BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF039P01

Length=982
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009597431.1|  PREDICTED: uncharacterized protein LOC104093402    120   2e-27   Nicotiana tomentosiformis
ref|XP_009801590.1|  PREDICTED: uncharacterized protein LOC104247...    119   7e-27   Nicotiana sylvestris
ref|XP_010657505.1|  PREDICTED: uncharacterized protein LOC104880931    111   1e-23   Vitis vinifera
emb|CBI28490.3|  unnamed protein product                                111   1e-23   Vitis vinifera
ref|XP_008462017.1|  PREDICTED: uncharacterized protein LOC103500...    103   3e-21   Cucumis melo [Oriental melon]
ref|XP_008462016.1|  PREDICTED: uncharacterized protein LOC103500...    103   3e-21   Cucumis melo [Oriental melon]
ref|XP_004144625.1|  PREDICTED: uncharacterized protein LOC101213119    103   5e-21   Cucumis sativus [cucumbers]
ref|XP_002510568.1|  hypothetical protein RCOM_1598630                  101   1e-20   
emb|CDP06141.1|  unnamed protein product                              96.7    1e-20   Coffea canephora [robusta coffee]
ref|XP_006493559.1|  PREDICTED: uncharacterized protein LOC102612342  94.7    9e-20   
ref|XP_004243220.1|  PREDICTED: uncharacterized protein LOC101252503  97.4    2e-19   Solanum lycopersicum
ref|XP_006366758.1|  PREDICTED: uncharacterized protein LOC102601...  96.7    2e-19   Solanum tuberosum [potatoes]
dbj|BAJ53106.1|  JHL20J20.13                                          97.8    4e-19   Jatropha curcas
gb|KFK33101.1|  hypothetical protein AALP_AA6G331300                  96.7    8e-19   Arabis alpina [alpine rockcress]
ref|XP_011467625.1|  PREDICTED: uncharacterized protein LOC101295...  95.5    1e-18   Fragaria vesca subsp. vesca
ref|XP_007049460.1|  Uncharacterized protein isoform 4                94.0    2e-18   
ref|NP_195998.2|  protein TRF-like 10                                 94.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CAB82943.1|  myb-like protein                                     94.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42517.1|  myb like protein                                     94.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KDO52378.1|  hypothetical protein CISIN_1g042922mg                 94.7    3e-18   Citrus sinensis [apfelsine]
ref|XP_007049457.1|  Uncharacterized protein isoform 1                94.7    4e-18   
ref|XP_007049458.1|  Uncharacterized protein isoform 2                94.4    4e-18   
ref|XP_002301900.2|  hypothetical protein POPTR_0002s00710g           93.6    7e-18   
gb|KFK42520.1|  hypothetical protein AALP_AA1G005200                  93.2    2e-17   Arabis alpina [alpine rockcress]
ref|XP_011034802.1|  PREDICTED: protein CHROMATIN REMODELING 4-li...  92.4    2e-17   Populus euphratica
gb|KFK42521.1|  hypothetical protein AALP_AA1G005200                  93.2    2e-17   Arabis alpina [alpine rockcress]
emb|CDY68656.1|  BnaCnng59970D                                        91.3    2e-17   Brassica napus [oilseed rape]
gb|KHG04639.1|  snRNA-activating complex subunit 4                    91.7    2e-17   Gossypium arboreum [tree cotton]
emb|CDX80850.1|  BnaC03g01040D                                        89.4    3e-17   
gb|KJB08733.1|  hypothetical protein B456_001G100000                  91.7    3e-17   Gossypium raimondii
gb|KJB08735.1|  hypothetical protein B456_001G100000                  92.0    3e-17   Gossypium raimondii
gb|KJB08734.1|  hypothetical protein B456_001G100000                  92.0    3e-17   Gossypium raimondii
ref|XP_011467630.1|  PREDICTED: uncharacterized protein LOC101295...  91.3    3e-17   Fragaria vesca subsp. vesca
ref|XP_006493556.1|  PREDICTED: uncharacterized protein LOC102610863  92.8    3e-17   Citrus sinensis [apfelsine]
ref|XP_010920081.1|  PREDICTED: uncharacterized protein LOC105044...  92.0    5e-17   Elaeis guineensis
ref|XP_010920082.1|  PREDICTED: uncharacterized protein LOC105044...  92.0    5e-17   Elaeis guineensis
ref|XP_006287565.1|  hypothetical protein CARUB_v10000776mg           90.9    7e-17   
gb|KJB42680.1|  hypothetical protein B456_007G163600                  88.2    7e-17   Gossypium raimondii
ref|XP_008775217.1|  PREDICTED: uncharacterized protein LOC103695626  91.3    9e-17   Phoenix dactylifera
ref|XP_002873113.1|  hypothetical protein ARALYDRAFT_487156           90.1    9e-17   
ref|XP_010689347.1|  PREDICTED: uncharacterized protein LOC104903...  90.9    9e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009151630.1|  PREDICTED: uncharacterized protein LOC103874944  89.7    1e-16   Brassica rapa
ref|XP_010689350.1|  PREDICTED: uncharacterized protein LOC104903...  90.1    1e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007216759.1|  hypothetical protein PRUPE_ppa024791mg           88.2    2e-16   Prunus persica
ref|XP_008229759.1|  PREDICTED: uncharacterized protein LOC103329108  87.8    3e-16   Prunus mume [ume]
ref|XP_010036112.1|  PREDICTED: uncharacterized protein LOC104425191  88.2    6e-16   Eucalyptus grandis [rose gum]
ref|XP_010930009.1|  PREDICTED: uncharacterized protein LOC105051333  85.9    6e-16   
gb|KHN37664.1|  hypothetical protein glysoja_007367                   85.9    9e-16   Glycine soja [wild soybean]
ref|XP_009111833.1|  PREDICTED: uncharacterized protein LOC103837245  86.7    1e-15   Brassica rapa
ref|XP_010252972.1|  PREDICTED: uncharacterized protein LOC104594...  87.4    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010252971.1|  PREDICTED: uncharacterized protein LOC104594...  87.4    1e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010266411.1|  PREDICTED: uncharacterized protein LOC104603935  87.4    2e-15   Nelumbo nucifera [Indian lotus]
emb|CDY19960.1|  BnaA09g02910D                                        86.3    2e-15   Brassica napus [oilseed rape]
ref|XP_010252969.1|  PREDICTED: uncharacterized protein LOC104594...  87.4    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010252970.1|  PREDICTED: uncharacterized protein LOC104594...  87.4    2e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006395199.1|  hypothetical protein EUTSA_v10004420mg           85.9    2e-15   
ref|XP_010452274.1|  PREDICTED: transcriptional regulator ATRX        86.7    2e-15   Camelina sativa [gold-of-pleasure]
emb|CDX86313.1|  BnaA06g30300D                                        87.0    3e-15   
ref|XP_004502098.1|  PREDICTED: uncharacterized protein LOC101494...  84.3    3e-15   
emb|CDY00068.1|  BnaC09g02330D                                        85.5    3e-15   
ref|XP_004502097.1|  PREDICTED: uncharacterized protein LOC101494...  84.7    3e-15   Cicer arietinum [garbanzo]
ref|XP_010423662.1|  PREDICTED: uncharacterized protein LOC104708745  85.5    3e-15   
ref|XP_004502096.1|  PREDICTED: uncharacterized protein LOC101494...  84.7    3e-15   
ref|XP_010112893.1|  hypothetical protein L484_017729                 85.1    5e-15   Morus notabilis
ref|XP_011082888.1|  PREDICTED: telomeric repeat-binding factor 1...  84.3    6e-15   
ref|XP_002863231.1|  predicted protein                                85.1    7e-15   
ref|XP_006594392.1|  PREDICTED: histone-lysine N-methyltransferas...  84.3    8e-15   Glycine max [soybeans]
gb|KHN27333.1|  hypothetical protein glysoja_031941                   84.3    1e-14   Glycine soja [wild soybean]
ref|XP_006283306.1|  hypothetical protein CARUB_v10004342mg           84.0    2e-14   Capsella rubella
ref|XP_006598111.1|  PREDICTED: neurofilament medium polypeptide-...  83.6    2e-14   Glycine max [soybeans]
ref|XP_004304663.2|  PREDICTED: uncharacterized protein LOC101308008  80.5    2e-14   Fragaria vesca subsp. vesca
ref|XP_006283305.1|  hypothetical protein CARUB_v10004342mg           84.0    2e-14   
ref|XP_010551981.1|  PREDICTED: uncharacterized protein LOC104822...  82.8    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_010551980.1|  PREDICTED: uncharacterized protein LOC104822...  82.8    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_003601481.1|  hypothetical protein MTR_3g082160                81.3    5e-14   
gb|AES71732.2|  myb-like DNA-binding domain protein                   81.3    5e-14   Medicago truncatula
gb|KCW47629.1|  hypothetical protein EUGRSUZ_K01371                   82.0    5e-14   Eucalyptus grandis [rose gum]
ref|XP_009401240.1|  PREDICTED: uncharacterized protein LOC103985...  82.8    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010653800.1|  PREDICTED: uncharacterized protein LOC100852566  82.4    6e-14   Vitis vinifera
emb|CAN80644.1|  hypothetical protein VITISV_016915                   82.4    6e-14   Vitis vinifera
ref|XP_009401239.1|  PREDICTED: uncharacterized protein LOC103985...  82.4    6e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_171623.1|  homeodomain-like protein with RING/FYVE/PHD-typ...  80.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395961.1|  hypothetical protein EUTSA_v10003829mg           80.9    2e-13   Eutrema salsugineum [saltwater cress]
gb|KFK24460.1|  hypothetical protein AALP_AAs46367U000300             80.5    2e-13   Arabis alpina [alpine rockcress]
gb|AAF26467.1|AC007323_8  T25K16.14                                   79.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122937.1|  PREDICTED: kinesin-related protein 11-like       80.1    3e-13   Brassica rapa
ref|XP_007202189.1|  hypothetical protein PRUPE_ppa026014mg           80.1    4e-13   
ref|NP_193003.2|  DNA binding protein                                 79.7    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008645113.1|  PREDICTED: uncharacterized protein LOC103626...  80.1    4e-13   
ref|XP_008240866.1|  PREDICTED: uncharacterized protein LOC103339362  78.6    4e-13   
gb|AFW69603.1|  putative homeodomain-like transcription factor su...  79.7    5e-13   
ref|XP_002889380.1|  hypothetical protein ARALYDRAFT_887342           77.8    5e-13   Arabidopsis lyrata subsp. lyrata
gb|AFW69604.1|  putative homeodomain-like transcription factor su...  79.7    5e-13   
gb|KDO45394.1|  hypothetical protein CISIN_1g0037502mg                79.0    8e-13   Citrus sinensis [apfelsine]
ref|XP_006493906.1|  PREDICTED: uncharacterized protein LOC102627...  79.0    9e-13   Citrus sinensis [apfelsine]
gb|KDO45393.1|  hypothetical protein CISIN_1g0037502mg                79.0    9e-13   Citrus sinensis [apfelsine]
ref|XP_010557729.1|  PREDICTED: uncharacterized protein LOC104826636  77.0    9e-13   Tarenaya hassleriana [spider flower]
ref|XP_004955692.1|  PREDICTED: uncharacterized protein LOC101784911  79.0    1e-12   Setaria italica
ref|XP_006421445.1|  hypothetical protein CICLE_v10004349mg           78.6    1e-12   Citrus clementina [clementine]
gb|EAY80933.1|  hypothetical protein OsI_36111                        78.6    1e-12   Oryza sativa Indica Group [Indian rice]
gb|EYU34385.1|  hypothetical protein MIMGU_mgv1a008782mg              77.4    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_006304037.1|  hypothetical protein CARUB_v10009814mg           77.0    1e-12   
ref|XP_006857950.1|  hypothetical protein AMTR_s00069p00165540        78.2    2e-12   
ref|XP_009334961.1|  PREDICTED: uncharacterized protein LOC103927742  78.2    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_009340161.1|  PREDICTED: uncharacterized protein LOC103932322  77.8    2e-12   
ref|XP_009149315.1|  PREDICTED: uncharacterized protein LOC103872635  75.5    2e-12   Brassica rapa
emb|CDY35078.1|  BnaA06g10880D                                        75.5    3e-12   Brassica napus [oilseed rape]
emb|CDY33345.1|  BnaC05g12380D                                        75.5    3e-12   Brassica napus [oilseed rape]
ref|XP_002463492.1|  hypothetical protein SORBIDRAFT_01g000725        72.8    3e-12   
emb|CAB40984.1|  putative protein                                     76.6    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004516066.1|  PREDICTED: uncharacterized protein LOC101508...  77.0    4e-12   
ref|XP_004516068.1|  PREDICTED: uncharacterized protein LOC101508...  77.0    4e-12   
ref|XP_006381017.1|  hypothetical protein POPTR_0006s05315g           70.9    5e-12   
gb|KDP30809.1|  hypothetical protein JCGZ_13752                       76.6    5e-12   Jatropha curcas
ref|XP_010235463.1|  PREDICTED: uncharacterized protein LOC100830...  76.3    6e-12   Brachypodium distachyon [annual false brome]
ref|XP_010532944.1|  PREDICTED: uncharacterized protein LOC104808...  75.9    6e-12   Tarenaya hassleriana [spider flower]
ref|XP_003572559.1|  PREDICTED: uncharacterized protein LOC100830...  76.3    6e-12   Brachypodium distachyon [annual false brome]
ref|XP_003561334.1|  PREDICTED: uncharacterized protein LOC100826621  76.3    7e-12   Brachypodium distachyon [annual false brome]
ref|XP_010474702.1|  PREDICTED: uncharacterized protein LOC104754259  75.1    8e-12   
gb|KDP26014.1|  hypothetical protein JCGZ_21047                       75.9    9e-12   Jatropha curcas
ref|XP_006663448.1|  PREDICTED: uncharacterized protein LOC102714137  75.5    1e-11   Oryza brachyantha
ref|XP_002526722.1|  conserved hypothetical protein                   75.1    1e-11   Ricinus communis
emb|CDP10065.1|  unnamed protein product                              74.7    3e-11   Coffea canephora [robusta coffee]
ref|NP_001065819.1|  Os11g0160700                                     74.3    3e-11   
gb|AAX95463.1|  hypothetical protein                                  74.3    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67726.1|  hypothetical protein OsI_35213                        74.3    4e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_008357975.1|  PREDICTED: trichohyalin-like                     73.6    4e-11   
ref|XP_011020329.1|  PREDICTED: uncharacterized protein LOC105122...  73.6    4e-11   Populus euphratica
ref|XP_011020333.1|  PREDICTED: uncharacterized protein LOC105122...  73.6    5e-11   Populus euphratica
ref|XP_011020332.1|  PREDICTED: uncharacterized protein LOC105122...  73.6    5e-11   Populus euphratica
ref|XP_010532943.1|  PREDICTED: uncharacterized protein LOC104808...  73.2    5e-11   Tarenaya hassleriana [spider flower]
ref|XP_010462525.1|  PREDICTED: uncharacterized protein LOC104743106  71.6    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_011087314.1|  PREDICTED: uncharacterized protein LOC105168...  72.8    1e-10   
ref|XP_011087312.1|  PREDICTED: uncharacterized protein LOC105168...  72.4    1e-10   Sesamum indicum [beniseed]
ref|XP_011072839.1|  PREDICTED: uncharacterized protein LOC105157...  72.0    2e-10   Sesamum indicum [beniseed]
ref|XP_011072836.1|  PREDICTED: uncharacterized protein LOC105157...  71.6    2e-10   
ref|XP_010480621.1|  PREDICTED: uncharacterized protein LOC104759...  70.9    2e-10   
ref|XP_010480615.1|  PREDICTED: uncharacterized protein LOC104759...  71.2    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002323310.1|  hypothetical protein POPTR_0016s05370g           71.6    3e-10   
ref|XP_011033306.1|  PREDICTED: uncharacterized protein LOC105131...  70.9    4e-10   Populus euphratica
ref|XP_008644307.1|  PREDICTED: uncharacterized protein LOC103625...  70.1    8e-10   Zea mays [maize]
ref|XP_008644308.1|  PREDICTED: uncharacterized protein LOC103625...  70.1    8e-10   Zea mays [maize]
ref|XP_007028830.1|  RING/FYVE/PHD zinc finger superfamily protei...  68.6    2e-09   
ref|XP_007028829.1|  RING/FYVE/PHD zinc finger superfamily protei...  68.2    3e-09   
gb|EYU46844.1|  hypothetical protein MIMGU_mgv1a012220mg              66.2    4e-09   Erythranthe guttata [common monkey flower]
ref|XP_002452154.1|  hypothetical protein SORBIDRAFT_04g020760        67.8    5e-09   Sorghum bicolor [broomcorn]
emb|CDM85276.1|  unnamed protein product                              67.4    5e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004952567.1|  PREDICTED: uncharacterized protein LOC101781636  67.0    9e-09   
gb|KHG06835.1|  PHD finger 21B                                        65.9    2e-08   Gossypium arboreum [tree cotton]
dbj|BAK00800.1|  predicted protein                                    66.2    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004249272.1|  PREDICTED: uncharacterized protein LOC101258507  65.9    2e-08   Solanum lycopersicum
ref|XP_006577901.1|  PREDICTED: uncharacterized protein LOC102661...  65.1    3e-08   Glycine max [soybeans]
ref|XP_009801592.1|  PREDICTED: uncharacterized protein LOC104247...  64.3    3e-08   Nicotiana sylvestris
ref|XP_010091860.1|  hypothetical protein L484_002387                 65.1    4e-08   
ref|XP_002451340.1|  hypothetical protein SORBIDRAFT_04g000347        64.3    4e-08   
ref|XP_001751753.1|  predicted protein                                64.7    4e-08   
gb|KJB36050.1|  hypothetical protein B456_006G138200                  64.3    5e-08   Gossypium raimondii
ref|XP_007145628.1|  hypothetical protein PHAVU_007G255000g           64.3    6e-08   Phaseolus vulgaris [French bean]
ref|XP_006364332.1|  PREDICTED: uncharacterized protein LOC102590076  64.3    7e-08   Solanum tuberosum [potatoes]
gb|KDO40422.1|  hypothetical protein CISIN_1g038943mg                 61.6    7e-08   Citrus sinensis [apfelsine]
gb|KJB36048.1|  hypothetical protein B456_006G138200                  63.9    8e-08   Gossypium raimondii
ref|XP_006827299.1|  hypothetical protein AMTR_s00010p00265560        60.8    5e-07   
gb|EYU23569.1|  hypothetical protein MIMGU_mgv1a003817mg              60.8    7e-07   Erythranthe guttata [common monkey flower]
ref|XP_009613453.1|  PREDICTED: uncharacterized protein LOC104106...  60.5    9e-07   Nicotiana tomentosiformis
ref|XP_010672772.1|  PREDICTED: uncharacterized protein LOC104889...  60.5    9e-07   
ref|XP_006351323.1|  PREDICTED: uncharacterized protein LOC102589...  60.8    9e-07   Solanum tuberosum [potatoes]
ref|XP_009804770.1|  PREDICTED: uncharacterized protein LOC104249...  60.5    1e-06   Nicotiana sylvestris
ref|XP_010672769.1|  PREDICTED: uncharacterized protein LOC104889...  60.5    1e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009613452.1|  PREDICTED: uncharacterized protein LOC104106...  60.5    1e-06   Nicotiana tomentosiformis
ref|XP_009613450.1|  PREDICTED: uncharacterized protein LOC104106...  60.5    1e-06   Nicotiana tomentosiformis
ref|XP_009804765.1|  PREDICTED: uncharacterized protein LOC104249...  60.5    1e-06   Nicotiana sylvestris
ref|XP_004302169.1|  PREDICTED: uncharacterized protein LOC101291...  58.2    2e-06   Fragaria vesca subsp. vesca
ref|XP_008892249.1|  hypothetical protein, variant                    57.4    4e-06   Phytophthora parasitica INRA-310
gb|ETK89389.1|  hypothetical protein, variant                         57.4    4e-06   Phytophthora parasitica
ref|XP_008892248.1|  hypothetical protein PPTG_02759                  57.0    8e-06   Phytophthora parasitica INRA-310
gb|ETI49504.1|  hypothetical protein F443_06662                       57.0    8e-06   Phytophthora parasitica P1569
ref|XP_001759833.1|  predicted protein                                57.8    8e-06   
gb|ETK89388.1|  hypothetical protein L915_06536                       57.0    9e-06   Phytophthora parasitica
ref|XP_006469394.1|  PREDICTED: uncharacterized protein LOC102624735  54.3    9e-06   
ref|XP_002999221.1|  conserved hypothetical protein                   55.5    4e-05   Phytophthora infestans T30-4
gb|EPS59795.1|  hypothetical protein M569_15011                       51.2    7e-05   Genlisea aurea
ref|XP_010031230.1|  PREDICTED: uncharacterized protein LOC104421...  54.3    8e-05   
gb|KCW83777.1|  hypothetical protein EUGRSUZ_B00647                   54.3    9e-05   Eucalyptus grandis [rose gum]
ref|XP_009587848.1|  PREDICTED: uncharacterized protein LOC104085...  53.5    1e-04   
ref|XP_010029695.1|  PREDICTED: telomeric repeat-binding factor 2...  53.5    2e-04   Eucalyptus grandis [rose gum]
gb|EPS72218.1|  hypothetical protein M569_02550                       52.8    2e-04   Genlisea aurea
gb|EMT27515.1|  Casein kinase I isoform delta-like protein            52.8    4e-04   
gb|EMS53431.1|  DNA (cytosine-5)-methyltransferase 1                  52.8    4e-04   Triticum urartu
ref|XP_009787002.1|  PREDICTED: uncharacterized protein LOC104235...  52.0    4e-04   Nicotiana sylvestris
ref|NP_001105597.1|  terminal acidic SANT 1                           52.0    5e-04   Zea mays [maize]
gb|AAV87181.1|  terminal acidic SANT 1                                48.1    5e-04   Zea mays [maize]
gb|EMT02974.1|  hypothetical protein F775_18538                       52.0    6e-04   
dbj|BAK06702.1|  predicted protein                                    51.2    7e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006350882.1|  PREDICTED: uncharacterized protein LOC102603861  51.2    8e-04   Solanum tuberosum [potatoes]
ref|XP_008659207.1|  PREDICTED: telomeric repeat-binding factor 1...  48.1    0.001   



>ref|XP_009597431.1| PREDICTED: uncharacterized protein LOC104093402 [Nicotiana tomentosiformis]
Length=384

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 105/169 (62%), Gaps = 8/169 (5%)
 Frame = -1

Query  541  QMQGKTRESAVPFANKEPESQLHMKAKRRDETGASTSREFEAVLGRRNRNKESNEIEGQP  362
            QM G  + +A  F N +P    ++K KRR ETG ST RE + V  +R   K  N++  + 
Sbjct  216  QMIGVDQTTAT-FLNADPSPLQNLKGKRRVETGDSTCRESKPVSTQRKPGKLVNKVRDEH  274

Query  361  LNSDS-KRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEE  185
            L +DS +R +RT+ S  + S L G+     +P      S L   + PNG+R++++W  EE
Sbjct  275  LVTDSPRRLTRTSASLLENSNLAGQLVQVKQP------SMLLPVELPNGKRKRVLWRHEE  328

Query  184  EEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            EEML+EGV +FS + NKNIPWRKIL+ GRHVF  TR P DLKDKW+ +C
Sbjct  329  EEMLEEGVKQFSTTVNKNIPWRKILELGRHVFDQTRNPTDLKDKWKQIC  377



>ref|XP_009801590.1| PREDICTED: uncharacterized protein LOC104247318 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009801591.1| PREDICTED: uncharacterized protein LOC104247318 isoform X1 [Nicotiana 
sylvestris]
Length=387

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 103/169 (61%), Gaps = 8/169 (5%)
 Frame = -1

Query  541  QMQGKTRESAVPFANKEPESQLHMKAKRRDETGASTSREFEAVLGRRNRNKESNEIEGQP  362
            QM G  + +A  F   +P    H+K KRR ETG ST  E + V  +R   K  N++  + 
Sbjct  219  QMIGADQTTAT-FLKADPSLLQHLKGKRRVETGDSTCSESKPVSTQRKPGKLVNKVRDEH  277

Query  361  LNSDS-KRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEE  185
            + +DS +R +RT+ S  + S L G+     +P      S L   + PNG+R++++W  EE
Sbjct  278  MVTDSPRRLTRTSASLLENSNLAGQLVQVKQP------SMLLPVELPNGKRKRVLWRHEE  331

Query  184  EEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            EEML+EGV +FS + NKNIPWRKIL+ GRHVF  TR P DLKDKW+ +C
Sbjct  332  EEMLEEGVKQFSTTVNKNIPWRKILELGRHVFDQTRTPTDLKDKWKQIC  380



>ref|XP_010657505.1| PREDICTED: uncharacterized protein LOC104880931 [Vitis vinifera]
 ref|XP_010657506.1| PREDICTED: uncharacterized protein LOC104880931 [Vitis vinifera]
Length=546

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 98/174 (56%), Gaps = 11/174 (6%)
 Frame = -1

Query  541  QMQGKTRESAVPFANKEPESQLHMKA----KRRDET-GASTSREFEAVLGRRNRNKESNE  377
            QMQ + +E+       +P S +H K     +  D   GA T    +  +G+R +NK    
Sbjct  372  QMQPQAQETTTAIPGGDPASLVHEKVNIGFRIIDSCRGARTLLTHQRHVGQRAKNK----  427

Query  376  IEGQPLNSDSKRSSRTAFSPKKFSG-LTGETSSPDKPKQAEEYSPLQRNQ-FPNGRRQKL  203
            +  Q ++S  K S     + +K +G  T E     K  Q    S    NQ FPN RR+KL
Sbjct  428  MVSQNVDSQKKSSPDLHNNAEKNAGDGTKEVIVSSKSIQPRGPSKQLTNQIFPNERRKKL  487

Query  202  MWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +W T+EEEML+EGV KFS + +KN+PWRKIL+FGRHVF  TR P DLKDKWR +
Sbjct  488  LWKTDEEEMLKEGVQKFSATGDKNLPWRKILEFGRHVFDGTRTPVDLKDKWRKM  541



>emb|CBI28490.3| unnamed protein product [Vitis vinifera]
Length=566

 Score =   111 bits (277),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 98/174 (56%), Gaps = 11/174 (6%)
 Frame = -1

Query  541  QMQGKTRESAVPFANKEPESQLHMKA----KRRDET-GASTSREFEAVLGRRNRNKESNE  377
            QMQ + +E+       +P S +H K     +  D   GA T    +  +G+R +NK    
Sbjct  392  QMQPQAQETTTAIPGGDPASLVHEKVNIGFRIIDSCRGARTLLTHQRHVGQRAKNK----  447

Query  376  IEGQPLNSDSKRSSRTAFSPKKFSG-LTGETSSPDKPKQAEEYSPLQRNQ-FPNGRRQKL  203
            +  Q ++S  K S     + +K +G  T E     K  Q    S    NQ FPN RR+KL
Sbjct  448  MVSQNVDSQKKSSPDLHNNAEKNAGDGTKEVIVSSKSIQPRGPSKQLTNQIFPNERRKKL  507

Query  202  MWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +W T+EEEML+EGV KFS + +KN+PWRKIL+FGRHVF  TR P DLKDKWR +
Sbjct  508  LWKTDEEEMLKEGVQKFSATGDKNLPWRKILEFGRHVFDGTRTPVDLKDKWRKM  561



>ref|XP_008462017.1| PREDICTED: uncharacterized protein LOC103500488 isoform X2 [Cucumis 
melo]
Length=488

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -1

Query  265  QAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFH  86
            Q+  ++  +   F  G+R+++ WS EEEEML+EGV KFS +ANKN+PWRKIL+FGRH+F 
Sbjct  411  QSASHNHFKSLDFHGGKRKRMRWSVEEEEMLREGVQKFSSTANKNLPWRKILEFGRHIFD  470

Query  85   PTRMPADLKDKWRTLCFR  32
             TR P DLKDKWR L  R
Sbjct  471  DTRTPVDLKDKWRNLLGR  488



>ref|XP_008462016.1| PREDICTED: uncharacterized protein LOC103500488 isoform X1 [Cucumis 
melo]
Length=499

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -1

Query  265  QAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFH  86
            Q+  ++  +   F  G+R+++ WS EEEEML+EGV KFS +ANKN+PWRKIL+FGRH+F 
Sbjct  422  QSASHNHFKSLDFHGGKRKRMRWSVEEEEMLREGVQKFSSTANKNLPWRKILEFGRHIFD  481

Query  85   PTRMPADLKDKWRTLCFR  32
             TR P DLKDKWR L  R
Sbjct  482  DTRTPVDLKDKWRNLLGR  499



>ref|XP_004144625.1| PREDICTED: uncharacterized protein LOC101213119 [Cucumis sativus]
 ref|XP_004167056.1| PREDICTED: uncharacterized LOC101213119 [Cucumis sativus]
 gb|KGN43387.1| hypothetical protein Csa_7G030500 [Cucumis sativus]
Length=510

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  265  QAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFH  86
            Q   ++ L+   F +G+R+++ WS EEEEML+EGV KFS + NKN+PWRKIL+FGRH+F 
Sbjct  433  QPASHNQLKSLDFHSGKRKRMRWSVEEEEMLKEGVRKFSSTTNKNLPWRKILEFGRHIFD  492

Query  85   PTRMPADLKDKWRTLCFR  32
             TR P DLKDKWR+L  R
Sbjct  493  DTRTPVDLKDKWRSLLGR  510



>ref|XP_002510568.1| hypothetical protein RCOM_1598630 [Ricinus communis]
 gb|EEF52755.1| hypothetical protein RCOM_1598630 [Ricinus communis]
Length=422

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 94/180 (52%), Gaps = 19/180 (11%)
 Frame = -1

Query  502  ANKEPESQLHMKAKRRDETGASTSREFEAVLGRRNRNKESNEIEGQPLNSDSKRSSRTAF  323
            A KE E  +H  A   + TG       + V      +   NE     L+   +R+++ A 
Sbjct  248  ARKEEEEGVHEDAPAANCTGG------DVVADVPKMSDSDNETLAARLSWAKQRANQKAN  301

Query  322  SPKKFSGLTGETSSPDKPKQAEEYSPLQRNQ-------------FPNGRRQKLMWSTEEE  182
            S KK S      S      Q E+  PL++++             FP+ +R++L W  EEE
Sbjct  302  STKKSSHHPDNISVEKARNQNEKVIPLKKSRQTQAPAKKLTNLSFPHEKRKRLHWKPEEE  361

Query  181  EMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLCFR*NSGSHFETM  2
            EML+EGV KFS + NKN+PW+KIL+FG HVF  +R PADLKDKWR +  + +S  +  T+
Sbjct  362  EMLREGVQKFSTTVNKNLPWKKILEFGHHVFDGSRTPADLKDKWRNIVAKDSSAVNGRTL  421



>emb|CDP06141.1| unnamed protein product [Coffea canephora]
Length=153

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            PN RR+ L W+  EEEML+EGV KFS   NKNIPWRKIL+FGRHVF  +R P DLKDKWR
Sbjct  87   PNARRKSLPWTDAEEEMLKEGVEKFSTDRNKNIPWRKILEFGRHVFDGSRTPVDLKDKWR  146

Query  46   TL  41
             +
Sbjct  147  NI  148



>ref|XP_006493559.1| PREDICTED: uncharacterized protein LOC102612342 [Citrus sinensis]
Length=167

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F + +R++L W+ EEEEML+EGV KFS   NKN+PW+K+L+FG  VF PTR P+DLKDKW
Sbjct  94   FASEKRRRLHWTAEEEEMLKEGVEKFSTKVNKNLPWKKVLEFGCDVFDPTRTPSDLKDKW  153

Query  49   RTLCFR*NSG  20
            R +  R +S 
Sbjct  154  RNIMSRESSA  163



>ref|XP_004243220.1| PREDICTED: uncharacterized protein LOC101252503 [Solanum lycopersicum]
Length=402

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 93/164 (57%), Gaps = 6/164 (4%)
 Frame = -1

Query  529  KTRESAVPFANKEPESQLHMKAKRRDETGASTSREFEAVLGRRNRNKESNEIEGQPLNSD  350
            K  ++     + +P  Q H+  KRR ET   T R+ + V  +R   K+ N++  + + +D
Sbjct  238  KVDQTTAIVIHTDPLLQQHLHGKRRAETVDLTCRKSKRVSTQRKCGKQVNKVRDEHMLTD  297

Query  349  SKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQ  170
              R        +K + L    ++     Q ++ S L  +  PNG+R++++W  EEEEM++
Sbjct  298  FPR-----MLTRKSASLLENDNAAGMFVQVKKPSTLP-DILPNGQRKRVLWRREEEEMIE  351

Query  169  EGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            EGV KFS   NKN PWRKILDFG HVF  +R P DLKDKW+ +C
Sbjct  352  EGVQKFSSKVNKNTPWRKILDFGHHVFDHSRTPTDLKDKWKQMC  395



>ref|XP_006366758.1| PREDICTED: uncharacterized protein LOC102601593 isoform X1 [Solanum 
tuberosum]
 ref|XP_006366759.1| PREDICTED: uncharacterized protein LOC102601593 isoform X2 [Solanum 
tuberosum]
 ref|XP_006366760.1| PREDICTED: uncharacterized protein LOC102601593 isoform X3 [Solanum 
tuberosum]
 ref|XP_006366761.1| PREDICTED: uncharacterized protein LOC102601593 isoform X4 [Solanum 
tuberosum]
Length=386

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 88/152 (58%), Gaps = 6/152 (4%)
 Frame = -1

Query  493  EPESQLHMKAKRRDETGASTSREFEAVLGRRNRNKESNEIEGQPLNSDSKRSSRTAFSPK  314
            +P  Q H+  KRR ET   T  E + V  +R   K   +++ + + +DS R        +
Sbjct  234  DPSLQQHLHGKRRAETADLTCGESKRVSTQRECGKRVKKVKDEHMLTDSPR-----MLTR  288

Query  313  KFSGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANK  134
            K + L    ++     Q +  S L  +  PNG+R++++W +EEEEM++EGV KFS   NK
Sbjct  289  KSASLLENGNAAGMFVQVKHPSMLP-DILPNGKRRRVLWRSEEEEMIEEGVQKFSSKVNK  347

Query  133  NIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            N PWRKILDFG HVF  +R P DLKDKW+ +C
Sbjct  348  NTPWRKILDFGHHVFDHSRTPTDLKDKWKQMC  379



>dbj|BAJ53106.1| JHL20J20.13 [Jatropha curcas]
 gb|KDP36896.1| hypothetical protein JCGZ_08187 [Jatropha curcas]
Length=531

 Score = 97.8 bits (242),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F + +R++L+W  EEEEML+EGV KFS   NKN+PWRKIL+FGRHVF  +R P+DLKDKW
Sbjct  463  FSHEKRKRLLWRPEEEEMLREGVQKFSSKVNKNLPWRKILEFGRHVFDASRSPSDLKDKW  522

Query  49   RTL  41
            R L
Sbjct  523  RNL  525



>gb|KFK33101.1| hypothetical protein AALP_AA6G331300 [Arabis alpina]
Length=491

 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 95/162 (59%), Gaps = 17/162 (10%)
 Frame = -1

Query  499  NKEPESQLHMKAKRRDETGASTSREFEAVLGRRNRNKESNEIEGQ----PLNSDSKRSSR  332
            +K PE Q  +  K+R+ +   + +E  +  G+ +   + NE +G      LN+     S 
Sbjct  330  DKTPEVQTKVAGKKREVSPVLSMQE--SFSGKEHGQVQQNEKQGSRRRLILNATDSEFSS  387

Query  331  TAFSPKKFSG---LTGETSSPDKPKQAEEYSPLQR--NQFPNGRRQKLMWSTEEEEMLQE  167
            T    K+ +G   +T ETSS    K A +  P+ R  + F   +R++L+W+ EEEEML+ 
Sbjct  388  T----KERNGEEDVTKETSSS--TKVANKSKPVAREISFFNKDQRRRLLWTPEEEEMLKV  441

Query  166  GVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            GV +F+  ANKN+PWRKIL+ G +VFH TR PADLKDKWR +
Sbjct  442  GVERFAAEANKNMPWRKILEMGENVFHETRTPADLKDKWRNM  483



>ref|XP_011467625.1| PREDICTED: uncharacterized protein LOC101295436 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467626.1| PREDICTED: uncharacterized protein LOC101295436 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467627.1| PREDICTED: uncharacterized protein LOC101295436 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467628.1| PREDICTED: uncharacterized protein LOC101295436 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467629.1| PREDICTED: uncharacterized protein LOC101295436 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=449

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F NGRR++  W+ +E +ML+EGV  FS   NKNIPWRKI D G HVFH TR P +LKDKW
Sbjct  377  FHNGRRRRFNWTADELKMLKEGVQLFSARVNKNIPWRKIFDHGSHVFHKTRTPDNLKDKW  436

Query  49   RTLC  38
            + LC
Sbjct  437  KVLC  440



>ref|XP_007049460.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 ref|XP_007049461.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX93617.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX93618.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=361

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +R++L W+ EEE+ML+EGV +FS   NKNIPWRKIL+FG HVFH TR P DLKDKW+ +
Sbjct  296  KRRRLHWTAEEEDMLKEGVRRFSSIVNKNIPWRKILEFGHHVFHSTRTPVDLKDKWKNI  354



>ref|NP_195998.2| protein TRF-like 10 [Arabidopsis thaliana]
 dbj|BAH30573.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90653.1| protein TRF-like 10 [Arabidopsis thaliana]
Length=420

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   +R++L+W+ EEEEML+ GV KF+  ANKN+PWRKIL+ G  VFH TR PADLKDKW
Sbjct  340  FKMDQRRRLLWTYEEEEMLKVGVEKFAAEANKNMPWRKILEMGEKVFHETRTPADLKDKW  399

Query  49   RTL  41
            R++
Sbjct  400  RSM  402



>emb|CAB82943.1| myb-like protein [Arabidopsis thaliana]
 dbj|BAB08603.1| Myb-like protein [Arabidopsis thaliana]
 gb|AAS10013.1| MYB transcription factor [Arabidopsis thaliana]
Length=412

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   +R++L+W+ EEEEML+ GV KF+  ANKN+PWRKIL+ G  VFH TR PADLKDKW
Sbjct  332  FKMDQRRRLLWTYEEEEMLKVGVEKFAAEANKNMPWRKILEMGEKVFHETRTPADLKDKW  391

Query  49   RTL  41
            R++
Sbjct  392  RSM  394



>dbj|BAC42517.1| myb like protein [Arabidopsis thaliana]
Length=420

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   +R++L+W+ EEEEML+ GV KF+  ANKN+PWRKIL+ G  VFH TR PADLKDKW
Sbjct  340  FKMDQRRRLLWTYEEEEMLKVGVEKFAAEANKNMPWRKILEMGEKVFHETRTPADLKDKW  399

Query  49   RTL  41
            R++
Sbjct  400  RSM  402



>gb|KDO52378.1| hypothetical protein CISIN_1g042922mg [Citrus sinensis]
Length=452

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F + +R++L W+ EEEEML+EGV KFS   NKN+PW+K+L+FG  VF PTR P+DLKDKW
Sbjct  379  FASEKRRRLHWTAEEEEMLKEGVEKFSTKVNKNLPWKKVLEFGCDVFDPTRTPSDLKDKW  438

Query  49   RTLCFR  32
            R +  R
Sbjct  439  RNIMSR  444



>ref|XP_007049457.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX93614.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=502

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +R++L W+ EEE+ML+EGV +FS   NKNIPWRKIL+FG HVFH TR P DLKDKW+ +
Sbjct  437  KRRRLHWTAEEEDMLKEGVRRFSSIVNKNIPWRKILEFGHHVFHSTRTPVDLKDKWKNI  495



>ref|XP_007049458.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 ref|XP_007049459.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX93615.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX93616.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=487

 Score = 94.4 bits (233),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +R++L W+ EEE+ML+EGV +FS   NKNIPWRKIL+FG HVFH TR P DLKDKW+ +
Sbjct  422  KRRRLHWTAEEEDMLKEGVRRFSSIVNKNIPWRKILEFGHHVFHSTRTPVDLKDKWKNI  480



>ref|XP_002301900.2| hypothetical protein POPTR_0002s00710g [Populus trichocarpa]
 gb|EEE81173.2| hypothetical protein POPTR_0002s00710g [Populus trichocarpa]
Length=472

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = -1

Query  271  PKQAEEYSPLQRNQFP-NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRH  95
            P+Q  E   +  N +P N +RQ+L W+ +EE+ L+EGV KF+I  NKN PWRKIL+FG  
Sbjct  393  PRQRLESPKISSNLYPRNEKRQRLNWTADEEDTLKEGVEKFAIPGNKNTPWRKILEFGHR  452

Query  94   VFHPTRMPADLKDKWRTL  41
            VF  TR P DLKDKWR +
Sbjct  453  VFDSTRTPTDLKDKWRNM  470



>gb|KFK42520.1| hypothetical protein AALP_AA1G005200 [Arabis alpina]
Length=794

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   +R++++W++EEE+ML  GV KF+  AN+N+PWRKIL+ G+HVFH TR PA LKDKW
Sbjct  728  FNKDQRRRILWTSEEEDMLTAGVEKFAAEANRNMPWRKILEMGKHVFHETRNPASLKDKW  787

Query  49   RTL  41
            R +
Sbjct  788  RNM  790



>ref|XP_011034802.1| PREDICTED: protein CHROMATIN REMODELING 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011034803.1| PREDICTED: protein CHROMATIN REMODELING 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011034805.1| PREDICTED: protein CHROMATIN REMODELING 4-like isoform X1 [Populus 
euphratica]
Length=480

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = -1

Query  271  PKQAEEYSPLQRNQFP-NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRH  95
            P+Q  E   +  N +P N +RQ+L W+ +EE+ L+EGV KF+I  NKN PWRKIL++G  
Sbjct  401  PRQRLESPKISSNLYPRNEKRQRLNWTADEEDTLKEGVEKFAIPGNKNTPWRKILEYGHR  460

Query  94   VFHPTRMPADLKDKWRTL  41
            VF  TR P DLKDKWR +
Sbjct  461  VFDSTRTPTDLKDKWRNM  478



>gb|KFK42521.1| hypothetical protein AALP_AA1G005200 [Arabis alpina]
Length=770

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   +R++++W++EEE+ML  GV KF+  AN+N+PWRKIL+ G+HVFH TR PA LKDKW
Sbjct  704  FNKDQRRRILWTSEEEDMLTAGVEKFAAEANRNMPWRKILEMGKHVFHETRNPASLKDKW  763

Query  49   RTL  41
            R +
Sbjct  764  RNM  766



>emb|CDY68656.1| BnaCnng59970D [Brassica napus]
Length=394

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -1

Query  244  LQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPAD  65
            L  + F   +R++L W+ EEEEML+ GV KFS  A KN+PWRKIL+ G+ VFH TR PAD
Sbjct  317  LDMSSFKTDQRKRLFWTPEEEEMLKVGVEKFSAEAKKNMPWRKILEMGQDVFHETRTPAD  376

Query  64   LKDKWR  47
            LKDKWR
Sbjct  377  LKDKWR  382



>gb|KHG04639.1| snRNA-activating complex subunit 4 [Gossypium arboreum]
Length=420

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +R++L W+ EEE+ML+E VHKFS   NKNIPWRKIL+ GR VFH TR+P DLKDKW+ +
Sbjct  354  KRRRLHWTAEEEDMLKELVHKFSSQVNKNIPWRKILEHGRPVFHSTRIPVDLKDKWKNI  412



>emb|CDX80850.1| BnaC03g01040D [Brassica napus]
Length=269

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            + ++L+W+ EEEEML+ GV KF+  ANKNIPWRKIL+ G+ VF PTR PADLKDKWR
Sbjct  210  KNRRLLWTPEEEEMLRMGVKKFAAEANKNIPWRKILEMGQTVFQPTRTPADLKDKWR  266



>gb|KJB08733.1| hypothetical protein B456_001G100000 [Gossypium raimondii]
Length=457

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +R++L W+ EEE+ML+E VHKFS   NKNIPWRKIL+ GR VFH TR+P DLKDKW+ +
Sbjct  391  KRRRLHWTAEEEDMLKELVHKFSSQVNKNIPWRKILEHGRPVFHSTRIPVDLKDKWKNI  449



>gb|KJB08735.1| hypothetical protein B456_001G100000 [Gossypium raimondii]
Length=517

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +R++L W+ EEE+ML+E VHKFS   NKNIPWRKIL+ GR VFH TR+P DLKDKW+ +
Sbjct  451  KRRRLHWTAEEEDMLKELVHKFSSQVNKNIPWRKILEHGRPVFHSTRIPVDLKDKWKNI  509



>gb|KJB08734.1| hypothetical protein B456_001G100000 [Gossypium raimondii]
Length=530

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +R++L W+ EEE+ML+E VHKFS   NKNIPWRKIL+ GR VFH TR+P DLKDKW+ +
Sbjct  464  KRRRLHWTAEEEDMLKELVHKFSSQVNKNIPWRKILEHGRPVFHSTRIPVDLKDKWKNI  522



>ref|XP_011467630.1| PREDICTED: uncharacterized protein LOC101295436 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=440

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 1/82 (1%)
 Frame = -1

Query  280  PDKPKQAEEYSPLQRNQFP-NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDF  104
            PD  +  +  S  +  + P +GRR++  W+ +E +ML+EGV  FS   NKNIPWRKI D 
Sbjct  350  PDSNQNEKTTSSTEPIKVPESGRRRRFNWTADELKMLKEGVQLFSARVNKNIPWRKIFDH  409

Query  103  GRHVFHPTRMPADLKDKWRTLC  38
            G HVFH TR P +LKDKW+ LC
Sbjct  410  GSHVFHKTRTPDNLKDKWKVLC  431



>ref|XP_006493556.1| PREDICTED: uncharacterized protein LOC102610863 [Citrus sinensis]
Length=1085

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 52/149 (35%), Positives = 79/149 (53%), Gaps = 5/149 (3%)
 Frame = -1

Query  466   AKRRDETGASTSREFEAVLGRRNRNKESNEIEGQPLNSDSKRSSRTAFSPKKFSGLTGET  287
             +K+    G  + R+      R ++     + + Q ++S  K S     + +K +    E 
Sbjct  938   SKKAQSRGVDSPRKL-----RSSKGANPKKTKSQNVDSSKKLSPPKGANSEKIAQARNEK  992

Query  286   SSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILD  107
             S+  K              F + +R++L W+ EEEEML+EGV KFS   NKN+PW+K+L+
Sbjct  993   STASKKSTQVSGGKFTNFTFASEKRRRLHWTAEEEEMLKEGVEKFSTKVNKNLPWKKVLE  1052

Query  106   FGRHVFHPTRMPADLKDKWRTLCFR*NSG  20
             FG  VF PTR P+DLKDKWR +  R +S 
Sbjct  1053  FGCDVFDPTRTPSDLKDKWRNIMSRESSA  1081



>ref|XP_010920081.1| PREDICTED: uncharacterized protein LOC105044011 isoform X1 [Elaeis 
guineensis]
Length=799

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P+GRR+KL W+ +EEE L++ V KFS++++  +PW KIL+FGR VFH TR P DLKDKW
Sbjct  726  IPSGRRKKLAWTVQEEEALKDAVQKFSVNSDGTLPWTKILEFGRRVFHKTRQPGDLKDKW  785

Query  49   RTL  41
            R +
Sbjct  786  RNI  788



>ref|XP_010920082.1| PREDICTED: uncharacterized protein LOC105044011 isoform X2 [Elaeis 
guineensis]
Length=798

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P+GRR+KL W+ +EEE L++ V KFS++++  +PW KIL+FGR VFH TR P DLKDKW
Sbjct  725  IPSGRRKKLAWTVQEEEALKDAVQKFSVNSDGTLPWTKILEFGRRVFHKTRQPGDLKDKW  784

Query  49   RTL  41
            R +
Sbjct  785  RNI  787



>ref|XP_006287565.1| hypothetical protein CARUB_v10000776mg, partial [Capsella rubella]
 gb|EOA20463.1| hypothetical protein CARUB_v10000776mg, partial [Capsella rubella]
Length=503

 Score = 90.9 bits (224),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   +R++L+W+ EEEEML+ GV KF+  ANKN+PWRKIL+ G  VFH TR P+DLKDKW
Sbjct  427  FNKDQRRRLLWTFEEEEMLKVGVEKFAAEANKNMPWRKILEMGEKVFHETRTPSDLKDKW  486

Query  49   RTL  41
            R +
Sbjct  487  RNM  489



>gb|KJB42680.1| hypothetical protein B456_007G163600 [Gossypium raimondii]
Length=280

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  223  NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRT  44
            N +R++L W+ EEE++L+EGV +FS++ NKNIPWRKIL+FG +VF   R+P DLKDKW+ 
Sbjct  202  NVKRRRLHWTVEEEDILKEGVQRFSLTMNKNIPWRKILEFGHNVFGTNRLPVDLKDKWKK  261

Query  43   L  41
            +
Sbjct  262  I  262



>ref|XP_008775217.1| PREDICTED: uncharacterized protein LOC103695626, partial [Phoenix 
dactylifera]
Length=715

 Score = 91.3 bits (225),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P+GRR+KL W+ EEEE L++ V KF+ + +  +PW KIL+FGRHVFH TR P DLKDKW
Sbjct  642  IPSGRRRKLAWTVEEEEALKDVVPKFAANGDGTLPWTKILEFGRHVFHRTRQPGDLKDKW  701

Query  49   RTL  41
            R +
Sbjct  702  RNI  704



>ref|XP_002873113.1| hypothetical protein ARALYDRAFT_487156 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49372.1| hypothetical protein ARALYDRAFT_487156 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 65/115 (57%), Gaps = 5/115 (4%)
 Frame = -1

Query  385  SNEIEGQPLNSDSKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQK  206
            SNE  G+ +      S++      K       T+   K K   + S   ++Q     R++
Sbjct  304  SNERNGEDVTEQITSSAQVTSPSGKMKNQQATTNVAAKSKTVRDISFFMKDQ-----RRR  358

Query  205  LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            L+W+ +EEEML+ GV KF+  A KN+PWRKIL+ G  VFH TR PADLKDKWR +
Sbjct  359  LLWTYKEEEMLKVGVEKFAADAKKNMPWRKILEMGEKVFHETRTPADLKDKWRNM  413



>ref|XP_010689347.1| PREDICTED: uncharacterized protein LOC104903070 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=555

 Score = 90.9 bits (224),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -1

Query  265  QAEEYSPLQRNQ-FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVF  89
            + E    +QR+   P  RR+KL W+ +E  ML+EGV KFS++A+KN+PW KI++FGRH+F
Sbjct  472  KVESIKQIQRSTILPVERRRKLPWTVQEVTMLKEGVQKFSLTAHKNLPWMKIMEFGRHIF  531

Query  88   HPTRMPADLKDKWRTL  41
              TR P DLKDKW+ +
Sbjct  532  DGTRTPVDLKDKWKNI  547



>ref|XP_009151630.1| PREDICTED: uncharacterized protein LOC103874944 [Brassica rapa]
Length=401

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 5/81 (6%)
 Frame = -1

Query  289  TSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKIL  110
            T+   K K   + S L+ +Q     R++L W+ EEEEML+ GV KFS  A KN+PWRKIL
Sbjct  314  TTQVAKSKTVRDMSSLKTDQ-----RKRLFWTPEEEEMLKVGVEKFSAEAKKNMPWRKIL  368

Query  109  DFGRHVFHPTRMPADLKDKWR  47
            + G  VFH TR PADLKDKWR
Sbjct  369  EMGAEVFHETRTPADLKDKWR  389



>ref|XP_010689350.1| PREDICTED: uncharacterized protein LOC104903070 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=522

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P  RR+KL W+ +E  ML+EGV KFS++A+KN+PW KI++FGRH+F  TR P DLKDKW
Sbjct  452  LPVERRRKLPWTVQEVTMLKEGVQKFSLTAHKNLPWMKIMEFGRHIFDGTRTPVDLKDKW  511

Query  49   RTL  41
            + +
Sbjct  512  KNI  514



>ref|XP_007216759.1| hypothetical protein PRUPE_ppa024791mg [Prunus persica]
 gb|EMJ17958.1| hypothetical protein PRUPE_ppa024791mg [Prunus persica]
Length=358

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 64/114 (56%), Gaps = 12/114 (11%)
 Frame = -1

Query  340  SSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQ-----------FPNGRRQKLMWS  194
            S RT  SP + S     +   D  KQ E+     + +            PNG+R+KL W+
Sbjct  245  SLRTVPSPSRESSSCQTSFVEDSKKQNEKAKTFSKKEIEDHEFARNLVLPNGKRKKLNWT  304

Query  193  TEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLCFR  32
             EE EML+EGV  +  +  K IPW +IL+FG +VFH TR+PADLKDKWR L  R
Sbjct  305  GEEVEMLKEGVRIYK-AKGKKIPWTQILEFGHNVFHITRLPADLKDKWRNLIGR  357



>ref|XP_008229759.1| PREDICTED: uncharacterized protein LOC103329108 [Prunus mume]
Length=358

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 63/114 (55%), Gaps = 12/114 (11%)
 Frame = -1

Query  340  SSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQ-----------FPNGRRQKLMWS  194
            S RT  SP + S     +   D  KQ EE     + +            PNG+R+KL W+
Sbjct  245  SLRTVPSPSRESSSCQTSFVEDSRKQNEEAKTFSKKEIEDHEFARNLVLPNGKRKKLNWT  304

Query  193  TEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLCFR  32
             EE EML+EGV  +  +  K IPW +IL+FG +VFH TR+P DLKDKWR L  R
Sbjct  305  GEEVEMLKEGVRIYK-AKGKKIPWTQILEFGHNVFHITRLPVDLKDKWRNLIGR  357



>ref|XP_010036112.1| PREDICTED: uncharacterized protein LOC104425191 [Eucalyptus grandis]
 gb|KCW47628.1| hypothetical protein EUGRSUZ_K01371 [Eucalyptus grandis]
Length=492

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -1

Query  214  RQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLCF  35
            +++L WS EEEE+L+EGV  FS +ANKNIPWRKIL++G  VF+P+R P DLKDKW+ +  
Sbjct  431  KRRLRWSPEEEEILKEGVQLFSSNANKNIPWRKILEYGCRVFNPSRTPVDLKDKWKNIAT  490

Query  34   R  32
            R
Sbjct  491  R  491



>ref|XP_010930009.1| PREDICTED: uncharacterized protein LOC105051333 [Elaeis guineensis]
Length=302

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 50/73 (68%), Gaps = 5/73 (7%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P+GRR+KL W+ +EEE L++ V KFS++++  +PW KIL+FG  VFH T  P DLKDKW
Sbjct  155  IPSGRRKKLAWTVQEEEALKDAVQKFSVNSDGTLPWTKILEFGCRVFHKTHQPGDLKDKW  214

Query  49   RTL-----CFR*N  26
            R +     C R N
Sbjct  215  RNIQISVRCIRLN  227



>gb|KHN37664.1| hypothetical protein glysoja_007367 [Glycine soja]
Length=316

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  220  GRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
             +R++L+W+ EEE++L+EGV KFS + N+NIPWRKIL+FG  VF  TR P DLKDKW+ +
Sbjct  242  AKRKRLLWTAEEEKVLKEGVSKFS-TENQNIPWRKILEFGCRVFDETRTPVDLKDKWKNI  300



>ref|XP_009111833.1| PREDICTED: uncharacterized protein LOC103837245 [Brassica rapa]
Length=423

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   ++++L+W+ EEE ML+ GV KFS  A KNIPWRKIL+ G+ VFH TR P+DLKDKW
Sbjct  344  FKMDQKRRLLWTPEEEYMLKVGVEKFSAEAKKNIPWRKILEMGQKVFHETRTPSDLKDKW  403

Query  49   RTL  41
            R +
Sbjct  404  RNM  406



>ref|XP_010252972.1| PREDICTED: uncharacterized protein LOC104594379 isoform X4 [Nelumbo 
nucifera]
Length=813

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            RR+KL W  EEEE L++GV  FS + NKNIPWRKIL+FG +VF  TR P DLKDKW+ +
Sbjct  745  RRKKLPWKAEEEETLKKGVQMFSTTVNKNIPWRKILEFGANVFDGTRTPVDLKDKWKNI  803



>ref|XP_010252971.1| PREDICTED: uncharacterized protein LOC104594379 isoform X3 [Nelumbo 
nucifera]
Length=815

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            RR+KL W  EEEE L++GV  FS + NKNIPWRKIL+FG +VF  TR P DLKDKW+ +
Sbjct  745  RRKKLPWKAEEEETLKKGVQMFSTTVNKNIPWRKILEFGANVFDGTRTPVDLKDKWKNI  803



>ref|XP_010266411.1| PREDICTED: uncharacterized protein LOC104603935 [Nelumbo nucifera]
 ref|XP_010266413.1| PREDICTED: uncharacterized protein LOC104603935 [Nelumbo nucifera]
 ref|XP_010266414.1| PREDICTED: uncharacterized protein LOC104603935 [Nelumbo nucifera]
Length=936

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 55/84 (65%), Gaps = 4/84 (5%)
 Frame = -1

Query  292  ETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKI  113
            + SS D  +  +  SP    +FP+ RR K  W+ EEEE+L EGV +FS +  K  PW+KI
Sbjct  848  DISSNDSSRDQKPISP----KFPSLRRTKNPWTAEEEEILLEGVKRFSSTDGKGFPWKKI  903

Query  112  LDFGRHVFHPTRMPADLKDKWRTL  41
            L+FG HVFH TR P DLKDK+R +
Sbjct  904  LEFGCHVFHKTRTPVDLKDKYRNI  927



>emb|CDY19960.1| BnaA09g02910D [Brassica napus]
Length=424

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   ++++L+W+ EEE ML+ GV KFS  A KNIPWRKIL+ G+ VFH TR P+DLKDKW
Sbjct  345  FKMDQKRRLLWTPEEEYMLKVGVEKFSAEAKKNIPWRKILEMGQKVFHETRTPSDLKDKW  404

Query  49   RTL  41
            R +
Sbjct  405  RNM  407



>ref|XP_010252969.1| PREDICTED: uncharacterized protein LOC104594379 isoform X1 [Nelumbo 
nucifera]
Length=846

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            RR+KL W  EEEE L++GV  FS + NKNIPWRKIL+FG +VF  TR P DLKDKW+ +
Sbjct  745  RRKKLPWKAEEEETLKKGVQMFSTTVNKNIPWRKILEFGANVFDGTRTPVDLKDKWKNI  803



>ref|XP_010252970.1| PREDICTED: uncharacterized protein LOC104594379 isoform X2 [Nelumbo 
nucifera]
Length=843

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            RR+KL W  EEEE L++GV  FS + NKNIPWRKIL+FG +VF  TR P DLKDKW+ +
Sbjct  745  RRKKLPWKAEEEETLKKGVQMFSTTVNKNIPWRKILEFGANVFDGTRTPVDLKDKWKNI  803



>ref|XP_006395199.1| hypothetical protein EUTSA_v10004420mg [Eutrema salsugineum]
 gb|ESQ32485.1| hypothetical protein EUTSA_v10004420mg [Eutrema salsugineum]
Length=374

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 71/120 (59%), Gaps = 4/120 (3%)
 Frame = -1

Query  394  NKESNEIEGQPLNSDSKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQ--FPN  221
            N+ ++E  G+ +   S  S++   SP +   +  +    +   +    S + RN   F  
Sbjct  253  NESTSEWNGEDVTEQSTSSAQIVNSPSR--KMKNQQRKHNGTTKVRVASWICRNISFFKK  310

Query  220  GRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
             +R++L W++EEEEML+ GV KF+  A KN+PW+KIL+ G  VFH TR P+DLKDKWR +
Sbjct  311  DQRRRLFWTSEEEEMLKVGVEKFAPEAKKNMPWKKILEMGEKVFHETRTPSDLKDKWRNM  370



>ref|XP_010452274.1| PREDICTED: transcriptional regulator ATRX [Camelina sativa]
Length=486

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   +R++L W+ EEEEML+ GV KF+  A KN+PWRKIL+ G  VF  TR PADLKDKW
Sbjct  416  FKKDQRRRLFWTFEEEEMLKVGVEKFAAEAKKNMPWRKILEMGEKVFDETRTPADLKDKW  475

Query  49   RTL  41
            R +
Sbjct  476  RNM  478



>emb|CDX86313.1| BnaA06g30300D [Brassica napus]
Length=1520

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  217   RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
             +R++L W+ EEEEML+ GV KFS  A KN+PWRKIL+ G  VFH TR PADLKDKWR
Sbjct  1452  QRKRLFWTPEEEEMLKVGVEKFSAEAKKNMPWRKILEMGAEVFHETRTPADLKDKWR  1508



>ref|XP_004502098.1| PREDICTED: uncharacterized protein LOC101494287 isoform X3 [Cicer 
arietinum]
Length=321

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -1

Query  220  GRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            G+R++L W+ EEE+ L+EGV KFS + N+NIPWRKIL+FG  VF  TR P DLKDKWR +
Sbjct  253  GKRRRLFWTAEEEKTLKEGVLKFS-TGNQNIPWRKILEFGCRVFDNTRTPVDLKDKWRNM  311



>emb|CDY00068.1| BnaC09g02330D [Brassica napus]
Length=422

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   ++++L+W+ EEE ML+ GV KF+  A KNIPWRKIL+ G+ VFH TR P+DLKDKW
Sbjct  347  FKMDQKRRLLWTPEEEYMLKVGVEKFAAKAKKNIPWRKILEMGQKVFHETRTPSDLKDKW  406

Query  49   RTL  41
            R +
Sbjct  407  RNM  409



>ref|XP_004502097.1| PREDICTED: uncharacterized protein LOC101494287 isoform X2 [Cicer 
arietinum]
Length=343

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -1

Query  220  GRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            G+R++L W+ EEE+ L+EGV KFS + N+NIPWRKIL+FG  VF  TR P DLKDKWR +
Sbjct  279  GKRRRLFWTAEEEKTLKEGVLKFS-TGNQNIPWRKILEFGCRVFDNTRTPVDLKDKWRNM  337



>ref|XP_010423662.1| PREDICTED: uncharacterized protein LOC104708745 [Camelina sativa]
Length=416

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   +R++L W+ EEEEML+ GV KF+  A KN+PWRKIL+ G  VF  TR PADLKDKW
Sbjct  346  FKKDQRRRLFWTFEEEEMLKVGVEKFAAEAKKNMPWRKILEMGEKVFDETRTPADLKDKW  405

Query  49   RTL  41
            R +
Sbjct  406  RNM  408



>ref|XP_004502096.1| PREDICTED: uncharacterized protein LOC101494287 isoform X1 [Cicer 
arietinum]
Length=347

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -1

Query  220  GRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            G+R++L W+ EEE+ L+EGV KFS + N+NIPWRKIL+FG  VF  TR P DLKDKWR +
Sbjct  279  GKRRRLFWTAEEEKTLKEGVLKFS-TGNQNIPWRKILEFGCRVFDNTRTPVDLKDKWRNM  337



>ref|XP_010112893.1| hypothetical protein L484_017729 [Morus notabilis]
 gb|EXC35028.1| hypothetical protein L484_017729 [Morus notabilis]
Length=497

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P  RR +L W+ +EE ML+EG+  F  + N  IPW KIL++GRHVFH TR P+DLK+KWR
Sbjct  429  PVARRTRLHWTADEEHMLREGIKDFCPNTNVKIPWMKILEYGRHVFHETRSPSDLKNKWR  488

Query  46   TL  41
             +
Sbjct  489  NM  490



>ref|XP_011082888.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
 ref|XP_011082889.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
 ref|XP_011082890.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
 ref|XP_011082891.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
 ref|XP_011082892.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
 ref|XP_011082893.1| PREDICTED: telomeric repeat-binding factor 1-like [Sesamum indicum]
Length=385

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -1

Query  244  LQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPAD  65
            L    F +G+R++L+W+ EEEE L+ GV K+S   NKN+PW KILDFG+H F  TR P+D
Sbjct  315  LANYTFSSGKRKRLLWTEEEEETLKAGVQKYSTDGNKNLPWTKILDFGQHKFDRTRTPSD  374

Query  64   LKDKWRTL  41
            LKDKWR +
Sbjct  375  LKDKWRNM  382



>ref|XP_002863231.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39490.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 13/115 (11%)
 Frame = -1

Query  376  IEGQPLNSDSKRSSRTAFSPKKF---SGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQK  206
            IE +P+ S S  S + +F P+K+   S L    ++ + P Q +      +      +R++
Sbjct  374  IEARPICSVS--SKKPSFQPEKYGHKSYLEKNGTTSNDPGQRKFVLCSAK------KRKR  425

Query  205  LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            L W+  EEEML+ GV KF     +NIPWRKIL+FGR VFH  R P+DLKDKW+TL
Sbjct  426  LFWTQAEEEMLRVGVQKFP--GERNIPWRKILEFGRDVFHDERAPSDLKDKWKTL  478



>ref|XP_006594392.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-79 specific-like 
isoform X1 [Glycine max]
 ref|XP_006594393.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-79 specific-like 
isoform X2 [Glycine max]
Length=451

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  220  GRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
             +R++L+W+ EEE++L+EGV KFS + N+NIPWRKIL+FG  VF  TR P DLKDKW+ +
Sbjct  377  AKRKRLLWTAEEEKVLKEGVSKFS-TENQNIPWRKILEFGCRVFDETRTPVDLKDKWKNI  435



>gb|KHN27333.1| hypothetical protein glysoja_031941 [Glycine soja]
Length=515

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = -1

Query  223  NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRT  44
              +R++L+W+ EEE++L+EGV KFS + N+NIPWRKIL+FG  VF  TR P DLKDKW+ 
Sbjct  440  TAKRRRLLWTAEEEKVLKEGVSKFS-TENQNIPWRKILEFGCRVFDKTRTPVDLKDKWKN  498

Query  43   L  41
            +
Sbjct  499  I  499



>ref|XP_006283306.1| hypothetical protein CARUB_v10004342mg [Capsella rubella]
 gb|EOA16204.1| hypothetical protein CARUB_v10004342mg [Capsella rubella]
Length=643

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 68/114 (60%), Gaps = 11/114 (10%)
 Frame = -1

Query  376  IEGQPLNSDSKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRN--QFPNGRRQKL  203
            IE +PL S    S + +F P+K+    G  S  +K   A    P QR      + +R++L
Sbjct  510  IEARPLRS--IYSKKPSFQPEKY----GHKSYQEK-NGAVSNDPGQRKFVLCSDKKRKRL  562

Query  202  MWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
             W+  EEEML+ GV KF +   +NIPWRKIL+FGR VFH  R P+DLKDKW+ +
Sbjct  563  FWTQAEEEMLRVGVQKFLVG--RNIPWRKILEFGRDVFHDGRAPSDLKDKWKMM  614



>ref|XP_006598111.1| PREDICTED: neurofilament medium polypeptide-like [Glycine max]
Length=501

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -1

Query  220  GRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
             +R++L+W+ EEE++L+EGV KFS + N+NIPWRKIL+FG  VF  TR P DLKDKW+ +
Sbjct  435  AKRRRLLWTAEEEKVLKEGVSKFS-TENQNIPWRKILEFGCRVFDKTRTPVDLKDKWKNI  493



>ref|XP_004304663.2| PREDICTED: uncharacterized protein LOC101308008 [Fragaria vesca 
subsp. vesca]
Length=211

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   +R+K+ W+  E EML+ G+  FS    KN+PWR+IL+ GR +FH TR P +LKDKW
Sbjct  139  FRISKRRKVNWTAAELEMLEAGIQIFSAQVKKNLPWRRILELGRDIFHETRTPDNLKDKW  198

Query  49   RTLC  38
            + LC
Sbjct  199  KVLC  202



>ref|XP_006283305.1| hypothetical protein CARUB_v10004342mg [Capsella rubella]
 gb|EOA16203.1| hypothetical protein CARUB_v10004342mg [Capsella rubella]
Length=637

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 68/112 (61%), Gaps = 13/112 (12%)
 Frame = -1

Query  376  IEGQPLNSDSKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMW  197
            IE +PL S    S + +F P+K+    G  S  +K   A    P Q ++    +R++L W
Sbjct  510  IEARPLRS--IYSKKPSFQPEKY----GHKSYQEK-NGAVSNDPGQSDK----KRKRLFW  558

Query  196  STEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +  EEEML+ GV KF +   +NIPWRKIL+FGR VFH  R P+DLKDKW+ +
Sbjct  559  TQAEEEMLRVGVQKFLVG--RNIPWRKILEFGRDVFHDGRAPSDLKDKWKMM  608



>ref|XP_010551981.1| PREDICTED: uncharacterized protein LOC104822447 isoform X2 [Tarenaya 
hassleriana]
Length=540

 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -1

Query  223  NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRT  44
            N +R++L W  EEE ML+ GV   S   NKNIPWRKIL+ G  VFH TR P DLK+KWRT
Sbjct  460  NDKRKRLFWRPEEEAMLRVGVETLSGEVNKNIPWRKILEMGAKVFHETRTPTDLKEKWRT  519

Query  43   L  41
            +
Sbjct  520  M  520



>ref|XP_010551980.1| PREDICTED: uncharacterized protein LOC104822447 isoform X1 [Tarenaya 
hassleriana]
Length=541

 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -1

Query  223  NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRT  44
            N +R++L W  EEE ML+ GV   S   NKNIPWRKIL+ G  VFH TR P DLK+KWRT
Sbjct  461  NDKRKRLFWRPEEEAMLRVGVETLSGEVNKNIPWRKILEMGAKVFHETRTPTDLKEKWRT  520

Query  43   L  41
            +
Sbjct  521  M  521



>ref|XP_003601481.1| hypothetical protein MTR_3g082160 [Medicago truncatula]
Length=351

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = -1

Query  244  LQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPAD  65
            + +     G+R++L W+ EEE++L+EGV KF+ + ++NIPWRKIL+FG  VF  TR P D
Sbjct  280  VTKQNILTGKRKRLNWTAEEEKVLKEGVLKFA-TEDQNIPWRKILEFGCCVFDKTRTPVD  338

Query  64   LKDKWRTL  41
            LKDKWR +
Sbjct  339  LKDKWRKI  346



>gb|AES71732.2| myb-like DNA-binding domain protein [Medicago truncatula]
Length=353

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = -1

Query  244  LQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPAD  65
            + +     G+R++L W+ EEE++L+EGV KF+ + ++NIPWRKIL+FG  VF  TR P D
Sbjct  280  VTKQNILTGKRKRLNWTAEEEKVLKEGVLKFA-TEDQNIPWRKILEFGCCVFDKTRTPVD  338

Query  64   LKDKWRTL  41
            LKDKWR +
Sbjct  339  LKDKWRKI  346



>gb|KCW47629.1| hypothetical protein EUGRSUZ_K01371 [Eucalyptus grandis]
Length=485

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -1

Query  214  RQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLCF  35
            +++L WS EEEE+L+  V  FS +ANKNIPWRKIL++G  VF+P+R P DLKDKW+ +  
Sbjct  424  KRRLRWSPEEEEILKARVQLFSSNANKNIPWRKILEYGCRVFNPSRTPVDLKDKWKNIAT  483

Query  34   R  32
            R
Sbjct  484  R  484



>ref|XP_009401240.1| PREDICTED: uncharacterized protein LOC103985310 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score = 82.8 bits (203),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 54/87 (62%), Gaps = 9/87 (10%)
 Frame = -1

Query  286  SSPDKPKQ----AEEYS-PLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPW  122
            SSP K K+    A+ YS P+     P  RR KL W+ EEEE L+E VH+     + +IPW
Sbjct  790  SSPAKSKRHISRAKRYSNPI----LPPTRRTKLSWTPEEEEFLREAVHELGEKNDGSIPW  845

Query  121  RKILDFGRHVFHPTRMPADLKDKWRTL  41
             KIL+ GRHV H TR P DLKDKWR +
Sbjct  846  VKILELGRHVIHKTRQPGDLKDKWRNM  872



>ref|XP_010653800.1| PREDICTED: uncharacterized protein LOC100852566 [Vitis vinifera]
 emb|CBI29873.3| unnamed protein product [Vitis vinifera]
Length=774

 Score = 82.4 bits (202),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (62%), Gaps = 9/97 (9%)
 Frame = -1

Query  307  SGLTGETSSPDKPKQAEEYSPLQRNQ----FP---NGRRQKLMWSTEEEEMLQEGVHKFS  149
            SG +G+ +  DKP  +  Y   +R Q    FP     RR+KL W+ +EEE+L+ GV KFS
Sbjct  673  SGTSGDEN--DKPSSSTYYIRFRRQQQQYTFPPIHQLRRKKLAWTAKEEEILKVGVQKFS  730

Query  148  ISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
               +K+IPW+KI++FG  VF   R   DLKDKWR +C
Sbjct  731  NDHDKSIPWKKIMEFGGTVFQRGRTTIDLKDKWRNIC  767



>emb|CAN80644.1| hypothetical protein VITISV_016915 [Vitis vinifera]
Length=774

 Score = 82.4 bits (202),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (62%), Gaps = 9/97 (9%)
 Frame = -1

Query  307  SGLTGETSSPDKPKQAEEYSPLQRNQ----FP---NGRRQKLMWSTEEEEMLQEGVHKFS  149
            SG +G+ +  DKP  +  Y   +R Q    FP     RR+KL W+ +EEE+L+ GV KFS
Sbjct  673  SGTSGDEN--DKPSSSTYYIRFRRQQQQYTFPPIHQLRRKKLAWTAKEEEILKVGVQKFS  730

Query  148  ISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
               +K+IPW+KI++FG  VF   R   DLKDKWR +C
Sbjct  731  NDHDKSIPWKKIMEFGGTVFQRGRTTIDLKDKWRNIC  767



>ref|XP_009401239.1| PREDICTED: uncharacterized protein LOC103985310 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=886

 Score = 82.4 bits (202),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 54/87 (62%), Gaps = 9/87 (10%)
 Frame = -1

Query  286  SSPDKPKQ----AEEYS-PLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPW  122
            SSP K K+    A+ YS P+     P  RR KL W+ EEEE L+E VH+     + +IPW
Sbjct  793  SSPAKSKRHISRAKRYSNPI----LPPTRRTKLSWTPEEEEFLREAVHELGEKNDGSIPW  848

Query  121  RKILDFGRHVFHPTRMPADLKDKWRTL  41
             KIL+ GRHV H TR P DLKDKWR +
Sbjct  849  VKILELGRHVIHKTRQPGDLKDKWRNM  875



>ref|NP_171623.1| homeodomain-like protein with RING/FYVE/PHD-type zinc finger 
domain [Arabidopsis thaliana]
 gb|AEE27246.1| homeodomain-like protein with RING/FYVE/PHD-type zinc finger 
domain [Arabidopsis thaliana]
Length=345

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -1

Query  223  NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRT  44
            N + ++++W+  EE+ML+EGV KFS + NKN+PW+KIL+ G+ +FH TR  +DLKDKWR 
Sbjct  229  NDQPKRVLWTVNEEKMLREGVEKFSDTINKNMPWKKILEMGKGIFHTTRNSSDLKDKWRN  288

Query  43   L  41
            +
Sbjct  289  M  289



>ref|XP_006395961.1| hypothetical protein EUTSA_v10003829mg [Eutrema salsugineum]
 gb|ESQ33247.1| hypothetical protein EUTSA_v10003829mg [Eutrema salsugineum]
Length=620

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 67/115 (58%), Gaps = 13/115 (11%)
 Frame = -1

Query  376  IEGQPLNSDSKRSSRTAFSPKKF---SGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQK  206
            IE QP  S + +  + +F  +K+   S L    S+ D P+  +  S   +      +R++
Sbjct  487  IEAQPFRSAAPK--KPSFQHEKYGHKSYLEKNGSASDDPRHRKFVSCSDK------KRKR  538

Query  205  LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            L W+  EEEML+ GV  F     +NIPWRKIL+FGR VFH  R+P+DLKDKW+ +
Sbjct  539  LFWTQAEEEMLRVGVQNFP--GFRNIPWRKILEFGRDVFHDDRVPSDLKDKWKNM  591



>gb|KFK24460.1| hypothetical protein AALP_AAs46367U000300 [Arabis alpina]
Length=599

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 68/114 (60%), Gaps = 11/114 (10%)
 Frame = -1

Query  376  IEGQPLNSDSKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRN--QFPNGRRQKL  203
            I+ +P  S S  S + +F P+K+    G+    +K   A    P QR      + +R++L
Sbjct  474  IDARPYCSVS--SKKPSFQPEKY----GQNGHLEKNGAASN-DPGQRRFVLCIDKKRKRL  526

Query  202  MWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
             W+  EEEML+ GV KF     +NIPWRKIL+FGR VFH  R+P+DLKDKW+ +
Sbjct  527  FWTPAEEEMLRVGVQKFP--GVRNIPWRKILEFGRDVFHEERVPSDLKDKWKNM  578



>gb|AAF26467.1|AC007323_8 T25K16.14 [Arabidopsis thaliana]
Length=321

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -1

Query  223  NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRT  44
            N + ++++W+  EE+ML+EGV KFS + NKN+PW+KIL+ G+ +FH TR  +DLKDKWR 
Sbjct  207  NDQPKRVLWTVNEEKMLREGVEKFSDTINKNMPWKKILEMGKGIFHTTRNSSDLKDKWRN  266

Query  43   L  41
            +
Sbjct  267  M  267



>ref|XP_009122937.1| PREDICTED: kinesin-related protein 11-like [Brassica rapa]
Length=691

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F N R+++++W+ EEEEML+ GV  F+    KNI W++IL  G +VFH TR PADLKDKW
Sbjct  625  FFNQRQRRVLWTPEEEEMLKVGVETFATDPKKNISWKRILKMGENVFHQTRNPADLKDKW  684

Query  49   R  47
            R
Sbjct  685  R  685



>ref|XP_007202189.1| hypothetical protein PRUPE_ppa026014mg [Prunus persica]
 gb|EMJ03388.1| hypothetical protein PRUPE_ppa026014mg [Prunus persica]
Length=1010

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 84/180 (47%), Gaps = 35/180 (19%)
 Frame = -1

Query  514   AVPFANKEPESQLHMKAKRRDETGASTSREFEAVLGRR------------------NRNK  389
               PFA     S +H+ ++  DE+  +  R+ +A  G +                  ++N 
Sbjct  842   VAPFA-----SCVHVNSECGDESATAVCRKLDASTGEKEEEEKVARECIPVGVPLSSKNT  896

Query  388   ESNEIE-GQPLNSDSKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQFPNGRR  212
             E+  I+ G  +N DS++      S  K+S        P + K    Y        P  RR
Sbjct  897   ENLHIDQGYEVNFDSEQVDNQKSSTSKYS------IRPRRSKNTYSYPAT-----PQLRR  945

Query  211   QKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLCFR  32
              K+ W  EEEEML++GV   S +   NIPW++IL+FG  VF  +R   DLKDKWR +C R
Sbjct  946   IKVPWKVEEEEMLKKGVSTVSRNDEGNIPWKQILEFGGSVFLHSRTSIDLKDKWRNICRR  1005



>ref|NP_193003.2| DNA binding protein [Arabidopsis thaliana]
 gb|AAS58512.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AAS79550.1| At4g12670 [Arabidopsis thaliana]
 emb|CAG25861.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83161.1| DNA binding protein [Arabidopsis thaliana]
Length=499

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 64/115 (56%), Gaps = 19/115 (17%)
 Frame = -1

Query  376  IEGQPLNSDSKRSSRTAFSPKKF---SGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQK  206
            IE +PL S S  S + +F P+K+   S L     + + P Q+              +R++
Sbjct  372  IEARPLRSVS--SKKPSFQPEKYGHKSYLEKNGPASNDPAQSAT------------KRKR  417

Query  205  LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
              W+  E EML+ GV KF     +NIPWRKIL FGR VFH  R P+DLKDKW+TL
Sbjct  418  RFWTLAEVEMLRVGVQKFP--GERNIPWRKILQFGRDVFHDERAPSDLKDKWKTL  470



>ref|XP_008645113.1| PREDICTED: uncharacterized protein LOC103626481 isoform X1 [Zea 
mays]
Length=984

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 79/160 (49%), Gaps = 35/160 (22%)
 Frame = -1

Query  451  ETGASTSREF------------EAVLGRRNRNKESNEIEGQPLNSDSKRSSRTAFSPKKF  308
            ETGAS+ R              E  L    ++  S+E+E + L     +  + A S K  
Sbjct  825  ETGASSQRRCDPPSNHDVEADQEGSLTTSIQSSGSDELEAKGL-----QEKKAAVSSKSR  879

Query  307  SGLTGETSSPDKPKQAEEYSPLQRNQF-----------PNGRRQKLMWSTEEEEMLQEGV  161
             G++       K  Q    SP +RN             P GRR+KL W+ EEE +L+EG+
Sbjct  880  KGIS-------KRDQHMPTSPRKRNSVHLQKRYSNPLAPPGRRKKLFWTEEEEAVLREGM  932

Query  160  HKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
             KF+   N  IPW  IL+ GR VFH TR+P+DL+ KWR++
Sbjct  933  AKFTPQNNAQIPWILILEHGRGVFHRTRLPSDLRVKWRSM  972



>ref|XP_008240866.1| PREDICTED: uncharacterized protein LOC103339362 [Prunus mume]
Length=339

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 89/180 (49%), Gaps = 35/180 (19%)
 Frame = -1

Query  514  AVPFANKEPESQLHMKAKRRDETGASTSREFEAVLGRR------------------NRNK  389
              PFA     S++ + ++  DE+  +  R+ +   G++                  ++N 
Sbjct  171  VAPFA-----SRVDVNSECGDESATAVCRKLDVSAGKKEEEEKVAQECIPVGVPLSSKNT  225

Query  388  ESNEIE-GQPLNSDSKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQFPNGRR  212
            E+  I+ G  +N DS++      S  K+S          +P++++   P      P  RR
Sbjct  226  ENLLIDQGYEVNFDSEQVDNQKSSTSKYSI---------RPRRSK--IPYSFPATPQLRR  274

Query  211  QKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLCFR  32
             K+ W+ EEEEML++GV   S +   NIPW++IL+FG  VF  +R P DLKDKWR +C R
Sbjct  275  IKVPWTVEEEEMLKKGVETVSRNDEGNIPWKQILEFGGSVFLHSRTPIDLKDKWRNICRR  334



>gb|AFW69603.1| putative homeodomain-like transcription factor superfamily protein 
[Zea mays]
Length=942

 Score = 79.7 bits (195),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 79/160 (49%), Gaps = 35/160 (22%)
 Frame = -1

Query  451  ETGASTSREF------------EAVLGRRNRNKESNEIEGQPLNSDSKRSSRTAFSPKKF  308
            ETGAS+ R              E  L    ++  S+E+E + L     +  + A S K  
Sbjct  783  ETGASSQRRCDPPSNHDVEADQEGSLTTSIQSSGSDELEAKGL-----QEKKAAVSSKSR  837

Query  307  SGLTGETSSPDKPKQAEEYSPLQRNQF-----------PNGRRQKLMWSTEEEEMLQEGV  161
             G++       K  Q    SP +RN             P GRR+KL W+ EEE +L+EG+
Sbjct  838  KGIS-------KRDQHMPTSPRKRNSVHLQKRYSNPLAPPGRRKKLFWTEEEEAVLREGM  890

Query  160  HKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
             KF+   N  IPW  IL+ GR VFH TR+P+DL+ KWR++
Sbjct  891  AKFTPQNNAQIPWILILEHGRGVFHRTRLPSDLRVKWRSM  930



>ref|XP_002889380.1| hypothetical protein ARALYDRAFT_887342 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65639.1| hypothetical protein ARALYDRAFT_887342 [Arabidopsis lyrata subsp. 
lyrata]
Length=293

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -1

Query  223  NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRT  44
            + +R++++W+ +EE ML+ GV  F+ + NKNIPW+KIL+ G+ +FH TR  +DLKDKWR 
Sbjct  230  DDQRKRVLWTAKEENMLRVGVEIFAATINKNIPWKKILEMGKGIFHKTRNSSDLKDKWRN  289

Query  43   L  41
            +
Sbjct  290  M  290



>gb|AFW69604.1| putative homeodomain-like transcription factor superfamily protein 
[Zea mays]
Length=938

 Score = 79.7 bits (195),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P GRR+KL W+ EEE +L+EG+ KF+   N  IPW  IL+ GR VFH TR+P+DL+ KWR
Sbjct  869  PPGRRKKLFWTEEEEAVLREGMAKFTPQNNAQIPWILILEHGRGVFHRTRLPSDLRVKWR  928

Query  46   TL  41
            ++
Sbjct  929  SM  930



>gb|KDO45394.1| hypothetical protein CISIN_1g0037502mg [Citrus sinensis]
Length=707

 Score = 79.0 bits (193),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = -1

Query  274  KPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRH  95
            +PK    Y P+     P  RR+K+ W+ +EEE+L++GV KF+   ++ IPW+KIL+FG  
Sbjct  627  RPKTHYTYPPI-----PQLRRKKVPWTAKEEEILKKGVQKFASVDDRIIPWKKILEFGSS  681

Query  94   VFHPTRMPADLKDKWRTLC  38
            VF   R   DLKDKWR +C
Sbjct  682  VFFSGRTAIDLKDKWRNMC  700



>ref|XP_006493906.1| PREDICTED: uncharacterized protein LOC102627827 isoform X1 [Citrus 
sinensis]
Length=798

 Score = 79.0 bits (193),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = -1

Query  274  KPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRH  95
            +PK    Y P+     P  RR+K+ W+ +EEE+L++GV KF+   ++ IPW+KIL+FG  
Sbjct  718  RPKTHYTYPPI-----PQLRRKKVPWTAKEEEILKKGVQKFASVDDRIIPWKKILEFGSS  772

Query  94   VFHPTRMPADLKDKWRTLC  38
            VF   R   DLKDKWR +C
Sbjct  773  VFFSGRTAIDLKDKWRNMC  791



>gb|KDO45393.1| hypothetical protein CISIN_1g0037502mg [Citrus sinensis]
Length=798

 Score = 79.0 bits (193),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = -1

Query  274  KPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRH  95
            +PK    Y P+     P  RR+K+ W+ +EEE+L++GV KF+   ++ IPW+KIL+FG  
Sbjct  718  RPKTHYTYPPI-----PQLRRKKVPWTAKEEEILKKGVQKFASVDDRIIPWKKILEFGSS  772

Query  94   VFHPTRMPADLKDKWRTLC  38
            VF   R   DLKDKWR +C
Sbjct  773  VFFSGRTAIDLKDKWRNMC  791



>ref|XP_010557729.1| PREDICTED: uncharacterized protein LOC104826636 [Tarenaya hassleriana]
Length=310

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 9/93 (10%)
 Frame = -1

Query  292  ETSSPDKPKQAEE------YSPLQRNQFP--NGRRQKLM-WSTEEEEMLQEGVHKFSISA  140
            E    +K +Q EE       +P+QR      +GR++KL+ W+ EEEEML+ GV KFS +A
Sbjct  214  ECVESEKNQQCEEEGATECRAPIQRKDTVTRSGRKRKLLVWTPEEEEMLRIGVEKFSKTA  273

Query  139  NKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            N+N+PW  IL FG  VFH  R  ADLK KW+ +
Sbjct  274  NRNMPWSHILKFGESVFHEERTQADLKAKWKKM  306



>ref|XP_004955692.1| PREDICTED: uncharacterized protein LOC101784911 [Setaria italica]
Length=970

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P+GRR KL W+ EEE +L+E + KF+   +  IPW +IL++GR VFH TR+P+DL+ KWR
Sbjct  903  PSGRRTKLCWTEEEEAVLKEAMAKFTPQDDTPIPWVQILEYGRDVFHRTRLPSDLRVKWR  962

Query  46   TL  41
             +
Sbjct  963  NM  964



>ref|XP_006421445.1| hypothetical protein CICLE_v10004349mg [Citrus clementina]
 gb|ESR34685.1| hypothetical protein CICLE_v10004349mg [Citrus clementina]
Length=798

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = -1

Query  274  KPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRH  95
            +PK    Y P+     P  RR+K+ W+ +EEE+L++GV KF+   ++ IPW+KIL+FG  
Sbjct  718  RPKTHYTYPPI-----PQLRRKKVPWTAKEEEILKKGVQKFASVDDRIIPWKKILEFGSS  772

Query  94   VFHPTRMPADLKDKWRTLC  38
            VF   R   DLKDKWR +C
Sbjct  773  VFFGGRTAIDLKDKWRNMC  791



>gb|EAY80933.1| hypothetical protein OsI_36111 [Oryza sativa Indica Group]
Length=940

 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P GRR KL W+ +EE  L+E + KF+ S N  IPW +ILD+GR VFH TR+ +DL+ KWR
Sbjct  873  PAGRRTKLCWTEQEEATLREAMAKFTPSDNGPIPWVQILDYGRDVFHRTRLASDLRVKWR  932

Query  46   TL  41
             +
Sbjct  933  NM  934



>gb|EYU34385.1| hypothetical protein MIMGU_mgv1a008782mg [Erythranthe guttata]
Length=362

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            F   +R++L WS EE E L+EG+ K+S   NKNIPWRKIL +G  VF  TR P DL++K 
Sbjct  297  FSGKKRRRLFWSVEEVEKLKEGIEKYSTEINKNIPWRKILMYGHGVFDETRTPGDLREKG  356

Query  49   RTL  41
            R L
Sbjct  357  RKL  359



>ref|XP_006304037.1| hypothetical protein CARUB_v10009814mg, partial [Capsella rubella]
 gb|EOA36935.1| hypothetical protein CARUB_v10009814mg, partial [Capsella rubella]
Length=312

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 13/92 (14%)
 Frame = -1

Query  277  DKPKQAEEYSPLQRNQF-------------PNGRRQKLMWSTEEEEMLQEGVHKFSISAN  137
            D  K   E S +  +QF              N + ++++W+ +EE+ML+ GV  FS    
Sbjct  180  DTEKACGEASVVVNDQFIDIETSRNEASVVVNDQPKRVLWTAKEEDMLRVGVEIFSTKIK  239

Query  136  KNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            KN+PW+KIL+ G+ VFH TR P+DLKDKWR +
Sbjct  240  KNMPWKKILEMGKGVFHKTRNPSDLKDKWRNM  271



>ref|XP_006857950.1| hypothetical protein AMTR_s00069p00165540 [Amborella trichopoda]
 gb|ERN19417.1| hypothetical protein AMTR_s00069p00165540 [Amborella trichopoda]
Length=840

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            FP  RR KL W+ EEEE+L+EGV+KF+    K IPWR+ILDFGRH F  TR P DLKDKW
Sbjct  643  FPYIRRNKLPWTAEEEEVLEEGVNKFAEVGAKCIPWRRILDFGRHTFDKTRTPVDLKDKW  702

Query  49   RTL  41
            R +
Sbjct  703  RNI  705



>ref|XP_009334961.1| PREDICTED: uncharacterized protein LOC103927742 [Pyrus x bretschneideri]
Length=1059

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  217   RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
             RR K+ WS EEEEML++GV  FS    + +PW++IL+FG  VF  +R P DLKDKWR +C
Sbjct  993   RRVKVPWSIEEEEMLKKGVQTFSRIDERTLPWKQILEFGGSVFLHSRTPGDLKDKWRNIC  1052

Query  37    FR  32
              R
Sbjct  1053  RR  1054



>ref|XP_009340161.1| PREDICTED: uncharacterized protein LOC103932322 [Pyrus x bretschneideri]
Length=1098

 Score = 77.8 bits (190),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  217   RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
             RR K+ WS EEEEML++GV  FS    + +PW++IL+FG  VF  +R P DLKDKWR +C
Sbjct  1032  RRVKVPWSIEEEEMLKKGVQTFSRIDERTLPWKQILEFGGSVFLHSRTPGDLKDKWRNIC  1091

Query  37    FR  32
              R
Sbjct  1092  RR  1093



>ref|XP_009149315.1| PREDICTED: uncharacterized protein LOC103872635 [Brassica rapa]
Length=267

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 83/167 (50%), Gaps = 19/167 (11%)
 Frame = -1

Query  535  QGKTRESAVPFANKEPESQLHMKAKRRDETGAST-SREFEAVLGRRNRNKESNEI-EGQP  362
            QG+ RES   F   E       K +R  E  A T S+E        N   E +E  E  P
Sbjct  108  QGRRRESYEKFMAME-------KDQRMKEVAAETQSQELGGGFSENNHISEEDEQREHHP  160

Query  361  LNSDSKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEE  182
            +++D+ +        +        +  P K   A  + P QR      +R+++ W+  EE
Sbjct  161  ISTDNVQELALVIH-QPIVAQPFRSVPPPKNGTAL-HDPKQR------KRKRVFWTQAEE  212

Query  181  EMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +ML+ GV KF     +NIPWRKIL+FGR VFH  R+P+DLKDKW+ +
Sbjct  213  QMLRVGVEKFP--GIRNIPWRKILEFGRDVFHEDRVPSDLKDKWKMI  257



>emb|CDY35078.1| BnaA06g10880D [Brassica napus]
Length=270

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +R+++ W+  EE+ML+ GV KF     +NIPWRKIL+FGR VFH  R+P+DLKDKW+ +
Sbjct  204  KRKRVFWTQAEEQMLRVGVEKFP--GIRNIPWRKILEFGRDVFHEDRVPSDLKDKWKMI  260



>emb|CDY33345.1| BnaC05g12380D [Brassica napus]
Length=274

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 45/59 (76%), Gaps = 2/59 (3%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            +R+++ W+  EE+ML+ GV KF     +NIPWRKIL+FGR VFH  R+P+DLKDKW+ +
Sbjct  208  KRKRVFWTQAEEQMLRVGVEKFP--GIRNIPWRKILEFGRDVFHEDRVPSDLKDKWKMI  264



>ref|XP_002463492.1| hypothetical protein SORBIDRAFT_01g000725 [Sorghum bicolor]
 gb|EER90490.1| hypothetical protein SORBIDRAFT_01g000725 [Sorghum bicolor]
Length=139

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            PN RR+++ W+ EEE +L+E + KF+   +  IPW +I ++GRHVFH  R+P DL+ KWR
Sbjct  75   PNSRRKRVNWTKEEEAILREAMEKFTPQDDARIPWIQIREYGRHVFHEERLPDDLRVKWR  134

Query  46   TL  41
            ++
Sbjct  135  SM  136



>emb|CAB40984.1| putative protein [Arabidopsis thaliana]
 emb|CAB78309.1| putative protein [Arabidopsis thaliana]
Length=520

 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 66/129 (51%), Gaps = 26/129 (20%)
 Frame = -1

Query  376  IEGQPLNSDSKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQF----------  227
            IE +PL S S  S + +F P+K+    G  S  +K   A    P QR  F          
Sbjct  372  IEARPLRSVS--SKKPSFQPEKY----GHKSYLEKNGPASN-DPAQRFLFIWNFLVTGFK  424

Query  226  -------PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPA  68
                      +R++  W+  E EML+ GV KF     +NIPWRKIL FGR VFH  R P+
Sbjct  425  LTIFLPCSATKRKRRFWTLAEVEMLRVGVQKFP--GERNIPWRKILQFGRDVFHDERAPS  482

Query  67   DLKDKWRTL  41
            DLKDKW+TL
Sbjct  483  DLKDKWKTL  491



>ref|XP_004516066.1| PREDICTED: uncharacterized protein LOC101508857 isoform X1 [Cicer 
arietinum]
 ref|XP_004516067.1| PREDICTED: uncharacterized protein LOC101508857 isoform X2 [Cicer 
arietinum]
Length=915

 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 4/66 (6%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPT---RMPADLKD  56
            P  RR+++ W+ EEEE+++EGV KFS S ++ +PW+KIL FG HVF      R P DLKD
Sbjct  839  PKIRRKQIPWTAEEEELIREGVQKFSFS-DQQLPWKKILAFGSHVFEKNCRRRTPQDLKD  897

Query  55   KWRTLC  38
            KW+ +C
Sbjct  898  KWKNMC  903



>ref|XP_004516068.1| PREDICTED: uncharacterized protein LOC101508857 isoform X3 [Cicer 
arietinum]
Length=910

 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 4/66 (6%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPT---RMPADLKD  56
            P  RR+++ W+ EEEE+++EGV KFS S ++ +PW+KIL FG HVF      R P DLKD
Sbjct  834  PKIRRKQIPWTAEEEELIREGVQKFSFS-DQQLPWKKILAFGSHVFEKNCRRRTPQDLKD  892

Query  55   KWRTLC  38
            KW+ +C
Sbjct  893  KWKNMC  898



>ref|XP_006381017.1| hypothetical protein POPTR_0006s05315g [Populus trichocarpa]
 gb|ERP58814.1| hypothetical protein POPTR_0006s05315g [Populus trichocarpa]
Length=66

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P  RR+K+ W+ +EEEML+EGV KFS  ++   PW+ IL++G  VF   R   DLKDKWR
Sbjct  2    PRLRRKKVPWTVQEEEMLKEGVQKFS--SDGKFPWKDILEYGSSVFLSGRTTIDLKDKWR  59

Query  46   TLC  38
             +C
Sbjct  60   NMC  62



>gb|KDP30809.1| hypothetical protein JCGZ_13752 [Jatropha curcas]
Length=583

 Score = 76.6 bits (187),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            RR+K+ W+ +EEEML+EGV KF+   ++ IPW+KIL++G  VF   R   DLKDKWR +C
Sbjct  518  RRKKVPWTAKEEEMLKEGVQKFATVGDRTIPWKKILEYGSMVF-SHRTTVDLKDKWRNMC  576



>ref|XP_010235463.1| PREDICTED: uncharacterized protein LOC100830030 isoform X2 [Brachypodium 
distachyon]
Length=816

 Score = 76.3 bits (186),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P GRR KL W+ EEE  L++ + KF+   N +IPW +IL+ GR VFH TR+P+DL+ KWR
Sbjct  749  PAGRRTKLCWTEEEEGALRDAMLKFTPKDNGSIPWVQILEHGRGVFHKTRLPSDLRVKWR  808

Query  46   TL  41
             +
Sbjct  809  NM  810



>ref|XP_010532944.1| PREDICTED: uncharacterized protein LOC104808828 isoform X2 [Tarenaya 
hassleriana]
Length=441

 Score = 75.9 bits (185),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = -1

Query  268  KQAEEYS-PLQRNQFPN-GRRQK-LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGR  98
            K+A EY  P QR    N GR++K L W+ EEEE L+  V K S +AN+N+PWRK+L+FGR
Sbjct  360  KRATEYHVPKQRKDDTNYGRKRKPLYWTPEEEETLRVAVDKVSRAANRNMPWRKVLEFGR  419

Query  97   HVFHPTRMPADLKDKWRTL  41
              F   R+P+DLK+KW+ +
Sbjct  420  DKFQEGRIPSDLKEKWKKM  438



>ref|XP_003572559.1| PREDICTED: uncharacterized protein LOC100830030 isoform X1 [Brachypodium 
distachyon]
Length=953

 Score = 76.3 bits (186),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P GRR KL W+ EEE  L++ + KF+   N +IPW +IL+ GR VFH TR+P+DL+ KWR
Sbjct  886  PAGRRTKLCWTEEEEGALRDAMLKFTPKDNGSIPWVQILEHGRGVFHKTRLPSDLRVKWR  945

Query  46   TL  41
             +
Sbjct  946  NM  947



>ref|XP_003561334.1| PREDICTED: uncharacterized protein LOC100826621 [Brachypodium 
distachyon]
 ref|XP_010228264.1| PREDICTED: uncharacterized protein LOC100826621 [Brachypodium 
distachyon]
Length=954

 Score = 76.3 bits (186),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P GRR KL W+ EEE  L+E + KF+   N  IPW +IL++GR VFH  R+P DL+ KWR
Sbjct  887  PTGRRLKLCWTEEEEVALREAMEKFTPQDNMPIPWVQILEYGRDVFHRARLPCDLRVKWR  946

Query  46   TL  41
             +
Sbjct  947  NM  948



>ref|XP_010474702.1| PREDICTED: uncharacterized protein LOC104754259 [Camelina sativa]
Length=340

 Score = 75.1 bits (183),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -1

Query  283  SPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDF  104
            S D+    EE S  + +   N + ++++W+ EEE ML  GV K+S   NKN+PW+KIL+ 
Sbjct  234  SADQVIDMEESSG-EASVVVNDQPKRVLWTVEEETMLMVGVEKYSKIINKNMPWKKILEM  292

Query  103  GRHVFHPTRMPADLKDKWRTL  41
            G  VFH  R  +DLKDKWR +
Sbjct  293  GEGVFHVNRSSSDLKDKWRNM  313



>gb|KDP26014.1| hypothetical protein JCGZ_21047 [Jatropha curcas]
Length=931

 Score = 75.9 bits (185),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            RR+K+ W+ +EEEML+EGV KFS + ++ IPW++IL++G  +F   R   DLKDKWR +C
Sbjct  866  RRKKVPWTAKEEEMLKEGVQKFSTAGDRTIPWKQILEYGSTIF-SHRTTIDLKDKWRNMC  924



>ref|XP_006663448.1| PREDICTED: uncharacterized protein LOC102714137 [Oryza brachyantha]
Length=914

 Score = 75.5 bits (184),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P GRR KL W+ +EE  L+E + KF+   N  IPW +IL++GR VFH TR+P+DL+ KWR
Sbjct  847  PAGRRTKLCWTEQEEATLRELMAKFTPRDNGPIPWVQILEYGRDVFHRTRLPSDLRVKWR  906

Query  46   TL  41
             +
Sbjct  907  NM  908



>ref|XP_002526722.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35636.1| conserved hypothetical protein [Ricinus communis]
Length=814

 Score = 75.1 bits (183),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P  RR+K+ W+ +EEE+L+EGV KFS  +++ I W+KIL++G  VF   R   DLKDKWR
Sbjct  745  PQFRRKKVPWTAKEEEILKEGVQKFSNISDRTISWKKILEYGSAVFLHDRTTTDLKDKWR  804

Query  46   TLC  38
             +C
Sbjct  805  NIC  807



>emb|CDP10065.1| unnamed protein product [Coffea canephora]
Length=897

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 8/106 (8%)
 Frame = -1

Query  331  TAFSPKKFSGLTGETSSPDKPKQAEEYS-----PLQRNQFP---NGRRQKLMWSTEEEEM  176
            +A   +   G   E+S  D  K    YS     P++   +P     RR+ L W+  EEE 
Sbjct  787  SALPQEPVCGPISESSEEDNEKSVRSYSIRLRRPIKNYTYPAIPQLRRKILPWTKAEEEK  846

Query  175  LQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            L+EGV + S   +++IPW++IL+FG  VF   R   DLKDKWR +C
Sbjct  847  LKEGVQRLSSPHDRSIPWKQILEFGGDVFQRGRTTIDLKDKWRNIC  892



>ref|NP_001065819.1| Os11g0160700 [Oryza sativa Japonica Group]
 gb|ABA91594.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27664.1| Os11g0160700 [Oryza sativa Japonica Group]
 gb|EEE51697.1| hypothetical protein OsJ_33066 [Oryza sativa Japonica Group]
Length=951

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P GRR KL W+ +EE  L+E + KF+   N  IPW +IL+ GR VFH TR+P+DL+ KW
Sbjct  883  VPAGRRTKLCWTEKEEITLREAMAKFTPRDNGPIPWVQILEHGRDVFHRTRLPSDLRVKW  942

Query  49   RTL  41
            R +
Sbjct  943  RNM  945



>gb|AAX95463.1| hypothetical protein [Oryza sativa Japonica Group]
Length=932

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P GRR KL W+ +EE  L+E + KF+   N  IPW +IL+ GR VFH TR+P+DL+ KW
Sbjct  864  VPAGRRTKLCWTEKEEITLREAMAKFTPRDNGPIPWVQILEHGRDVFHRTRLPSDLRVKW  923

Query  49   RTL  41
            R +
Sbjct  924  RNM  926



>gb|EEC67726.1| hypothetical protein OsI_35213 [Oryza sativa Indica Group]
Length=951

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P GRR KL W+ +EE  L+E + KF+   N  IPW +IL+ GR VFH TR+P+DL+ KW
Sbjct  883  VPAGRRTKLCWTEKEEITLREAMAKFTPRDNGPIPWVQILEHGRDVFHRTRLPSDLRVKW  942

Query  49   RTL  41
            R +
Sbjct  943  RNM  945



>ref|XP_008357975.1| PREDICTED: trichohyalin-like [Malus domestica]
 ref|XP_008357976.1| PREDICTED: trichohyalin-like [Malus domestica]
Length=579

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 45/61 (74%), Gaps = 1/61 (2%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             PNG+R++L W+ EE +ML+EGV +   + N  + W++IL++G +VFH TR P DLKDKW
Sbjct  510  LPNGKRKRLDWTDEELKMLKEGV-RLHGTLNGKMQWKEILEYGHNVFHVTRQPVDLKDKW  568

Query  49   R  47
            R
Sbjct  569  R  569


 Score = 66.6 bits (161),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             PN + ++  W+ EE +ML+EGV +   S+N  + W+KIL++G  VFH TR P DLKDKW
Sbjct  347  LPNVKGKRSKWTDEEIKMLKEGV-RVCGSSNGKMQWKKILEYGHKVFHRTREPVDLKDKW  405

Query  49   R  47
            R
Sbjct  406  R  406



>ref|XP_011020329.1| PREDICTED: uncharacterized protein LOC105122743 isoform X1 [Populus 
euphratica]
 ref|XP_011020330.1| PREDICTED: uncharacterized protein LOC105122743 isoform X1 [Populus 
euphratica]
 ref|XP_011020331.1| PREDICTED: uncharacterized protein LOC105122743 isoform X1 [Populus 
euphratica]
Length=598

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 73/150 (49%), Gaps = 22/150 (15%)
 Frame = -1

Query  487  ESQLHMKAKRRDETGASTSREFEAVLGRRNRNKESNEIEGQPLNSDSKRSSRTAFSPKKF  308
            +S +    K +D      SR+     G+R +   +  I+G   + D    S ++    +F
Sbjct  442  DSDVDQSCKEKDVFSGIQSRD-----GQRQKAVSATNIDGGETSDDENDKSSSSNYFIQF  496

Query  307  SGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNI  128
              +  + S P  P+       L+R +FP        W+ +EEEML+EGV KFS  ++   
Sbjct  497  RNIEKQYSYPVMPQ-------LRRKKFP--------WTVQEEEMLKEGVQKFS--SDGKF  539

Query  127  PWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            PW+ IL++G  VF   R   DLKDKWR +C
Sbjct  540  PWKDILEYGCSVFLSGRTTIDLKDKWRNMC  569



>ref|XP_011020333.1| PREDICTED: uncharacterized protein LOC105122743 isoform X3 [Populus 
euphratica]
Length=576

 Score = 73.6 bits (179),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 73/150 (49%), Gaps = 22/150 (15%)
 Frame = -1

Query  487  ESQLHMKAKRRDETGASTSREFEAVLGRRNRNKESNEIEGQPLNSDSKRSSRTAFSPKKF  308
            +S +    K +D      SR+     G+R +   +  I+G   + D    S ++    +F
Sbjct  442  DSDVDQSCKEKDVFSGIQSRD-----GQRQKAVSATNIDGGETSDDENDKSSSSNYFIQF  496

Query  307  SGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNI  128
              +  + S P  P+       L+R +FP        W+ +EEEML+EGV KFS  ++   
Sbjct  497  RNIEKQYSYPVMPQ-------LRRKKFP--------WTVQEEEMLKEGVQKFS--SDGKF  539

Query  127  PWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            PW+ IL++G  VF   R   DLKDKWR +C
Sbjct  540  PWKDILEYGCSVFLSGRTTIDLKDKWRNMC  569



>ref|XP_011020332.1| PREDICTED: uncharacterized protein LOC105122743 isoform X2 [Populus 
euphratica]
Length=583

 Score = 73.6 bits (179),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 73/150 (49%), Gaps = 22/150 (15%)
 Frame = -1

Query  487  ESQLHMKAKRRDETGASTSREFEAVLGRRNRNKESNEIEGQPLNSDSKRSSRTAFSPKKF  308
            +S +    K +D      SR+     G+R +   +  I+G   + D    S ++    +F
Sbjct  442  DSDVDQSCKEKDVFSGIQSRD-----GQRQKAVSATNIDGGETSDDENDKSSSSNYFIQF  496

Query  307  SGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNI  128
              +  + S P  P+       L+R +FP        W+ +EEEML+EGV KFS  ++   
Sbjct  497  RNIEKQYSYPVMPQ-------LRRKKFP--------WTVQEEEMLKEGVQKFS--SDGKF  539

Query  127  PWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            PW+ IL++G  VF   R   DLKDKWR +C
Sbjct  540  PWKDILEYGCSVFLSGRTTIDLKDKWRNMC  569



>ref|XP_010532943.1| PREDICTED: uncharacterized protein LOC104808828 isoform X1 [Tarenaya 
hassleriana]
Length=446

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 8/84 (10%)
 Frame = -1

Query  268  KQAEEYS-PLQRNQF------PNGRRQK-LMWSTEEEEMLQEGVHKFSISANKNIPWRKI  113
            K+A EY  P QR  F        GR++K L W+ EEEE L+  V K S +AN+N+PWRK+
Sbjct  360  KRATEYHVPKQRFTFMWKDDTNYGRKRKPLYWTPEEEETLRVAVDKVSRAANRNMPWRKV  419

Query  112  LDFGRHVFHPTRMPADLKDKWRTL  41
            L+FGR  F   R+P+DLK+KW+ +
Sbjct  420  LEFGRDKFQEGRIPSDLKEKWKKM  443



>ref|XP_010462525.1| PREDICTED: uncharacterized protein LOC104743106 [Camelina sativa]
Length=317

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -1

Query  223  NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRT  44
            N + ++++W+ EEE+ML  GV K+S    KN+PW+KIL+ G  VFH  R  +DLKDKWR 
Sbjct  254  NDQPKRVLWTVEEEKMLMVGVEKYSKIIKKNMPWKKILEMGEGVFHVNRSSSDLKDKWRK  313

Query  43   L  41
            +
Sbjct  314  M  314



>ref|XP_011087314.1| PREDICTED: uncharacterized protein LOC105168847 isoform X2 [Sesamum 
indicum]
Length=929

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P  RR++L W++ EEE L++G+  +    +K IPW+KIL+FG +VF  +R   DLKDKW
Sbjct  859  IPQLRRKRLPWTSAEEETLKKGMRLYCSPYDKIIPWKKILEFGANVFEQSRTTMDLKDKW  918

Query  49   RTLC  38
            R +C
Sbjct  919  RNMC  922



>ref|XP_011087312.1| PREDICTED: uncharacterized protein LOC105168847 isoform X1 [Sesamum 
indicum]
Length=943

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P  RR++L W++ EEE L++G+  +    +K IPW+KIL+FG +VF  +R   DLKDKW
Sbjct  873  IPQLRRKRLPWTSAEEETLKKGMRLYCSPYDKIIPWKKILEFGANVFEQSRTTMDLKDKW  932

Query  49   RTLC  38
            R +C
Sbjct  933  RNMC  936



>ref|XP_011072839.1| PREDICTED: uncharacterized protein LOC105157969 isoform X2 [Sesamum 
indicum]
Length=920

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            FP  RR ++ W+T EEE L+EG+ KFS   ++ +PW+K+L+FG ++F+ +R   DLKDKW
Sbjct  852  FPQLRRIRVPWTTAEEEALKEGMRKFSTPHDR-LPWKKVLEFGANIFNESRSTVDLKDKW  910

Query  49   RTL  41
            R L
Sbjct  911  RNL  913



>ref|XP_011072836.1| PREDICTED: uncharacterized protein LOC105157969 isoform X1 [Sesamum 
indicum]
 ref|XP_011072837.1| PREDICTED: uncharacterized protein LOC105157969 isoform X1 [Sesamum 
indicum]
 ref|XP_011072838.1| PREDICTED: uncharacterized protein LOC105157969 isoform X1 [Sesamum 
indicum]
Length=935

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            FP  RR ++ W+T EEE L+EG+ KFS   ++ +PW+K+L+FG ++F+ +R   DLKDKW
Sbjct  867  FPQLRRIRVPWTTAEEEALKEGMRKFSTPHDR-LPWKKVLEFGANIFNESRSTVDLKDKW  925

Query  49   RTL  41
            R L
Sbjct  926  RNL  928



>ref|XP_010480621.1| PREDICTED: uncharacterized protein LOC104759374 isoform X2 [Camelina 
sativa]
Length=328

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -1

Query  223  NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRT  44
            N + ++++W+ EEE ML  GV  +S    KN+PWRKIL+ G+ VFH  R  +DLKDKWR 
Sbjct  268  NDQPKRVLWTVEEENMLMVGVKIYSEKIRKNMPWRKILEMGKGVFHVNRSSSDLKDKWRN  327

Query  43   L  41
            +
Sbjct  328  M  328



>ref|XP_010480615.1| PREDICTED: uncharacterized protein LOC104759374 isoform X1 [Camelina 
sativa]
Length=384

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -1

Query  223  NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRT  44
            N + ++++W+ EEE ML  GV  +S    KN+PWRKIL+ G+ VFH  R  +DLKDKWR 
Sbjct  268  NDQPKRVLWTVEEENMLMVGVKIYSEKIRKNMPWRKILEMGKGVFHVNRSSSDLKDKWRN  327

Query  43   LCFR*NSGS  17
            +    N  S
Sbjct  328  MLLWENVSS  336



>ref|XP_002323310.1| hypothetical protein POPTR_0016s05370g [Populus trichocarpa]
 gb|EEF05071.1| hypothetical protein POPTR_0016s05370g [Populus trichocarpa]
Length=827

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 6/77 (8%)
 Frame = -1

Query  268  KQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVF  89
            K+  +Y+P      P  RR+K+ W+  EEE+L+EGV KF+  ++   PW+ IL++G  VF
Sbjct  750  KRERQYTP----AMPQSRRKKVPWTAHEEEILKEGVQKFA--SDGKYPWKDILEYGSSVF  803

Query  88   HPTRMPADLKDKWRTLC  38
               R   DLKDKWR +C
Sbjct  804  SNGRTTIDLKDKWRNMC  820



>ref|XP_011033306.1| PREDICTED: uncharacterized protein LOC105131833 isoform X1 [Populus 
euphratica]
Length=804

 Score = 70.9 bits (172),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 6/77 (8%)
 Frame = -1

Query  268  KQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVF  89
            K+  +Y+P      P  RR+K+ W+ +EEE+L+EGV KF+  ++   PW+ IL++G  VF
Sbjct  727  KRERQYTP----AMPQLRRKKVPWTADEEEILKEGVQKFA--SDGKYPWKDILEYGSSVF  780

Query  88   HPTRMPADLKDKWRTLC  38
               R   DLKDKWR +C
Sbjct  781  SNGRTTIDLKDKWRNMC  797



>ref|XP_008644307.1| PREDICTED: uncharacterized protein LOC103625700 isoform X1 [Zea 
mays]
Length=928

 Score = 70.1 bits (170),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -1

Query  286  SSPDKPKQA---EEYS-PLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWR  119
            +SP K K A   + YS P+ R +    RR+KL W+ EEE ML++G+ KFS   +  I W 
Sbjct  834  TSPAKRKSANPQKHYSNPVARAR----RRRKLWWTAEEEAMLKDGMAKFSPHNDGQISWT  889

Query  118  KILDFGRHVFHPTRMPADLKDKWRTL  41
            +IL +GR VF+  R+P DL+ KWR +
Sbjct  890  QILQYGRGVFNIARLPCDLRVKWRNM  915



>ref|XP_008644308.1| PREDICTED: uncharacterized protein LOC103625700 isoform X2 [Zea 
mays]
 gb|AFW66893.1| putative homeodomain-like transcription factor superfamily protein 
[Zea mays]
Length=800

 Score = 70.1 bits (170),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 8/86 (9%)
 Frame = -1

Query  286  SSPDKPKQA---EEYS-PLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWR  119
            +SP K K A   + YS P+ R +    RR+KL W+ EEE ML++G+ KFS   +  I W 
Sbjct  706  TSPAKRKSANPQKHYSNPVARAR----RRRKLWWTAEEEAMLKDGMAKFSPHNDGQISWT  761

Query  118  KILDFGRHVFHPTRMPADLKDKWRTL  41
            +IL +GR VF+  R+P DL+ KWR +
Sbjct  762  QILQYGRGVFNIARLPCDLRVKWRNM  787



>ref|XP_007028830.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY09332.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=763

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P  RR+KL W+  EEEML+  V K++ S    +PW+KILD G  VF   R   DLKDKW
Sbjct  695  IPQLRRKKLPWTKNEEEMLRREVEKYA-SHGGTVPWKKILDMGTSVFLSGRTTVDLKDKW  753

Query  49   RTLC  38
            R +C
Sbjct  754  RNMC  757



>ref|XP_007028829.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY09331.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=841

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 1/64 (2%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P  RR+KL W+  EEEML+  V K++ S    +PW+KILD G  VF   R   DLKDKW
Sbjct  773  IPQLRRKKLPWTKNEEEMLRREVEKYA-SHGGTVPWKKILDMGTSVFLSGRTTVDLKDKW  831

Query  49   RTLC  38
            R +C
Sbjct  832  RNMC  835



>gb|EYU46844.1| hypothetical protein MIMGU_mgv1a012220mg [Erythranthe guttata]
Length=258

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P+ RR ++ W+ +EE+ L++   K     +K+IP+++IL+ G  VFHP R P DLKDKW
Sbjct  188  IPHPRRPRIRWTKKEEKALKKWKRKLHNDDDKSIPYKEILEAGAGVFHPRRTPTDLKDKW  247

Query  49   RTLC  38
            R +C
Sbjct  248  RNIC  251



>ref|XP_002452154.1| hypothetical protein SORBIDRAFT_04g020760 [Sorghum bicolor]
 gb|EES05130.1| hypothetical protein SORBIDRAFT_04g020760 [Sorghum bicolor]
Length=961

 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = -1

Query  271  PKQAEEYS-PLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRH  95
            P +  +Y+ P +R     GRR +L W+ +EE  L+E +  F+   N+ IPW +IL+ GR 
Sbjct  878  PSRKRKYAYPPKRYSNATGRRSRLCWTVKEEAALREAMKIFTPRDNEPIPWIQILEHGRD  937

Query  94   VFHPTRMPADLKDKWRTL  41
            VF  TR+P+DL+ KWR +
Sbjct  938  VFDETRLPSDLRVKWRNM  955



>emb|CDM85276.1| unnamed protein product [Triticum aestivum]
Length=992

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P GRR KL W+ EEE+ L++ + KF+   +  IPW +IL++G+  FH +R+ +DL+ KWR
Sbjct  925  PPGRRPKLCWTEEEEQALRDAMLKFTPKDDAPIPWTQILEYGKDTFHRSRLASDLRVKWR  984

Query  46   TL  41
             +
Sbjct  985  NM  986



>ref|XP_004952567.1| PREDICTED: uncharacterized protein LOC101781636 [Setaria italica]
Length=931

 Score = 67.0 bits (162),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P GRR KL W+ EEE  L+E + KF+   N  IPW +IL+ GR+VFH TR+P DL+ KWR
Sbjct  864  PTGRRSKLCWTEEEEAALREAMEKFTPRDNGAIPWVQILEHGRNVFHRTRLPCDLRVKWR  923

Query  46   TL  41
             +
Sbjct  924  NM  925



>gb|KHG06835.1| PHD finger 21B [Gossypium arboreum]
Length=685

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 11/84 (13%)
 Frame = -1

Query  289  TSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKIL  110
            TS+ DK      +SP +R      RR+K  W+ +EEEML++GV + + + +  +PW++IL
Sbjct  606  TSADDK-----SFSPTRR-----LRRKKAPWTNDEEEMLRKGVQELA-NEDGTVPWKRIL  654

Query  109  DFGRHVFHPTRMPADLKDKWRTLC  38
            +FG +VF   R   DLK+KWR++C
Sbjct  655  EFGTNVFLMDRTATDLKNKWRSMC  678



>dbj|BAK00800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=928

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P GRR KL W+ EEE+ L++ + KF+      IPW +IL+ GR  FH  R+ +DL+ KWR
Sbjct  861  PAGRRSKLCWTEEEEQALRDAMLKFTPKDGGPIPWVQILESGRGTFHKKRLASDLRVKWR  920

Query  46   TL  41
             +
Sbjct  921  NM  922



>ref|XP_004249272.1| PREDICTED: uncharacterized protein LOC101258507 [Solanum lycopersicum]
 ref|XP_010312131.1| PREDICTED: uncharacterized protein LOC101258507 [Solanum lycopersicum]
 ref|XP_010312132.1| PREDICTED: uncharacterized protein LOC101258507 [Solanum lycopersicum]
 ref|XP_010312133.1| PREDICTED: uncharacterized protein LOC101258507 [Solanum lycopersicum]
Length=886

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 7/71 (10%)
 Frame = -1

Query  241  QRNQF----PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRM  74
            Q N F    P  RR+KL W+  EEE L+EG+ +FS   ++   W++ILDFG  VF   R 
Sbjct  811  QENNFCPWIPQMRRKKLPWTKMEEETLKEGLLRFSHFHDR---WKRILDFGGDVFMKGRT  867

Query  73   PADLKDKWRTL  41
            P DLKDKWR +
Sbjct  868  PGDLKDKWRNI  878



>ref|XP_006577901.1| PREDICTED: uncharacterized protein LOC102661885 isoform X1 [Glycine 
max]
 gb|KHN33682.1| hypothetical protein glysoja_013688 [Glycine soja]
Length=717

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 39/63 (62%), Gaps = 9/63 (14%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPT---RMPADLKDKWR  47
            RR+K+ W+ EEEE ++EGV KF         W+KIL FG HVF      R P DLKDKWR
Sbjct  654  RRKKIPWTAEEEEKIKEGVQKFGKE------WKKILQFGSHVFDKVGKRRTPHDLKDKWR  707

Query  46   TLC  38
             +C
Sbjct  708  NMC  710



>ref|XP_009801592.1| PREDICTED: uncharacterized protein LOC104247318 isoform X2 [Nicotiana 
sylvestris]
Length=352

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 68/125 (54%), Gaps = 8/125 (6%)
 Frame = -1

Query  541  QMQGKTRESAVPFANKEPESQLHMKAKRRDETGASTSREFEAVLGRRNRNKESNEIEGQP  362
            QM G  + +A  F   +P    H+K KRR ETG ST  E + V  +R   K  N++  + 
Sbjct  219  QMIGADQTTAT-FLKADPSLLQHLKGKRRVETGDSTCSESKPVSTQRKPGKLVNKVRDEH  277

Query  361  LNSDS-KRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEE  185
            + +DS +R +RT+ S  + S L G+     +P      S L   + PNG+R++++W  EE
Sbjct  278  MVTDSPRRLTRTSASLLENSNLAGQLVQVKQP------SMLLPVELPNGKRKRVLWRHEE  331

Query  184  EEMLQ  170
            EEML+
Sbjct  332  EEMLE  336



>ref|XP_010091860.1| hypothetical protein L484_002387 [Morus notabilis]
 gb|EXB46301.1| hypothetical protein L484_002387 [Morus notabilis]
Length=922

 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 2/69 (3%)
 Frame = -1

Query  247  PLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPA  68
            P      P  RR+K+ W+  EE+ L+E + KFS    K IPW++IL FG  VF   R   
Sbjct  848  PCNFRGIPQSRRKKVPWTVAEEKKLKEAIQKFS--HEKKIPWKEILKFGDSVFVKGRTTV  905

Query  67   DLKDKWRTL  41
            DLKDKWR +
Sbjct  906  DLKDKWRNM  914



>ref|XP_002451340.1| hypothetical protein SORBIDRAFT_04g000347 [Sorghum bicolor]
 gb|EES04316.1| hypothetical protein SORBIDRAFT_04g000347 [Sorghum bicolor]
Length=392

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -1

Query  247  PLQRNQFPNG--RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRM  74
            P +RN  P    RR+++ WS  EE ML+E + KF+   +  IPW +IL +GR VF   R+
Sbjct  319  PQKRNSNPVAPTRRERMAWSGAEEAMLREAMAKFAPENDAPIPWVRILGYGRSVFDMARL  378

Query  73   PADLKDKWRTL  41
             +DL+ KWR +
Sbjct  379  ASDLRVKWRNM  389



>ref|XP_001751753.1| predicted protein [Physcomitrella patens]
 gb|EDQ83188.1| predicted protein [Physcomitrella patens]
Length=862

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -1

Query  238  RNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLK  59
            R + P  RR+ L W+ EEE+ L EGV + S +      W++IL FG+  F P+R   DLK
Sbjct  792  RRKLPGFRRRPLPWTREEEDALMEGVRRISNNGEWGFHWKRILQFGKGRFDPSRTYGDLK  851

Query  58   DKWRTL  41
            DKWR L
Sbjct  852  DKWRNL  857



>gb|KJB36050.1| hypothetical protein B456_006G138200 [Gossypium raimondii]
Length=590

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 66/108 (61%), Gaps = 9/108 (8%)
 Frame = -1

Query  361  LNSDSKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEE  182
            +NSD + SS +A    K+  ++  ++   K +  + +S  +R      RR+K  W+ +EE
Sbjct  485  VNSDGEESSTSA--DDKYI-ISSHSTRSKKSETRQSFSTTRR-----LRRKKAPWTNDEE  536

Query  181  EMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            EML++G+ + + + +  +PW++IL+FG +VF   R   DLK+KWR++C
Sbjct  537  EMLKKGLQEIA-NEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMC  583



>ref|XP_007145628.1| hypothetical protein PHAVU_007G255000g [Phaseolus vulgaris]
 gb|ESW17622.1| hypothetical protein PHAVU_007G255000g [Phaseolus vulgaris]
Length=918

 Score = 64.3 bits (155),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 8/72 (11%)
 Frame = -1

Query  244  LQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPT---RM  74
             Q NQ    RR+K+ W+ EEE+ML+EGV KF     +   W+ IL FG HVF      R 
Sbjct  845  FQGNQL---RRKKIPWTAEEEDMLREGVQKFGFDDPR--KWKNILAFGSHVFEKVGKRRT  899

Query  73   PADLKDKWRTLC  38
              DLKDKW+ +C
Sbjct  900  SQDLKDKWKNMC  911



>ref|XP_006364332.1| PREDICTED: uncharacterized protein LOC102590076 [Solanum tuberosum]
Length=707

 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 66/135 (49%), Gaps = 18/135 (13%)
 Frame = -1

Query  400  NRNKESNEIEGQ----PLNSDSKRSSRTAFSPKK----FSGLTGETSSPDKPKQAEEYSP  245
            NRNK S E +G+    P+ ++S R+  T   P +       +  E S  ++ +    Y  
Sbjct  568  NRNKNSLEKDGEARSRPVTTNSMRAKVTQIHPPQPHVPHEHVCQENSEEEQDEIGSRYHV  627

Query  244  LQRNQ-------FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFH  86
              RNQ        P  RR+ L W+  EE+ L+EG  +FS   ++   W++IL FG  VF 
Sbjct  628  QSRNQVNNPCPWIPKLRRKNLPWTKMEEKTLKEGFLRFSDCGDR---WKRILAFGGDVFL  684

Query  85   PTRMPADLKDKWRTL  41
              R   DLKDKWR +
Sbjct  685  KARTSGDLKDKWRNI  699



>gb|KDO40422.1| hypothetical protein CISIN_1g038943mg [Citrus sinensis]
Length=213

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  169  EGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            EGV  FS    KN+PW+K+L+FG HVF+PT  P+DLKDK R
Sbjct  160  EGVENFSTKVIKNLPWKKVLEFGCHVFYPTCTPSDLKDKRR  200



>gb|KJB36048.1| hypothetical protein B456_006G138200 [Gossypium raimondii]
Length=676

 Score = 63.9 bits (154),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            RR+K  W+ +EEEML++G+ + + + +  +PW++IL+FG +VF   R   DLK+KWR++C
Sbjct  611  RRKKAPWTNDEEEMLKKGLQEIA-NEDGTVPWKRILEFGTNVFLMDRTATDLKNKWRSMC  669



>ref|XP_006827299.1| hypothetical protein AMTR_s00010p00265560 [Amborella trichopoda]
 gb|ERM94536.1| hypothetical protein AMTR_s00010p00265560 [Amborella trichopoda]
Length=346

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
            P+ RR+   W+ +EEE+L+EGV K     NK IPW++IL FGR  F+  R   DLKDKW
Sbjct  254  PSKRRKIGPWTAKEEEVLKEGV-KLMSEDNKCIPWKRILAFGRDAFNAARTTIDLKDKW  311



>gb|EYU23569.1| hypothetical protein MIMGU_mgv1a003817mg [Erythranthe guttata]
Length=562

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 43/65 (66%), Gaps = 1/65 (2%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHK-FSISANKNIPWRKILDFGRHVFHPTRMPADLKDK  53
             P  RR++L W+ EEE  L++ + + +    +K++P++KIL+ G  VF P+R   DLKDK
Sbjct  491  IPRVRRKRLPWTKEEENALKKWMRELYDPEEDKSLPYKKILEAGAGVFDPSRTTTDLKDK  550

Query  52   WRTLC  38
            WR +C
Sbjct  551  WRNIC  555



>ref|XP_009613453.1| PREDICTED: uncharacterized protein LOC104106584 isoform X3 [Nicotiana 
tomentosiformis]
Length=702

 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P  RR+K+ W+  EEE L+EGV +FS   ++   W++IL+FG  VF   R   DLKDKWR
Sbjct  636  PQLRRKKVQWTKIEEETLKEGVQRFSHFPDR---WKQILEFGCDVFLKGRTTGDLKDKWR  692

Query  46   TL  41
             +
Sbjct  693  NM  694



>ref|XP_010672772.1| PREDICTED: uncharacterized protein LOC104889276 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=668

 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P  RR+K+ W+ EEE +L++GV  +    ++  PW+ IL+FG  VF   R   DLKDKWR
Sbjct  598  PRYRRKKVPWTAEEEAVLKKGVELYQ-GGSRATPWKSILEFGGSVFQKGRTAIDLKDKWR  656

Query  46   TL  41
             +
Sbjct  657  NI  658



>ref|XP_006351323.1| PREDICTED: uncharacterized protein LOC102589560 isoform X1 [Solanum 
tuberosum]
 ref|XP_006351324.1| PREDICTED: uncharacterized protein LOC102589560 isoform X2 [Solanum 
tuberosum]
 ref|XP_006351325.1| PREDICTED: uncharacterized protein LOC102589560 isoform X3 [Solanum 
tuberosum]
Length=869

 Score = 60.8 bits (146),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -1

Query  229  FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKW  50
             P  RR+KL W+  EEE L+EG+ +FS   ++   W++IL+FG  VF   R   DLKDKW
Sbjct  802  IPQLRRKKLPWTKMEEETLKEGLLRFSHFHDR---WKRILEFGGDVFQKGRTSGDLKDKW  858

Query  49   RTL  41
            R +
Sbjct  859  RNI  861



>ref|XP_009804770.1| PREDICTED: uncharacterized protein LOC104249935 isoform X3 [Nicotiana 
sylvestris]
Length=695

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P  RR+K+ W+  EEE L+EGV +FS   ++   W++IL+FG  VF   R   DLKDKWR
Sbjct  629  PQLRRRKVQWTKIEEETLKEGVQRFSHFPDR---WKQILEFGCDVFLKGRTTGDLKDKWR  685

Query  46   TL  41
             +
Sbjct  686  NM  687



>ref|XP_010672769.1| PREDICTED: uncharacterized protein LOC104889276 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010672770.1| PREDICTED: uncharacterized protein LOC104889276 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010672771.1| PREDICTED: uncharacterized protein LOC104889276 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=697

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P  RR+K+ W+ EEE +L++GV  +    ++  PW+ IL+FG  VF   R   DLKDKWR
Sbjct  627  PRYRRKKVPWTAEEEAVLKKGVELYQ-GGSRATPWKSILEFGGSVFQKGRTAIDLKDKWR  685

Query  46   TL  41
             +
Sbjct  686  NI  687



>ref|XP_009613452.1| PREDICTED: uncharacterized protein LOC104106584 isoform X2 [Nicotiana 
tomentosiformis]
Length=812

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P  RR+K+ W+  EEE L+EGV +FS   ++   W++IL+FG  VF   R   DLKDKWR
Sbjct  746  PQLRRKKVQWTKIEEETLKEGVQRFSHFPDR---WKQILEFGCDVFLKGRTTGDLKDKWR  802

Query  46   TL  41
             +
Sbjct  803  NM  804



>ref|XP_009613450.1| PREDICTED: uncharacterized protein LOC104106584 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613451.1| PREDICTED: uncharacterized protein LOC104106584 isoform X1 [Nicotiana 
tomentosiformis]
Length=822

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P  RR+K+ W+  EEE L+EGV +FS   ++   W++IL+FG  VF   R   DLKDKWR
Sbjct  756  PQLRRKKVQWTKIEEETLKEGVQRFSHFPDR---WKQILEFGCDVFLKGRTTGDLKDKWR  812

Query  46   TL  41
             +
Sbjct  813  NM  814



>ref|XP_009804765.1| PREDICTED: uncharacterized protein LOC104249935 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009804766.1| PREDICTED: uncharacterized protein LOC104249935 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009804767.1| PREDICTED: uncharacterized protein LOC104249935 isoform X1 [Nicotiana 
sylvestris]
Length=814

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWR  47
            P  RR+K+ W+  EEE L+EGV +FS   ++   W++IL+FG  VF   R   DLKDKWR
Sbjct  748  PQLRRRKVQWTKIEEETLKEGVQRFSHFPDR---WKQILEFGCDVFLKGRTTGDLKDKWR  804

Query  46   TL  41
             +
Sbjct  805  NM  806



>ref|XP_004302169.1| PREDICTED: uncharacterized protein LOC101291254 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=242

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -1

Query  220  GRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            G R++++W+ +E + L+EGV        KNIPW KIL   +  FH +R  A+LKDKW+++
Sbjct  178  GGRRRVLWTEDEIKALEEGVQNIWNPTRKNIPWEKILQAYKDRFHSSRTAANLKDKWKSM  237



>ref|XP_008892249.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETI49505.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETL42795.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL95966.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM49155.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN23045.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETO78227.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP47210.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=262

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 5/56 (9%)
 Frame = -1

Query  205  LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            + WS EEE  L+ GV K+ I       W+KIL  G+ VF   R   DLKDKW+ LC
Sbjct  122  MFWSAEEETFLRRGVEKYGIG-----KWKKILIDGKDVFSSHRTNVDLKDKWKNLC  172



>gb|ETK89389.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETP19264.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
Length=262

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 5/56 (9%)
 Frame = -1

Query  205  LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            + WS EEE  L+ GV K+ I       W+KIL  G+ VF   R   DLKDKW+ LC
Sbjct  122  MFWSAEEETFLRRGVEKYGIG-----KWKKILIDGKDVFSSHRTNVDLKDKWKNLC  172



>ref|XP_008892248.1| hypothetical protein PPTG_02759 [Phytophthora parasitica INRA-310]
 gb|ETN23044.1| hypothetical protein PPTG_02759 [Phytophthora parasitica INRA-310]
 gb|ETO78226.1| hypothetical protein F444_06733 [Phytophthora parasitica P1976]
Length=334

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 5/56 (9%)
 Frame = -1

Query  205  LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            + WS EEE  L+ GV K+ I       W+KIL  G+ VF   R   DLKDKW+ LC
Sbjct  122  MFWSAEEETFLRRGVEKYGIG-----KWKKILIDGKDVFSSHRTNVDLKDKWKNLC  172



>gb|ETI49504.1| hypothetical protein F443_06662 [Phytophthora parasitica P1569]
 gb|ETL42794.1| hypothetical protein L916_06477 [Phytophthora parasitica]
 gb|ETL95965.1| hypothetical protein L917_06344 [Phytophthora parasitica]
 gb|ETM49154.1| hypothetical protein L914_06450 [Phytophthora parasitica]
 gb|ETP47209.1| hypothetical protein F442_06702 [Phytophthora parasitica P10297]
Length=334

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 5/56 (9%)
 Frame = -1

Query  205  LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            + WS EEE  L+ GV K+ I       W+KIL  G+ VF   R   DLKDKW+ LC
Sbjct  122  MFWSAEEETFLRRGVEKYGIG-----KWKKILIDGKDVFSSHRTNVDLKDKWKNLC  172



>ref|XP_001759833.1| predicted protein [Physcomitrella patens]
 gb|EDQ75337.1| predicted protein [Physcomitrella patens]
Length=947

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  205  LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
            L W+  EE+ L+EGV  +S +      W++IL+FG   F P+R   DLKDKWR L
Sbjct  888  LPWTRAEEDALKEGVRLYSYNGAWGFQWKRILEFGEGRFDPSRTDVDLKDKWRNL  942



>gb|ETK89388.1| hypothetical protein L915_06536 [Phytophthora parasitica]
 gb|ETP19263.1| hypothetical protein F441_06669 [Phytophthora parasitica CJ01A1]
Length=334

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 5/56 (9%)
 Frame = -1

Query  205  LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            + WS EEE  L+ GV K+ I       W+KIL  G+ VF   R   DLKDKW+ LC
Sbjct  122  MFWSAEEETFLRRGVEKYGIG-----KWKKILIDGKDVFSSHRTNVDLKDKWKNLC  172



>ref|XP_006469394.1| PREDICTED: uncharacterized protein LOC102624735 [Citrus sinensis]
Length=115

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  178  MLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDK  53
            M +EGV KFS    KN+ W+K+L+FG  VF PT  P+DLKDK
Sbjct  1    MGKEGVDKFSTKIIKNLSWKKVLEFGCRVFDPTCTPSDLKDK  42



>ref|XP_002999221.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY69367.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=1272

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 5/56 (9%)
 Frame = -1

Query  205   LMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
             + WS EEEE L+ GV K+ I       W+KIL  G  VF   R   DLKDKW+ +C
Sbjct  1069  VFWSAEEEEFLRRGVEKYGIG-----KWKKILIDGNDVFSSHRTNVDLKDKWKNMC  1119



>gb|EPS59795.1| hypothetical protein M569_15011 [Genlisea aurea]
Length=81

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = -1

Query  202  MWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTL  41
             W+  E E L EGV  +      +IPW+ +L FG   F+P+R   DLKDKWR +
Sbjct  16   WWTEAEVEALVEGVKAYFHPNQSSIPWKLVLAFGTGRFNPSRTVTDLKDKWRNI  69



>ref|XP_010031230.1| PREDICTED: uncharacterized protein LOC104421078 isoform X2 [Eucalyptus 
grandis]
Length=418

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 6/69 (9%)
 Frame = -1

Query  247  PLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPA  68
            PL R+   +GRR+   WS EEEE L+ GV +F         W+ IL   RH+F   R   
Sbjct  353  PLTRSLKVSGRRKAKRWSLEEEETLRNGVQRFGKGN-----WKLILHCYRHIFE-ERTEV  406

Query  67   DLKDKWRTL  41
            DLKDKWR +
Sbjct  407  DLKDKWRNM  415



>gb|KCW83777.1| hypothetical protein EUGRSUZ_B00647 [Eucalyptus grandis]
Length=517

 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 39/69 (57%), Gaps = 6/69 (9%)
 Frame = -1

Query  247  PLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPA  68
            PL R+   +GRR+   WS EEEE L+ GV +F    N    W+ IL   RH+F   R   
Sbjct  452  PLTRSLKVSGRRKAKRWSLEEEETLRNGVQRFG-KGN----WKLILHCYRHIFE-ERTEV  505

Query  67   DLKDKWRTL  41
            DLKDKWR +
Sbjct  506  DLKDKWRNM  514



>ref|XP_009587848.1| PREDICTED: uncharacterized protein LOC104085504 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009587849.1| PREDICTED: uncharacterized protein LOC104085504 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009587850.1| PREDICTED: uncharacterized protein LOC104085504 isoform X1 [Nicotiana 
tomentosiformis]
Length=481

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 38/73 (52%), Gaps = 8/73 (11%)
 Frame = -1

Query  253  YSPLQRNQF--PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPT  80
             SPL++  F     RR+   WST EEE L+ GV K+ +       WR I D    +F   
Sbjct  413  VSPLKKYGFKKVTKRRKSKRWSTIEEETLRSGVQKYGVG-----NWRLIFDTNHEIFE-D  466

Query  79   RMPADLKDKWRTL  41
            R P DLKDKWR L
Sbjct  467  RTPVDLKDKWRNL  479



>ref|XP_010029695.1| PREDICTED: telomeric repeat-binding factor 2-like isoform X1 
[Eucalyptus grandis]
 gb|KCW83596.1| hypothetical protein EUGRSUZ_B00490 [Eucalyptus grandis]
Length=502

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 39/69 (57%), Gaps = 6/69 (9%)
 Frame = -1

Query  247  PLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPA  68
            PL R+   +GRR+   WS EEEE L+ GV +F    N    W+ IL   RH+F   R   
Sbjct  437  PLTRSLKVSGRRKVKRWSLEEEETLRNGVQRFG-KGN----WKLILHCYRHIFE-ERTEV  490

Query  67   DLKDKWRTL  41
            DLKDKWR +
Sbjct  491  DLKDKWRNM  499



>gb|EPS72218.1| hypothetical protein M569_02550 [Genlisea aurea]
Length=326

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 7/72 (10%)
 Frame = -1

Query  256  EYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTR  77
            E+ P +RN     R + + W  EE  ML+ GV  F     K IPW+K+L+ G  VF   R
Sbjct  252  EWRPRKRN-----RTKSIAWKPEEIAMLKRGVELFR--NEKKIPWKKVLEMGIGVFDEFR  304

Query  76   MPADLKDKWRTL  41
             P+DLK +W  L
Sbjct  305  SPSDLKGQWNNL  316



>gb|EMT27515.1| Casein kinase I isoform delta-like protein [Aegilops tauschii]
Length=1300

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  226  PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFH  86
            P GRR KL W+ EEE+ L++ + KF+   +  IPW +IL++G+  FH
Sbjct  913  PPGRRPKLCWTEEEEQALRDAMLKFTPKDDAPIPWTQILEYGKDTFH  959



>gb|EMS53431.1| DNA (cytosine-5)-methyltransferase 1 [Triticum urartu]
Length=960

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = -1

Query  271  PKQAEEYSPLQRNQ---FPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFG  101
            P +  +Y+P +R      P GRR KL W+ EEE+ L++ + KF+   ++ IPW +IL++ 
Sbjct  739  PSRKRKYAPPKRYCNPVAPAGRRSKLCWTEEEEQALRDAMLKFTPKDDELIPWIQILEYA  798

Query  100  RHVF  89
             H+F
Sbjct  799  SHLF  802



>ref|XP_009787002.1| PREDICTED: uncharacterized protein LOC104235031 isoform X1 [Nicotiana 
sylvestris]
Length=481

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 38/71 (54%), Gaps = 8/71 (11%)
 Frame = -1

Query  247  PLQRNQF--PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRM  74
            PL++ +F     RR+   WST EEE L+ GV K+ +       WR I D    +F   R 
Sbjct  415  PLKKYEFKKVTKRRKSKRWSTIEEETLRSGVQKYGVGN-----WRLIFDTYHEIFE-DRT  468

Query  73   PADLKDKWRTL  41
            P DLKDKWR L
Sbjct  469  PGDLKDKWRNL  479



>ref|NP_001105597.1| terminal acidic SANT 1 [Zea mays]
 gb|AAV28560.1| terminal acidic SANT 1 [Zea mays]
 gb|ACG40093.1| terminal acidic SANT 1 [Zea mays]
 gb|ACR36002.1| unknown [Zea mays]
 gb|AFW75712.1| terminal acidic SANT 1 [Zea mays]
Length=422

 Score = 52.0 bits (123),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 6/64 (9%)
 Frame = -1

Query  223  NGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRT  44
            N RR+   WS  EEE L++GV ++ +       WR ILD     F   R P DLKDKWR 
Sbjct  365  NNRRKARRWSLFEEETLRKGVEEYGVGN-----WRDILDNNAEAFT-GRTPVDLKDKWRN  418

Query  43   LCFR  32
            + FR
Sbjct  419  MLFR  422



>gb|AAV87181.1| terminal acidic SANT 1, partial [Zea mays]
Length=56

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 6/62 (10%)
 Frame = -1

Query  217  RRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDKWRTLC  38
            RR+   WS  EEE L++GV ++ +       WR ILD     F   R P DLKDKWR + 
Sbjct  1    RRKARRWSLFEEETLRKGVEEYGVG-----NWRDILDNNAEAF-TGRTPVDLKDKWRNML  54

Query  37   FR  32
            FR
Sbjct  55   FR  56



>gb|EMT02974.1| hypothetical protein F775_18538 [Aegilops tauschii]
Length=802

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 41/76 (54%), Gaps = 9/76 (12%)
 Frame = -1

Query  250  SPLQRNQFP----NGRRQKLMWSTEEEEMLQEGVHKFSISAN-----KNIPWRKILDFGR  98
            SPL  ++ P      RR+ + W+  EE  L+E V KF+ +       ++I W +I ++ R
Sbjct  705  SPLAPSKTPFTSTTARRKMIFWTEAEEVALREAVAKFAPNGEAAKEKRSISWVRIHEYCR  764

Query  97   HVFHPTRMPADLKDKW  50
               HPTR P DL+ KW
Sbjct  765  ESIHPTRCPDDLRKKW  780



>dbj|BAK06702.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=416

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 40/71 (56%), Gaps = 6/71 (8%)
 Frame = -1

Query  253  YSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRM  74
             SPLQ  +  + RR+   WS+ EEE L++GV +F  S N    W+ IL     VF   R 
Sbjct  350  VSPLQVAENKSMRRRARRWSSVEEEALKDGVEQFG-SGN----WKDILSHNADVFI-GRT  403

Query  73   PADLKDKWRTL  41
            P DLKDKWR +
Sbjct  404  PVDLKDKWRNM  414



>ref|XP_006350882.1| PREDICTED: uncharacterized protein LOC102603861 [Solanum tuberosum]
Length=468

 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 59/124 (48%), Gaps = 19/124 (15%)
 Frame = -1

Query  406  RRNRNKESNEIEGQPLNSDSKRSSRTAFSPKKFSGLTGETSSPDKPKQAEEYSPLQRNQF  227
            R N+N  +N     PL  D      T  SP K + +T  T     PK  +  SPL++ +F
Sbjct  360  RVNQNSAAN-----PLELDDFFDEVTERSPSKANRVTLPT-----PKTTK-VSPLKKYEF  408

Query  226  --PNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWRKILDFGRHVFHPTRMPADLKDK  53
                 RR+ + WS+ EE+ L+ GV K+         W+ ILD    +F   R   DLKDK
Sbjct  409  KKITTRRKPMKWSSLEEDTLRTGVQKYGTGN-----WKVILDTYHGIFS-VRTACDLKDK  462

Query  52   WRTL  41
            WR +
Sbjct  463  WRNM  466



>ref|XP_008659207.1| PREDICTED: telomeric repeat-binding factor 1-like [Zea mays]
Length=101

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 42/89 (47%), Gaps = 6/89 (7%)
 Frame = -1

Query  298  TGETSSPDKPKQAEEYSPLQRNQFPNGRRQKLMWSTEEEEMLQEGVHKFSISANKNIPWR  119
              E+S    P      SPL      NGRR+   W   EEE L++GV ++         W+
Sbjct  19   CSESSLRRPPLPIVPVSPLAPRVKKNGRRKARRWCLLEEETLRKGVEQYGRGN-----WK  73

Query  118  KILDFGRHVFHPTRMPADLKDKWRTLCFR  32
            +ILD    VF   R P DLKDKWR +  R
Sbjct  74   EILDNNPDVFI-GRTPVDLKDKWRNMIIR  101



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2341242863510