BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF039O20

Length=813
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786623.1|  PREDICTED: uncharacterized protein LOC104234713    366   1e-121   Nicotiana sylvestris
ref|XP_009761711.1|  PREDICTED: uncharacterized protein LOC104213860    363   2e-120   Nicotiana sylvestris
ref|XP_009627129.1|  PREDICTED: uncharacterized protein LOC104117749    362   4e-120   Nicotiana tomentosiformis
ref|XP_009619401.1|  PREDICTED: uncharacterized protein LOC104111412    361   1e-119   Nicotiana tomentosiformis
ref|XP_007029857.1|  Nuclear factor 1 A-type isoform 2                  348   1e-114   
ref|XP_003529004.1|  PREDICTED: uncharacterized protein LOC100788...    348   2e-114   
ref|XP_002319218.1|  hypothetical protein POPTR_0013s06840g             347   5e-114   Populus trichocarpa [western balsam poplar]
ref|XP_011086622.1|  PREDICTED: uncharacterized protein LOC105168293    346   1e-113   Sesamum indicum [beniseed]
ref|XP_002268337.1|  PREDICTED: uncharacterized protein LOC100245378    345   2e-113   Vitis vinifera
gb|KHG10101.1|  Mitochondrial inner membrane protease subunit 1         343   1e-112   Gossypium arboreum [tree cotton]
emb|CDP16208.1|  unnamed protein product                                344   1e-112   Coffea canephora [robusta coffee]
gb|KJB44386.1|  hypothetical protein B456_007G249900                    343   2e-112   Gossypium raimondii
emb|CAN65847.1|  hypothetical protein VITISV_014976                     340   2e-111   Vitis vinifera
ref|XP_008460086.1|  PREDICTED: uncharacterized protein LOC103499002    340   3e-111   Cucumis melo [Oriental melon]
ref|XP_004145014.1|  PREDICTED: uncharacterized protein LOC101209874    339   4e-111   
ref|XP_004229535.1|  PREDICTED: uncharacterized protein LOC101261157    339   4e-111   
ref|XP_006359111.1|  PREDICTED: uncharacterized protein LOC102583...    336   6e-110   
ref|XP_007029856.1|  Nuclear factor 1 A-type isoform 1                  337   1e-109   
ref|XP_010324887.1|  PREDICTED: uncharacterized protein LOC101268299    333   1e-108   Solanum lycopersicum
ref|XP_006346697.1|  PREDICTED: uncharacterized protein LOC102596535    333   2e-108   Solanum tuberosum [potatoes]
emb|CAJ19269.1|  putative stress-induced protein                        331   9e-108   Solanum commersonii
ref|XP_010097676.1|  hypothetical protein L484_023816                   330   3e-107   Morus notabilis
gb|KEH18002.1|  stress-induced protein, putative                        329   4e-107   Medicago truncatula
ref|XP_010056513.1|  PREDICTED: uncharacterized protein LOC104444526    329   4e-107   Eucalyptus grandis [rose gum]
ref|XP_006437344.1|  hypothetical protein CICLE_v10031611mg             327   3e-106   Citrus clementina [clementine]
gb|ACV88395.1|  putative stress-induced protein                         319   7e-106   Cucumis sativus [cucumbers]
ref|XP_007134346.1|  hypothetical protein PHAVU_010G039800g             326   7e-106   Phaseolus vulgaris [French bean]
gb|KJB46076.1|  hypothetical protein B456_007G347500                    325   2e-105   Gossypium raimondii
ref|XP_003521028.1|  PREDICTED: uncharacterized protein LOC100815...    325   3e-105   Glycine max [soybeans]
gb|KHG03019.1|  Wilms tumor                                             324   4e-105   Gossypium arboreum [tree cotton]
gb|KDP39605.1|  hypothetical protein JCGZ_02625                         323   5e-105   Jatropha curcas
ref|XP_011004940.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    322   2e-104   Populus euphratica
ref|XP_004510160.1|  PREDICTED: uncharacterized protein LOC101490...    322   3e-104   Cicer arietinum [garbanzo]
ref|XP_002523978.1|  conserved hypothetical protein                     321   6e-104   Ricinus communis
ref|XP_010266416.1|  PREDICTED: uncharacterized protein LOC104603937    320   2e-103   Nelumbo nucifera [Indian lotus]
ref|XP_008232195.1|  PREDICTED: uncharacterized protein LOC103331357    320   3e-103   Prunus mume [ume]
ref|XP_007218028.1|  hypothetical protein PRUPE_ppa005972mg             319   4e-103   Prunus persica
ref|XP_010549738.1|  PREDICTED: uncharacterized protein LOC104820818    318   6e-103   Tarenaya hassleriana [spider flower]
ref|XP_008345095.1|  PREDICTED: uncharacterized protein LOC103407996    317   5e-102   
ref|XP_006400305.1|  hypothetical protein EUTSA_v10013602mg             316   7e-102   Eutrema salsugineum [saltwater cress]
gb|EYU27182.1|  hypothetical protein MIMGU_mgv1a006729mg                316   7e-102   Erythranthe guttata [common monkey flower]
gb|KFK25983.1|  hypothetical protein AALP_AA8G187900                    315   9e-102   Arabis alpina [alpine rockcress]
ref|XP_004307193.1|  PREDICTED: uncharacterized protein LOC101307926    314   3e-101   Fragaria vesca subsp. vesca
ref|NP_197266.1|  uncharacterized protein                               313   6e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873840.1|  hypothetical protein ARALYDRAFT_909762             313   1e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_010420495.1|  PREDICTED: uncharacterized protein LOC104706...    313   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010420494.1|  PREDICTED: uncharacterized protein LOC104706...    313   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006289579.1|  hypothetical protein CARUB_v10003124mg             312   1e-100   Capsella rubella
ref|XP_010492723.1|  PREDICTED: uncharacterized protein LOC104770072    312   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010453965.1|  PREDICTED: uncharacterized protein LOC104735808    312   2e-100   Camelina sativa [gold-of-pleasure]
emb|CDY16904.1|  BnaC09g40310D                                          309   2e-99    Brassica napus [oilseed rape]
ref|XP_009107533.1|  PREDICTED: uncharacterized protein LOC103833189    309   3e-99    Brassica rapa
ref|XP_009361368.1|  PREDICTED: uncharacterized protein LOC103951663    307   4e-98    
ref|XP_009345575.1|  PREDICTED: uncharacterized protein LOC103937356    306   6e-98    Pyrus x bretschneideri [bai li]
ref|XP_010275162.1|  PREDICTED: uncharacterized protein LOC104610306    300   9e-96    Nelumbo nucifera [Indian lotus]
gb|KJB46078.1|  hypothetical protein B456_007G347500                    269   2e-84    Gossypium raimondii
ref|XP_010905311.1|  PREDICTED: uncharacterized protein LOC105032546    270   4e-84    
ref|XP_008777938.1|  PREDICTED: uncharacterized protein LOC103697788    269   1e-83    Phoenix dactylifera
gb|EYU42265.1|  hypothetical protein MIMGU_mgv1a007286mg                265   2e-82    Erythranthe guttata [common monkey flower]
ref|XP_009398606.1|  PREDICTED: uncharacterized protein LOC103983151    260   3e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002443918.1|  hypothetical protein SORBIDRAFT_07g004370          221   5e-65    Sorghum bicolor [broomcorn]
gb|ACN28488.1|  unknown                                                 218   9e-64    Zea mays [maize]
ref|NP_001061067.1|  Os08g0163500                                       212   1e-61    
ref|XP_001760212.1|  predicted protein                                  207   5e-60    
ref|XP_001778621.1|  predicted protein                                  206   1e-59    
gb|KHG29270.1|  hypothetical protein F383_14119                         203   1e-58    Gossypium arboreum [tree cotton]
gb|KJB54312.1|  hypothetical protein B456_009G028600                    203   2e-58    Gossypium raimondii
emb|CDP03235.1|  unnamed protein product                                203   2e-58    Coffea canephora [robusta coffee]
ref|XP_010049600.1|  PREDICTED: uncharacterized protein LOC104438202    201   1e-57    Eucalyptus grandis [rose gum]
ref|XP_002514196.1|  conserved hypothetical protein                     200   2e-57    Ricinus communis
gb|KJB07238.1|  hypothetical protein B456_001G009800                    202   2e-57    Gossypium raimondii
gb|KHG26934.1|  hypothetical protein F383_08453                         200   2e-57    Gossypium arboreum [tree cotton]
ref|XP_007012983.1|  Uncharacterized protein TCM_037753                 200   2e-57    Theobroma cacao [chocolate]
emb|CDY06823.1|  BnaC01g09220D                                          199   5e-57    
gb|KDP33775.1|  hypothetical protein JCGZ_07346                         199   5e-57    Jatropha curcas
ref|XP_009602498.1|  PREDICTED: uncharacterized protein LOC104097612    199   8e-57    Nicotiana tomentosiformis
gb|KDO55858.1|  hypothetical protein CISIN_1g017474mg                   197   1e-56    Citrus sinensis [apfelsine]
gb|KFK29490.1|  hypothetical protein AALP_AA7G141200                    199   1e-56    Arabis alpina [alpine rockcress]
ref|XP_008458969.1|  PREDICTED: uncharacterized protein LOC103498220    198   1e-56    Cucumis melo [Oriental melon]
ref|XP_002965215.1|  hypothetical protein SELMODRAFT_230537             199   1e-56    
ref|XP_002962295.1|  hypothetical protein SELMODRAFT_77561              199   1e-56    
ref|XP_004287493.1|  PREDICTED: uncharacterized protein LOC101301714    198   1e-56    Fragaria vesca subsp. vesca
ref|XP_009766756.1|  PREDICTED: uncharacterized protein LOC104218054    198   1e-56    Nicotiana sylvestris
ref|XP_004141026.1|  PREDICTED: uncharacterized protein LOC101219082    198   2e-56    
gb|KGN60567.1|  hypothetical protein Csa_2G000750                       198   2e-56    Cucumis sativus [cucumbers]
ref|XP_010438312.1|  PREDICTED: uncharacterized protein LOC104721933    198   2e-56    Camelina sativa [gold-of-pleasure]
ref|XP_010433108.1|  PREDICTED: uncharacterized protein LOC104717264    198   2e-56    Camelina sativa [gold-of-pleasure]
ref|XP_002283391.1|  PREDICTED: uncharacterized protein LOC100245695    197   2e-56    Vitis vinifera
ref|NP_194660.1|  uncharacterized protein                               197   2e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867413.1|  hypothetical protein ARALYDRAFT_913577             197   2e-56    Arabidopsis lyrata subsp. lyrata
ref|XP_007152956.1|  hypothetical protein PHAVU_004G174300g             197   4e-56    Phaseolus vulgaris [French bean]
ref|XP_010447867.1|  PREDICTED: uncharacterized protein LOC104730404    198   4e-56    Camelina sativa [gold-of-pleasure]
ref|XP_002992680.1|  hypothetical protein SELMODRAFT_135747             197   4e-56    
ref|XP_002980096.1|  hypothetical protein SELMODRAFT_111932             197   5e-56    
ref|XP_006283793.1|  hypothetical protein CARUB_v10004884mg             196   6e-56    Capsella rubella
ref|XP_011093657.1|  PREDICTED: uncharacterized protein LOC105173566    196   7e-56    Sesamum indicum [beniseed]
ref|XP_006451341.1|  hypothetical protein CICLE_v10008480mg             196   7e-56    
ref|XP_006412853.1|  hypothetical protein EUTSA_v10025288mg             196   1e-55    Eutrema salsugineum [saltwater cress]
dbj|BAJ98408.1|  predicted protein                                      196   1e-55    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003525292.1|  PREDICTED: uncharacterized protein LOC100785838    196   2e-55    Glycine max [soybeans]
emb|CDY48610.1|  BnaA01g07550D                                          195   2e-55    Brassica napus [oilseed rape]
ref|XP_008242466.1|  PREDICTED: uncharacterized protein LOC103340798    195   3e-55    Prunus mume [ume]
ref|XP_003530524.1|  PREDICTED: uncharacterized protein LOC100811...    194   3e-55    Glycine max [soybeans]
ref|XP_007202154.1|  hypothetical protein PRUPE_ppa006267mg             194   4e-55    Prunus persica
ref|XP_009352575.1|  PREDICTED: uncharacterized protein LOC103943924    194   4e-55    Pyrus x bretschneideri [bai li]
ref|XP_010688362.1|  PREDICTED: uncharacterized protein LOC104902329    194   6e-55    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003620756.1|  hypothetical protein MTR_6g090060                  194   8e-55    Medicago truncatula
ref|XP_008799780.1|  PREDICTED: uncharacterized protein LOC103714350    193   1e-54    Phoenix dactylifera
ref|XP_008387423.1|  PREDICTED: uncharacterized protein LOC103449874    193   2e-54    Malus domestica [apple tree]
ref|XP_008337614.1|  PREDICTED: uncharacterized protein LOC103400735    192   2e-54    
ref|XP_003530182.1|  PREDICTED: uncharacterized protein LOC100790306    192   3e-54    Glycine max [soybeans]
ref|XP_010267102.1|  PREDICTED: uncharacterized protein LOC104604464    192   3e-54    Nelumbo nucifera [Indian lotus]
ref|XP_010249469.1|  PREDICTED: uncharacterized protein LOC104592027    192   4e-54    Nelumbo nucifera [Indian lotus]
ref|XP_010110868.1|  hypothetical protein L484_006983                   191   8e-54    Morus notabilis
ref|XP_001754636.1|  predicted protein                                  191   1e-53    
ref|XP_009128862.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    190   2e-53    Brassica rapa
ref|XP_010526420.1|  PREDICTED: uncharacterized protein LOC104803996    189   4e-53    Tarenaya hassleriana [spider flower]
ref|XP_007160272.1|  hypothetical protein PHAVU_002G307300g             189   4e-53    Phaseolus vulgaris [French bean]
ref|XP_009395733.1|  PREDICTED: uncharacterized protein LOC103980924    189   5e-53    
ref|XP_004251646.1|  PREDICTED: uncharacterized protein LOC101262285    189   7e-53    Solanum lycopersicum
ref|XP_006353504.1|  PREDICTED: uncharacterized protein LOC102579879    188   9e-53    Solanum tuberosum [potatoes]
ref|XP_004157897.1|  PREDICTED: uncharacterized LOC101219082            182   9e-53    
ref|XP_009597038.1|  PREDICTED: uncharacterized protein LOC104093034    187   3e-52    Nicotiana tomentosiformis
ref|XP_010539384.1|  PREDICTED: uncharacterized protein LOC104813482    186   5e-52    Tarenaya hassleriana [spider flower]
ref|XP_009757179.1|  PREDICTED: uncharacterized protein LOC104210073    186   7e-52    Nicotiana sylvestris
ref|XP_003516376.1|  PREDICTED: uncharacterized protein LOC100805866    186   7e-52    Glycine max [soybeans]
ref|XP_008367920.1|  PREDICTED: uncharacterized protein LOC103431533    179   2e-51    
ref|XP_010042246.1|  PREDICTED: uncharacterized protein LOC104431287    181   2e-51    
gb|AIE44349.1|  putative stress-induced protein                         174   6e-51    Ostryopsis davidiana
ref|XP_008795504.1|  PREDICTED: uncharacterized protein LOC103711219    183   1e-50    Phoenix dactylifera
gb|AIE44359.1|  DUF1005 protein                                         174   1e-50    Corylus mandshurica
ref|XP_010924447.1|  PREDICTED: uncharacterized protein LOC105047284    183   1e-50    Elaeis guineensis
gb|AIE44355.1|  putative stress-induced protein                         173   2e-50    Ostryopsis intermedia
ref|XP_010915009.1|  PREDICTED: uncharacterized protein LOC105040251    182   3e-50    Elaeis guineensis
ref|XP_004503501.1|  PREDICTED: uncharacterized protein LOC101489321    179   2e-49    Cicer arietinum [garbanzo]
ref|XP_009416467.1|  PREDICTED: uncharacterized protein LOC103997060    179   5e-49    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002510019.1|  conserved hypothetical protein                     177   2e-48    Ricinus communis
ref|XP_009410899.1|  PREDICTED: uncharacterized protein LOC103992782    176   5e-48    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY63745.1|  BnaC05g07770D                                          175   1e-47    Brassica napus [oilseed rape]
ref|XP_011078236.1|  PREDICTED: uncharacterized protein LOC105162032    174   1e-47    Sesamum indicum [beniseed]
ref|XP_010104534.1|  hypothetical protein L484_025508                   175   1e-47    Morus notabilis
dbj|BAJ91729.1|  predicted protein                                      174   3e-47    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009406176.1|  PREDICTED: uncharacterized protein LOC103989135    174   3e-47    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB64011.1|  hypothetical protein B456_010G029500                    174   4e-47    Gossypium raimondii
ref|XP_010544039.1|  PREDICTED: uncharacterized protein LOC104816779    174   5e-47    Tarenaya hassleriana [spider flower]
gb|KDP41556.1|  hypothetical protein JCGZ_15963                         173   6e-47    Jatropha curcas
gb|KHN16657.1|  hypothetical protein glysoja_002754                     166   7e-47    Glycine soja [wild soybean]
ref|XP_002301131.1|  hypothetical protein POPTR_0002s11320g             173   9e-47    Populus trichocarpa [western balsam poplar]
ref|XP_008352747.1|  PREDICTED: uncharacterized protein LOC103416271    172   1e-46    
emb|CDM84004.1|  unnamed protein product                                172   1e-46    Triticum aestivum [Canadian hard winter wheat]
gb|KHN40365.1|  hypothetical protein glysoja_000863                     166   1e-46    Glycine soja [wild soybean]
gb|KHM99820.1|  hypothetical protein glysoja_017518                     166   1e-46    Glycine soja [wild soybean]
ref|XP_011017042.1|  PREDICTED: uncharacterized protein LOC105120505    172   2e-46    Populus euphratica
ref|XP_009335470.1|  PREDICTED: uncharacterized protein LOC103928190    172   2e-46    Pyrus x bretschneideri [bai li]
ref|XP_008339055.1|  PREDICTED: uncharacterized protein LOC103402092    172   2e-46    
ref|XP_009357220.1|  PREDICTED: uncharacterized protein LOC103947956    171   3e-46    Pyrus x bretschneideri [bai li]
ref|XP_004299850.1|  PREDICTED: uncharacterized protein LOC101308766    171   5e-46    Fragaria vesca subsp. vesca
emb|CDY57930.1|  BnaA06g37990D                                          171   6e-46    Brassica napus [oilseed rape]
ref|XP_007018388.1|  Formin-like protein 18                             171   6e-46    
ref|XP_002285542.1|  PREDICTED: uncharacterized protein LOC100245533    170   8e-46    Vitis vinifera
ref|XP_010458327.1|  PREDICTED: uncharacterized protein LOC104739...    171   9e-46    Camelina sativa [gold-of-pleasure]
ref|XP_010232287.1|  PREDICTED: uncharacterized protein LOC100822437    170   9e-46    Brachypodium distachyon [annual false brome]
ref|XP_006307457.1|  hypothetical protein CARUB_v10009083mg             171   9e-46    Capsella rubella
emb|CAN62368.1|  hypothetical protein VITISV_001847                     170   1e-45    Vitis vinifera
ref|XP_010245617.1|  PREDICTED: uncharacterized protein LOC104589117    170   1e-45    Nelumbo nucifera [Indian lotus]
ref|XP_004136235.1|  PREDICTED: uncharacterized protein LOC101220969    170   1e-45    Cucumis sativus [cucumbers]
ref|XP_010490593.1|  PREDICTED: uncharacterized protein LOC104768341    170   1e-45    Camelina sativa [gold-of-pleasure]
ref|XP_006852767.1|  hypothetical protein AMTR_s00033p00137950          170   1e-45    Amborella trichopoda
ref|XP_008219142.1|  PREDICTED: uncharacterized protein LOC103319390    169   2e-45    Prunus mume [ume]
ref|XP_002306517.2|  hypothetical protein POPTR_0005s19380g             169   2e-45    
ref|XP_007222135.1|  hypothetical protein PRUPE_ppa005719mg             169   3e-45    Prunus persica
ref|NP_172473.1|  uncharacterized protein                               169   3e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417503.1|  hypothetical protein EUTSA_v10007581mg             168   5e-45    Eutrema salsugineum [saltwater cress]
ref|XP_002892543.1|  hypothetical protein ARALYDRAFT_888260             168   5e-45    Arabidopsis lyrata subsp. lyrata
ref|XP_008466095.1|  PREDICTED: uncharacterized protein LOC103503621    168   6e-45    
ref|XP_011011605.1|  PREDICTED: uncharacterized protein LOC105116107    168   8e-45    Populus euphratica
ref|XP_010061596.1|  PREDICTED: uncharacterized protein LOC104449221    168   9e-45    Eucalyptus grandis [rose gum]
ref|XP_004501082.1|  PREDICTED: uncharacterized protein LOC101496773    167   1e-44    Cicer arietinum [garbanzo]
gb|EYU30689.1|  hypothetical protein MIMGU_mgv1a0070432mg               161   1e-44    Erythranthe guttata [common monkey flower]
ref|XP_006356806.1|  PREDICTED: uncharacterized protein LOC102599523    167   2e-44    Solanum tuberosum [potatoes]
ref|XP_010458326.1|  PREDICTED: uncharacterized protein LOC104739...    167   2e-44    Camelina sativa [gold-of-pleasure]
ref|XP_004238051.1|  PREDICTED: uncharacterized protein LOC101246921    166   2e-44    Solanum lycopersicum
dbj|BAF00981.1|  hypothetical protein                                   166   3e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266771.1|  PREDICTED: uncharacterized protein LOC104604209    166   3e-44    Nelumbo nucifera [Indian lotus]
gb|KJB58716.1|  hypothetical protein B456_009G224000                    166   4e-44    Gossypium raimondii
gb|KFK43302.1|  hypothetical protein AALP_AA1G106600                    166   7e-44    Arabis alpina [alpine rockcress]
ref|XP_009407691.1|  PREDICTED: uncharacterized protein LOC103990325    165   7e-44    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003526511.1|  PREDICTED: uncharacterized protein LOC100805268    165   9e-44    Glycine max [soybeans]
ref|XP_009148322.1|  PREDICTED: uncharacterized protein LOC103871783    165   9e-44    Brassica rapa
ref|XP_004969897.1|  PREDICTED: uncharacterized protein LOC101784603    164   2e-43    Setaria italica
emb|CDY20666.1|  BnaC08g13920D                                          163   3e-43    Brassica napus [oilseed rape]
emb|CDY31054.1|  BnaA08g26040D                                          163   4e-43    Brassica napus [oilseed rape]
ref|XP_009144481.1|  PREDICTED: uncharacterized protein LOC103868126    163   4e-43    Brassica rapa
ref|XP_007137270.1|  hypothetical protein PHAVU_009G113400g             162   6e-43    Phaseolus vulgaris [French bean]
ref|XP_009399078.1|  PREDICTED: uncharacterized protein LOC103983571    163   7e-43    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011088149.1|  PREDICTED: uncharacterized protein LOC105169457    162   7e-43    Sesamum indicum [beniseed]
ref|XP_003522725.1|  PREDICTED: uncharacterized protein LOC100775...    162   8e-43    Glycine max [soybeans]
ref|XP_008372951.1|  PREDICTED: uncharacterized protein LOC103436305    163   9e-43    
ref|XP_010692653.1|  PREDICTED: uncharacterized protein LOC104905738    162   1e-42    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009759768.1|  PREDICTED: uncharacterized protein LOC104212246    161   2e-42    Nicotiana sylvestris
ref|XP_011074314.1|  PREDICTED: uncharacterized protein LOC105159071    161   2e-42    Sesamum indicum [beniseed]
gb|EYU37533.1|  hypothetical protein MIMGU_mgv1a018154mg                160   3e-42    Erythranthe guttata [common monkey flower]
emb|CDX95423.1|  BnaC01g33150D                                          160   4e-42    
emb|CBI25109.3|  unnamed protein product                                160   4e-42    Vitis vinifera
ref|XP_002274843.1|  PREDICTED: uncharacterized protein LOC100254836    160   4e-42    Vitis vinifera
ref|XP_003603662.1|  hypothetical protein MTR_3g110630                  160   6e-42    Medicago truncatula
ref|XP_003630690.1|  hypothetical protein MTR_8g102270                  154   6e-42    
ref|XP_008801663.1|  PREDICTED: uncharacterized protein LOC103715709    159   8e-42    Phoenix dactylifera
ref|XP_009595727.1|  PREDICTED: uncharacterized protein LOC104091979    159   1e-41    Nicotiana tomentosiformis
ref|XP_010943312.1|  PREDICTED: uncharacterized protein LOC105061065    159   1e-41    Elaeis guineensis
ref|XP_010941977.1|  PREDICTED: uncharacterized protein LOC105060083    159   1e-41    Elaeis guineensis
ref|XP_007201076.1|  hypothetical protein PRUPE_ppa006838mg             158   1e-41    
gb|EYU34216.1|  hypothetical protein MIMGU_mgv1a006107mg                159   1e-41    Erythranthe guttata [common monkey flower]
ref|XP_003573437.1|  PREDICTED: uncharacterized protein LOC100828811    159   2e-41    Brachypodium distachyon [annual false brome]
ref|XP_006355293.1|  PREDICTED: uncharacterized protein LOC102593921    158   2e-41    Solanum tuberosum [potatoes]
gb|AFK43684.1|  unknown                                                 157   3e-41    Medicago truncatula
ref|XP_003610647.1|  hypothetical protein MTR_5g005420                  157   3e-41    Medicago truncatula
ref|XP_004230673.1|  PREDICTED: uncharacterized protein LOC101258701    158   3e-41    Solanum lycopersicum
ref|XP_011078480.1|  PREDICTED: uncharacterized protein LOC105162206    158   3e-41    Sesamum indicum [beniseed]
gb|EYU36412.1|  hypothetical protein MIMGU_mgv1a006276mg                157   6e-41    Erythranthe guttata [common monkey flower]
emb|CDO97321.1|  unnamed protein product                                157   7e-41    Coffea canephora [robusta coffee]
emb|CDP00983.1|  unnamed protein product                                157   9e-41    Coffea canephora [robusta coffee]
ref|XP_002456333.1|  hypothetical protein SORBIDRAFT_03g034120          157   9e-41    Sorghum bicolor [broomcorn]
ref|XP_009801206.1|  PREDICTED: uncharacterized protein LOC104246980    156   2e-40    Nicotiana sylvestris
emb|CDY24620.1|  BnaC05g33040D                                          156   2e-40    Brassica napus [oilseed rape]
ref|XP_008776853.1|  PREDICTED: uncharacterized protein LOC103696910    156   2e-40    Phoenix dactylifera
emb|CDY51694.1|  BnaA05g36810D                                          155   2e-40    Brassica napus [oilseed rape]
ref|XP_004292055.1|  PREDICTED: uncharacterized protein LOC101308741    155   3e-40    Fragaria vesca subsp. vesca
gb|EAZ28736.1|  hypothetical protein OsJ_12756                          155   5e-40    Oryza sativa Japonica Group [Japonica rice]
gb|AAP68894.1|  unknown protein                                         154   7e-40    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003557619.1|  PREDICTED: uncharacterized protein LOC100825031    154   7e-40    Brachypodium distachyon [annual false brome]
gb|EAY92004.1|  hypothetical protein OsI_13693                          154   7e-40    Oryza sativa Indica Group [Indian rice]
ref|XP_004150270.1|  PREDICTED: uncharacterized protein LOC101221491    154   9e-40    
gb|KGN52731.1|  hypothetical protein Csa_4G000030                       154   1e-39    
ref|XP_004156872.1|  PREDICTED: uncharacterized LOC101221491            154   1e-39    
gb|KCW56839.1|  hypothetical protein EUGRSUZ_I02507                     153   1e-39    Eucalyptus grandis [rose gum]
dbj|BAJ89116.1|  predicted protein                                      151   1e-39    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001058837.1|  Os07g0133500                                       154   1e-39    
ref|XP_009111603.1|  PREDICTED: uncharacterized protein LOC103837023    154   2e-39    Brassica rapa
ref|NP_001051414.1|  Os03g0773000                                       153   2e-39    
ref|XP_007157186.1|  hypothetical protein PHAVU_002G049700g             153   2e-39    Phaseolus vulgaris [French bean]
ref|XP_010327488.1|  PREDICTED: uncharacterized protein LOC101263856    150   2e-39    
ref|XP_009408582.1|  PREDICTED: uncharacterized protein LOC103990981    153   2e-39    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001143291.1|  hypothetical protein                               153   2e-39    Zea mays [maize]
gb|EAZ02678.1|  hypothetical protein OsI_24791                          153   3e-39    Oryza sativa Indica Group [Indian rice]
dbj|BAJ89011.1|  predicted protein                                      152   4e-39    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010030891.1|  PREDICTED: uncharacterized protein LOC104420809    152   5e-39    Eucalyptus grandis [rose gum]
ref|XP_009610822.1|  PREDICTED: uncharacterized protein LOC104104441    152   5e-39    Nicotiana tomentosiformis
ref|XP_008671026.1|  PREDICTED: uncharacterized protein LOC103648311    152   5e-39    Zea mays [maize]
ref|XP_006406471.1|  hypothetical protein EUTSA_v10020590mg             152   5e-39    Eutrema salsugineum [saltwater cress]
ref|XP_008454429.1|  PREDICTED: uncharacterized protein LOC103494838    152   5e-39    Cucumis melo [Oriental melon]
ref|XP_004955420.1|  PREDICTED: uncharacterized protein LOC101777215    152   7e-39    Setaria italica
ref|XP_011092476.1|  PREDICTED: uncharacterized protein LOC105172657    151   8e-39    Sesamum indicum [beniseed]
gb|KFK39297.1|  hypothetical protein AALP_AA3G226300                    152   8e-39    Arabis alpina [alpine rockcress]
ref|XP_004981601.1|  PREDICTED: uncharacterized protein LOC101765126    151   1e-38    Setaria italica
ref|XP_009145758.1|  PREDICTED: uncharacterized protein LOC103869426    151   1e-38    
ref|XP_006646307.1|  PREDICTED: uncharacterized protein LOC102706623    149   1e-38    
ref|XP_007041415.1|  Gb:AAC34331.1                                      150   2e-38    
ref|XP_010691530.1|  PREDICTED: uncharacterized protein LOC104904833    150   2e-38    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010095633.1|  hypothetical protein L484_003734                   150   2e-38    Morus notabilis
ref|XP_003558723.1|  PREDICTED: uncharacterized protein LOC100826176    150   2e-38    Brachypodium distachyon [annual false brome]
gb|ACF82838.1|  unknown                                                 150   3e-38    Zea mays [maize]
ref|XP_006297520.1|  hypothetical protein CARUB_v10013544mg             150   3e-38    Capsella rubella
ref|XP_004511326.1|  PREDICTED: uncharacterized protein LOC101500065    149   4e-38    Cicer arietinum [garbanzo]
gb|AAL60032.1|  unknown protein                                         150   4e-38    Arabidopsis thaliana [mouse-ear cress]
ref|NP_188602.1|  uncharacterized protein                               150   4e-38    Arabidopsis thaliana [mouse-ear cress]
gb|EAY75765.1|  hypothetical protein OsI_03678                          149   5e-38    Oryza sativa Indica Group [Indian rice]
ref|NP_001141500.1|  uncharacterized protein LOC100273612               149   5e-38    Zea mays [maize]
ref|NP_001044201.1|  Os01g0740400                                       146   5e-38    
tpg|DAA51652.1|  TPA: hypothetical protein ZEAMMB73_809833              149   6e-38    
ref|XP_010487913.1|  PREDICTED: uncharacterized protein LOC104765839    149   7e-38    Camelina sativa [gold-of-pleasure]
gb|ACG44256.1|  hypothetical protein                                    148   9e-38    Zea mays [maize]
ref|XP_010466129.1|  PREDICTED: uncharacterized protein LOC104746366    149   9e-38    Camelina sativa [gold-of-pleasure]
ref|XP_002970044.1|  hypothetical protein SELMODRAFT_440968             149   1e-37    Selaginella moellendorffii
emb|CDY42200.1|  BnaA01g25950D                                          143   1e-37    Brassica napus [oilseed rape]
gb|EPS68322.1|  hypothetical protein M569_06448                         148   1e-37    Genlisea aurea
ref|XP_002463817.1|  hypothetical protein SORBIDRAFT_01g006730          148   1e-37    Sorghum bicolor [broomcorn]
gb|KHG13181.1|  hypothetical protein F383_01774                         148   1e-37    Gossypium arboreum [tree cotton]
ref|XP_009605701.1|  PREDICTED: uncharacterized protein LOC104100222    147   2e-37    Nicotiana tomentosiformis
ref|XP_002883199.1|  hypothetical protein ARALYDRAFT_479485             148   2e-37    
gb|AET05166.2|  DUF1005 family protein                                  146   2e-37    
ref|XP_006393185.1|  hypothetical protein EUTSA_v10011462mg             147   3e-37    
ref|XP_006486865.1|  PREDICTED: uncharacterized protein LOC102617316    147   3e-37    
ref|XP_009761264.1|  PREDICTED: uncharacterized protein LOC104213456    147   3e-37    
gb|KDO49502.1|  hypothetical protein CISIN_1g012226mg                   147   5e-37    
ref|XP_010557540.1|  PREDICTED: uncharacterized protein LOC104826503    147   6e-37    
ref|XP_006422727.1|  hypothetical protein CICLE_v10028366mg             146   6e-37    
ref|XP_009381291.1|  PREDICTED: uncharacterized protein LOC103969480    146   7e-37    
tpg|DAA51653.1|  TPA: hypothetical protein ZEAMMB73_809833              148   8e-37    
gb|KJB32814.1|  hypothetical protein B456_005G263000                    146   8e-37    
ref|XP_006307458.1|  hypothetical protein CARUB_v10009084mg             146   1e-36    
ref|NP_001183106.1|  uncharacterized protein LOC100501471               141   1e-36    
ref|XP_002298796.1|  hypothetical protein POPTR_0001s29590g             145   2e-36    
ref|XP_002522078.1|  conserved hypothetical protein                     145   2e-36    
ref|XP_002461423.1|  hypothetical protein SORBIDRAFT_02g002380          144   3e-36    
ref|XP_011030280.1|  PREDICTED: uncharacterized protein LOC105129770    144   4e-36    
ref|XP_010478443.1|  PREDICTED: uncharacterized protein LOC104757404    144   7e-36    
ref|XP_010541837.1|  PREDICTED: uncharacterized protein LOC104815217    143   1e-35    
emb|CAN70307.1|  hypothetical protein VITISV_026399                     141   2e-35    
gb|KJB16127.1|  hypothetical protein B456_002G213400                    142   2e-35    
gb|KHG07926.1|  hypothetical protein F383_34968                         142   2e-35    
ref|XP_008236238.1|  PREDICTED: uncharacterized protein LOC103335027    141   3e-35    
gb|KDP37617.1|  hypothetical protein JCGZ_06960                         141   3e-35    
ref|XP_011002550.1|  PREDICTED: uncharacterized protein LOC105109515    141   3e-35    
ref|XP_002313199.1|  hypothetical protein POPTR_0009s08730g             141   4e-35    
tpg|DAA59484.1|  TPA: hypothetical protein ZEAMMB73_809167              140   7e-35    
emb|CBI27979.3|  unnamed protein product                                139   1e-34    
ref|XP_010461856.1|  PREDICTED: uncharacterized protein LOC104742540    138   5e-34    
ref|XP_002891552.1|  predicted protein                                  137   8e-34    
ref|XP_002985234.1|  hypothetical protein SELMODRAFT_234693             137   9e-34    
ref|XP_010500559.1|  PREDICTED: uncharacterized protein LOC104777930    137   1e-33    
ref|NP_175426.1|  uncharacterized protein                               136   3e-33    
gb|EPS64751.1|  hypothetical protein M569_10025                         135   7e-33    
gb|AFW87787.1|  hypothetical protein ZEAMMB73_393258                    135   7e-33    
emb|CDY40836.1|  BnaC01g31200D                                          134   8e-33    
emb|CDY28137.1|  BnaC06g03180D                                          133   2e-32    
emb|CDY35490.1|  BnaA01g24220D                                          133   3e-32    
ref|XP_009108354.1|  PREDICTED: uncharacterized protein LOC103834048    133   3e-32    
ref|XP_010420061.1|  PREDICTED: uncharacterized protein DDB_G0271...    123   9e-29    
gb|EMT00514.1|  hypothetical protein F775_52390                         118   3e-28    
gb|AAM62635.1|  unknown                                                 116   2e-27    
ref|XP_009792899.1|  PREDICTED: uncharacterized protein LOC104239868    119   2e-27    
gb|AFK46956.1|  unknown                                                 114   3e-27    
emb|CBI19337.3|  unnamed protein product                                119   3e-27    
dbj|BAJ85980.1|  predicted protein                                      116   2e-26    
emb|CDY48608.1|  BnaA01g07570D                                          103   3e-23    
ref|NP_001145181.1|  uncharacterized protein LOC100278423               102   3e-23    
gb|KJB44388.1|  hypothetical protein B456_007G249900                    106   4e-23    
ref|XP_006658256.1|  PREDICTED: uncharacterized protein LOC102703230    101   2e-21    
ref|XP_006853723.1|  hypothetical protein AMTR_s00056p00161630        98.6    1e-20    
emb|CDX82283.1|  BnaA03g35380D                                        96.7    3e-20    
gb|EMT05408.1|  hypothetical protein F775_19846                       95.1    7e-20    
gb|KJB58717.1|  hypothetical protein B456_009G224000                  94.7    6e-19    
gb|EAZ13484.1|  hypothetical protein OsJ_03399                        79.0    2e-14    
gb|ACF84078.1|  unknown                                               80.9    2e-14    
ref|XP_010327489.1|  PREDICTED: uncharacterized protein LOC101265079  79.0    3e-14    
ref|XP_006659865.1|  PREDICTED: uncharacterized protein LOC102704909  68.6    5e-10    
emb|CBI40002.3|  unnamed protein product                              62.4    6e-09    
ref|XP_006651858.1|  PREDICTED: uncharacterized protein LOC102704326  59.7    9e-08    
gb|KJB44389.1|  hypothetical protein B456_007G249900                  61.2    1e-07    
gb|KJB44387.1|  hypothetical protein B456_007G249900                  60.1    3e-07    
ref|NP_001143250.1|  uncharacterized protein LOC100275778             52.8    3e-05    
gb|KHN44505.1|  hypothetical protein glysoja_035737                   48.9    3e-04    
gb|KHN30446.1|  hypothetical protein glysoja_033184                   51.2    4e-04    



>ref|XP_009786623.1| PREDICTED: uncharacterized protein LOC104234713 [Nicotiana sylvestris]
 ref|XP_009786625.1| PREDICTED: uncharacterized protein LOC104234713 [Nicotiana sylvestris]
 ref|XP_009786626.1| PREDICTED: uncharacterized protein LOC104234713 [Nicotiana sylvestris]
Length=432

 Score =   366 bits (940),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 211/242 (87%), Positives = 224/242 (93%), Gaps = 1/242 (0%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             IKQPIFSC+FSQDRV  VDPL+NF SS  D S++E+E+RERKGWKVKIHDLSGSAVAAA
Sbjct  191  TIKQPIFSCEFSQDRVSPVDPLNNFWSSSFDGSELEVEKRERKGWKVKIHDLSGSAVAAA  250

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLIVRPD C  ESWQPWGKLEAWRERGIRDSICCRFHL
Sbjct  251  FITTPFVPSTGCDWVAKSNPGAWLIVRPDICRPESWQPWGKLEAWRERGIRDSICCRFHL  310

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+G E GGDLLMSEILISAEKGGEFYIDTD+QV+AAASP+PSPRSSGDF+ALSPV GGF
Sbjct  311  LSEGQECGGDLLMSEILISAEKGGEFYIDTDRQVQAAASPLPSPRSSGDFAALSPVAGGF  370

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMSCRVQGEGK SK LVQLAMRH+TCVEDAAIFMALAAAVDLSIEACRPFRR LRR TRH
Sbjct  371  VMSCRVQGEGKCSKPLVQLAMRHITCVEDAAIFMALAAAVDLSIEACRPFRRKLRRSTRH  430

Query  94   SW  89
            SW
Sbjct  431  SW  432



>ref|XP_009761711.1| PREDICTED: uncharacterized protein LOC104213860 [Nicotiana sylvestris]
Length=428

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 204/242 (84%), Positives = 215/242 (89%), Gaps = 2/242 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             IKQPIFSCKFSQDRV   DPLS+F SS  DSS+++I++RERKGWKVKIHDLSGSAVAAA
Sbjct  188  TIKQPIFSCKFSQDRVSPRDPLSHFWSSSSDSSELDIDKRERKGWKVKIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPGAWLIVR D C  ESWQPWGKLEAWRERGIRDSICCRFHL
Sbjct  248  FITTPFVPSTGCDWVARSNPGAWLIVRSDVCRPESWQPWGKLEAWRERGIRDSICCRFHL  307

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  E   DLLMSEILISAEKGGEFYIDTD+QVRAA+SP+ SPR SGDF+ALSPV GGF
Sbjct  308  LSEEQE-YADLLMSEILISAEKGGEFYIDTDRQVRAASSPLHSPRGSGDFTALSPVAGGF  366

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMSCRVQGEGK SK LVQLAMRHVTCVED AIFMALAAAVDLSIEACRPFRR LRR   H
Sbjct  367  VMSCRVQGEGKCSKPLVQLAMRHVTCVEDVAIFMALAAAVDLSIEACRPFRRKLRRSASH  426

Query  94   SW  89
            SW
Sbjct  427  SW  428



>ref|XP_009627129.1| PREDICTED: uncharacterized protein LOC104117749 [Nicotiana tomentosiformis]
Length=428

 Score =   362 bits (930),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 205/242 (85%), Positives = 214/242 (88%), Gaps = 2/242 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             IKQPIFSCKFSQDRV   DPLSNF SS  DSS++EI++RERKGWKVKIHDLSGSAVAAA
Sbjct  188  TIKQPIFSCKFSQDRVSPRDPLSNFWSSSSDSSELEIDKRERKGWKVKIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPGAWLIVR D C  ESWQPWGKLEAWRERGIRDSICCRFHL
Sbjct  248  FITTPFVPSTGCDWVARSNPGAWLIVRSDVCRPESWQPWGKLEAWRERGIRDSICCRFHL  307

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LSD  E   DLLMSEILISAEKGGEFYIDTD+QVRAA+SP+ SPR SGDF+ALSPV GGF
Sbjct  308  LSDEQE-CADLLMSEILISAEKGGEFYIDTDRQVRAASSPLRSPRGSGDFTALSPVAGGF  366

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMSCRVQGEGK SK +VQLAMRHVTCVED AIFMALAAAVDLSIEAC PFRR LRR   H
Sbjct  367  VMSCRVQGEGKCSKPVVQLAMRHVTCVEDVAIFMALAAAVDLSIEACMPFRRKLRRSASH  426

Query  94   SW  89
            SW
Sbjct  427  SW  428



>ref|XP_009619401.1| PREDICTED: uncharacterized protein LOC104111412 [Nicotiana tomentosiformis]
Length=431

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 209/242 (86%), Positives = 222/242 (92%), Gaps = 1/242 (0%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             IKQPIFSC+FSQDRV  VDPL+NF SS  D S++E+E+RERKGWKVKIHDLSGSAVAAA
Sbjct  190  TIKQPIFSCEFSQDRVSPVDPLNNFWSSSFDGSELEVEKRERKGWKVKIHDLSGSAVAAA  249

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLIVRPD C  ESWQPWGKLEAWRERGIRDSI CRFHL
Sbjct  250  FITTPFVPSTGCDWVAKSNPGAWLIVRPDICRPESWQPWGKLEAWRERGIRDSIYCRFHL  309

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+G E GGDLLMSEILISAEKGGEFYIDTD+QV+AA SP+PSPRSSGDF+ALSPV GGF
Sbjct  310  LSEGQECGGDLLMSEILISAEKGGEFYIDTDRQVQAAVSPLPSPRSSGDFAALSPVAGGF  369

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMSCRVQGEGK SK LVQLAMRH+TCVEDAAIFMALAAAVDLSIEACRPFRR LRR TRH
Sbjct  370  VMSCRVQGEGKCSKPLVQLAMRHITCVEDAAIFMALAAAVDLSIEACRPFRRKLRRSTRH  429

Query  94   SW  89
            SW
Sbjct  430  SW  431



>ref|XP_007029857.1| Nuclear factor 1 A-type isoform 2 [Theobroma cacao]
 gb|EOY10359.1| Nuclear factor 1 A-type isoform 2 [Theobroma cacao]
Length=429

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 200/241 (83%), Positives = 217/241 (90%), Gaps = 2/241 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKFS+DRV QVDPLS + S   DS DIE ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SIKQPIFSCKFSRDRVAQVDPLSTYWSGSADSLDIETERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPGAWLIVRPD C  ESW PWGKLEAWRERGIRDSICCRFHL
Sbjct  249  FITTPFVPSTGCDWVARSNPGAWLIVRPDICRPESWLPWGKLEAWRERGIRDSICCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  + G ++LMSEILISAEKGGEF+IDTD+Q+R A +P+PSP+SSGDFSALSP+ GGF
Sbjct  309  LSEA-QDGAEVLMSEILISAEKGGEFFIDTDRQMRRAPTPIPSPQSSGDFSALSPIAGGF  367

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRLRRGTRH  95
            VMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC+PF RR+RRG+ H
Sbjct  368  VMSCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACKPFRRRIRRGSGH  427

Query  94   S  92
            S
Sbjct  428  S  428



>ref|XP_003529004.1| PREDICTED: uncharacterized protein LOC100788522 isoform X1 [Glycine 
max]
 ref|XP_006583497.1| PREDICTED: uncharacterized protein LOC100788522 isoform X2 [Glycine 
max]
 ref|XP_006583498.1| PREDICTED: uncharacterized protein LOC100788522 isoform X3 [Glycine 
max]
 gb|KHN34008.1| hypothetical protein glysoja_033455 [Glycine soja]
Length=431

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 208/244 (85%), Gaps = 6/244 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKFS+DRV Q+DPLS + S   D SD+E ERRERKGWKV IHDLSGSAVAAA
Sbjct  189  SIKQPIFSCKFSKDRVSQIDPLSAYWSGSNDISDLETERRERKGWKVTIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPS+GCDWV RSNPG+WLIVRPD    ESWQPWGKLEAWRERGIRD++CCRFHL
Sbjct  249  FITTPFVPSSGCDWVARSNPGSWLIVRPDLGRSESWQPWGKLEAWRERGIRDTVCCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---sprsSGDFSALSPVV  281
            LS+    GG+ LMSEI ISAEKGGEF+IDT+K ++  A+      SP+SSGDF ALSP+V
Sbjct  309  LSEAQ--GGEFLMSEIHISAEKGGEFFIDTEKHMQTVATAASPIPSPQSSGDFGALSPLV  366

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRG  104
            GGFVMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAA+VDLSI AC+PFRR +RRG
Sbjct  367  GGFVMSCRVQGEGKRSKPLVQLAMRHVTCVEDAAIFMALAASVDLSIVACKPFRRKVRRG  426

Query  103  TRHS  92
              HS
Sbjct  427  FWHS  430



>ref|XP_002319218.1| hypothetical protein POPTR_0013s06840g [Populus trichocarpa]
 gb|EEE95141.1| hypothetical protein POPTR_0013s06840g [Populus trichocarpa]
Length=428

 Score =   347 bits (889),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 221/241 (92%), Gaps = 3/241 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKFS+DRV QVDPLS + S+  D +D+E ER+ERKGWKVKIHDLSGSAVAA 
Sbjct  189  SIKQPIFSCKFSRDRVTQVDPLSTYWSTSDDGADVETERKERKGWKVKIHDLSGSAVAAT  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVP+TGCDWV RSNPGAWLIVRPD C  +SWQPWGKLEAWRERGIRDSICCRFHL
Sbjct  249  FITTPFVPATGCDWVARSNPGAWLIVRPDACRPDSWQPWGKLEAWRERGIRDSICCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+G E GG++LMSEILISAEKGGEF+IDTD+Q+R AA+P+PSP+SSGDFS LSP+V GF
Sbjct  309  LSEGQE-GGEVLMSEILISAEKGGEFFIDTDRQLRTAAAPIPSPQSSGDFSGLSPIV-GF  366

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            +MSCRVQGEGK++K LVQLAMRHVTCVEDAAIFMALAAAVDLSI ACRPFRR LR+G+RH
Sbjct  367  IMSCRVQGEGKHNKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIVACRPFRRKLRKGSRH  426

Query  94   S  92
            S
Sbjct  427  S  427



>ref|XP_011086622.1| PREDICTED: uncharacterized protein LOC105168293 [Sesamum indicum]
Length=429

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 200/242 (83%), Positives = 218/242 (90%), Gaps = 2/242 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             +KQPIFSCKFS+DRV QVDPLS+F SS  D S  +IERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  TVKQPIFSCKFSRDRVSQVDPLSSFWSSSGDGSYQDIERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPS+GCDWV +SNPGAWLIVRPD C  ESWQPWGKLE WRERGIRDSIC RFH+
Sbjct  249  FITTPFVPSSGCDWVAKSNPGAWLIVRPDACRPESWQPWGKLEVWRERGIRDSICFRFHV  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
             SDG E GG+ LMSE+LI+AEKGGEF+IDTD+Q+R AA+PVPSP+SSGDF+ALSPV GGF
Sbjct  309  FSDGQE-GGEFLMSELLINAEKGGEFFIDTDRQIRGAATPVPSPQSSGDFAALSPVTGGF  367

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR +R G+RH
Sbjct  368  VMSCRVQGEGKCSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRKMRIGSRH  427

Query  94   SW  89
            SW
Sbjct  428  SW  429



>ref|XP_002268337.1| PREDICTED: uncharacterized protein LOC100245378 [Vitis vinifera]
Length=430

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 200/242 (83%), Positives = 216/242 (89%), Gaps = 3/242 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             IKQPIFSCKFS+DRV QVDPLS + S   DSS+ E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  TIKQPIFSCKFSRDRVSQVDPLSTYWSGSADSSEQETERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPGAWLIVRPD C  ESWQPWGKLEAWRERGIRDSICCRFHL
Sbjct  249  FITTPFVPSTGCDWVARSNPGAWLIVRPDACRPESWQPWGKLEAWRERGIRDSICCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQv-raaaspvpsprsSGDFSALSPVVGG  275
            LS+G + GG+LLMSEI I+AEKGGEF+IDTD+QV  AA +P+PSP+SSGDF+AL+P VGG
Sbjct  309  LSEG-QDGGELLMSEIFINAEKGGEFFIDTDRQVRAAATTPIPSPQSSGDFAALAPAVGG  367

Query  274  FVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTR  98
            FVMSCRVQGEGK SK LVQLA+RH+TCVEDAAIFMALAAAVDLSIEACRPFRR  RRG  
Sbjct  368  FVMSCRVQGEGKSSKPLVQLAIRHITCVEDAAIFMALAAAVDLSIEACRPFRRKFRRGNC  427

Query  97   HS  92
            HS
Sbjct  428  HS  429



>gb|KHG10101.1| Mitochondrial inner membrane protease subunit 1 [Gossypium arboreum]
Length=432

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 195/241 (81%), Positives = 216/241 (90%), Gaps = 2/241 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSC+FS+DRV +VDPL  + +   DSSDIE ERRERKGWKVKIHDLSGSAVAAA
Sbjct  192  SIKQPIFSCEFSRDRVAKVDPLGTYWTGSADSSDIETERRERKGWKVKIHDLSGSAVAAA  251

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLIVRPD C  ESW PWGKLEAWRERGIRDSICCRFHL
Sbjct  252  FITTPFVPSTGCDWVAKSNPGAWLIVRPDICRPESWLPWGKLEAWRERGIRDSICCRFHL  311

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  + G ++LMSEILISAEKGGEF+IDTD+Q+R   +P+PSP+SSGDFSALSP+ GGF
Sbjct  312  LSEA-QDGAEVLMSEILISAEKGGEFFIDTDRQMRQGPTPIPSPQSSGDFSALSPIAGGF  370

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC+PFRR +R G+RH
Sbjct  371  VMSCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACKPFRRKIRIGSRH  430

Query  94   S  92
            S
Sbjct  431  S  431



>emb|CDP16208.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 203/242 (84%), Positives = 221/242 (91%), Gaps = 2/242 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
              KQ IFSCKF+QDRV Q+DPLSNF S  VDSSD ++ERRERKGWKVKIHDLSGSAVAAA
Sbjct  218  TFKQRIFSCKFNQDRVTQLDPLSNFWSHSVDSSDQDVERRERKGWKVKIHDLSGSAVAAA  277

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPS+GCDWV +SNPGAWLIVRPD C  ESWQPWGKLEAWRERGIRDSICCRFHL
Sbjct  278  FITTPFVPSSGCDWVAKSNPGAWLIVRPDACRPESWQPWGKLEAWRERGIRDSICCRFHL  337

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+G E GG++LMSEILI+AEKGGEF+IDTD+QV+AAA+PVPSP+SSGDF+ALSPV GGF
Sbjct  338  LSEGQE-GGEILMSEILINAEKGGEFFIDTDRQVKAAATPVPSPQSSGDFAALSPVHGGF  396

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMS RVQGEGK  K LVQLAMR+VTCVEDAAIFMALAAAVDLSIEACRPFRR +RRG RH
Sbjct  397  VMSSRVQGEGKRCKPLVQLAMRYVTCVEDAAIFMALAAAVDLSIEACRPFRRKVRRGNRH  456

Query  94   SW  89
            SW
Sbjct  457  SW  458



>gb|KJB44386.1| hypothetical protein B456_007G249900 [Gossypium raimondii]
Length=432

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 194/241 (80%), Positives = 216/241 (90%), Gaps = 2/241 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSC+FS+DRV +VDPL  + +   DSSDIE ERRERKGWKVKIHDLSGSAVAAA
Sbjct  192  SIKQPIFSCEFSRDRVAKVDPLGTYWTGSADSSDIETERRERKGWKVKIHDLSGSAVAAA  251

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLIVRPD C  ESW PWGKLEAWRERGIRDSICCRFHL
Sbjct  252  FITTPFVPSTGCDWVAKSNPGAWLIVRPDICRPESWLPWGKLEAWRERGIRDSICCRFHL  311

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  + G ++LMSE+LISAEKGGEF+IDTD+Q+R   +P+PSP+SSGDFSALSP+ GGF
Sbjct  312  LSEA-QDGAEVLMSEMLISAEKGGEFFIDTDRQMRQGPTPIPSPQSSGDFSALSPIAGGF  370

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC+PFRR +R G+RH
Sbjct  371  VMSCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACKPFRRKIRIGSRH  430

Query  94   S  92
            S
Sbjct  431  S  431



>emb|CAN65847.1| hypothetical protein VITISV_014976 [Vitis vinifera]
Length=430

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 196/233 (84%), Positives = 212/233 (91%), Gaps = 2/233 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             IKQPIFSCKFS+DRV QVDPLS + S   DSS+ E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  TIKQPIFSCKFSRDRVSQVDPLSTYWSGSADSSEQETERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPGAWLIVRPD C  ESWQPWGKLEAWRERGIRDSICCRFHL
Sbjct  249  FITTPFVPSTGCDWVARSNPGAWLIVRPDACRPESWQPWGKLEAWRERGIRDSICCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVVGG  275
            LS+G + GG+LLMSEI I+AEKGGEF+IDTD+QVRAAA+  +PSP+SSGDF+AL+P VGG
Sbjct  309  LSEG-QDGGELLMSEIFINAEKGGEFFIDTDRQVRAAATTPIPSPQSSGDFAALAPAVGG  367

Query  274  FVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR  116
            FVMSCRVQGEGK SK LVQLA+RH+TCVEDAAIFMALAAAVDLSIEACRPFRR
Sbjct  368  FVMSCRVQGEGKSSKPLVQLAIRHITCVEDAAIFMALAAAVDLSIEACRPFRR  420



>ref|XP_008460086.1| PREDICTED: uncharacterized protein LOC103499002 [Cucumis melo]
 ref|XP_008460087.1| PREDICTED: uncharacterized protein LOC103499002 [Cucumis melo]
Length=428

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 217/241 (90%), Gaps = 2/241 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKFS+DRV Q D LSN+ S   D SD+E+ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SIKQPIFSCKFSRDRVSQADSLSNYWSGLGDGSDLEVERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPG+WLIVRPD C+ ESWQPWGKLEAWRERGIRD++CCRFHL
Sbjct  249  FITTPFVPSTGCDWVARSNPGSWLIVRPDVCIPESWQPWGKLEAWRERGIRDTVCCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  E GG+LLMSEI I+AEKGGEF+IDTDKQ+RAA SP+PSP+SSGDF+AL  VVGGF
Sbjct  309  LSEAQE-GGELLMSEIHINAEKGGEFFIDTDKQLRAATSPIPSPQSSGDFAALGQVVGGF  367

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMSCRVQGEG+ SK  VQLAMRHVTC+EDAAIFMALAAAVDLSIEACRPFRR +RR  RH
Sbjct  368  VMSCRVQGEGRSSKPTVQLAMRHVTCIEDAAIFMALAAAVDLSIEACRPFRRKIRRTPRH  427

Query  94   S  92
            S
Sbjct  428  S  428



>ref|XP_004145014.1| PREDICTED: uncharacterized protein LOC101209874 [Cucumis sativus]
 ref|XP_004153015.1| PREDICTED: uncharacterized protein LOC101204096 [Cucumis sativus]
 ref|XP_004160679.1| PREDICTED: uncharacterized protein LOC101224857 [Cucumis sativus]
 gb|KGN46265.1| hypothetical protein Csa_6G078600 [Cucumis sativus]
Length=428

 Score =   339 bits (870),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 217/241 (90%), Gaps = 2/241 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKFS+DRV Q D LSN+ S   D SD+E+ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SIKQPIFSCKFSRDRVSQADSLSNYWSGLGDGSDLEVERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPG+WLIVRPD C+ ESWQPWGKLEAWRERGIRD++CCRFHL
Sbjct  249  FITTPFVPSTGCDWVARSNPGSWLIVRPDVCIPESWQPWGKLEAWRERGIRDTVCCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  E GG+LLMSEI I+AEKGGEF+IDTDKQ+RAA SP+PSP+SSGDF+AL  VVGGF
Sbjct  309  LSEAQE-GGELLMSEIHINAEKGGEFFIDTDKQLRAATSPIPSPQSSGDFAALGQVVGGF  367

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMSCRVQGEG+ SK  VQLAMRHVTC+EDAAIFMALAAAVDLSIEACRPFRR +RR  RH
Sbjct  368  VMSCRVQGEGRSSKPTVQLAMRHVTCIEDAAIFMALAAAVDLSIEACRPFRRKIRRTPRH  427

Query  94   S  92
            S
Sbjct  428  S  428



>ref|XP_004229535.1| PREDICTED: uncharacterized protein LOC101261157 [Solanum lycopersicum]
 ref|XP_010323393.1| PREDICTED: uncharacterized protein LOC101261157 [Solanum lycopersicum]
 ref|XP_010323395.1| PREDICTED: uncharacterized protein LOC101261157 [Solanum lycopersicum]
Length=430

 Score =   339 bits (870),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 198/227 (87%), Positives = 209/227 (92%), Gaps = 0/227 (0%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            NIKQPIFSCKFSQDRV  VDPL+NF S+ VD S+++IE+RERKGWKVKIHDLSGSAVAAA
Sbjct  189  NIKQPIFSCKFSQDRVSPVDPLNNFWSNSVDGSELDIEKRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLIV PD C    WQPWGKLEAWRERGIRD+ICCRFHL
Sbjct  249  FITTPFVPSTGCDWVAKSNPGAWLIVHPDVCRPGCWQPWGKLEAWRERGIRDTICCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+G E GGDLLMSEILISAEKGGEFYIDTDKQVRAA SP+PSPRSSGDF+ALSPV GGF
Sbjct  309  LSEGQENGGDLLMSEILISAEKGGEFYIDTDKQVRAATSPLPSPRSSGDFAALSPVAGGF  368

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            VMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC
Sbjct  369  VMSCRVQGEGKCSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  415



>ref|XP_006359111.1| PREDICTED: uncharacterized protein LOC102583788 isoform X1 [Solanum 
tuberosum]
 ref|XP_006359112.1| PREDICTED: uncharacterized protein LOC102583788 isoform X2 [Solanum 
tuberosum]
Length=430

 Score =   336 bits (862),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 195/227 (86%), Positives = 209/227 (92%), Gaps = 0/227 (0%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            NIKQPIFSCKFSQDRV  VDPL+NF S+ VD S++++E+RERKGWKVKIHDLSGSAVAAA
Sbjct  189  NIKQPIFSCKFSQDRVSPVDPLNNFWSNSVDGSELDVEKRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLIV PD C    WQPWGKLEAWRERGIRD+ICCRFHL
Sbjct  249  FITTPFVPSTGCDWVAKSNPGAWLIVHPDVCRPGCWQPWGKLEAWRERGIRDTICCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+G E GGDLLMSEILISAEKGGEFYIDTD+QVRAA SP+PSPRSSGDF+ALSPV GGF
Sbjct  309  LSEGQENGGDLLMSEILISAEKGGEFYIDTDRQVRAATSPLPSPRSSGDFAALSPVAGGF  368

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            VMSCRVQG+GK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC
Sbjct  369  VMSCRVQGDGKCSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  415



>ref|XP_007029856.1| Nuclear factor 1 A-type isoform 1 [Theobroma cacao]
 gb|EOY10358.1| Nuclear factor 1 A-type isoform 1 [Theobroma cacao]
Length=491

 Score =   337 bits (865),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 193/230 (84%), Positives = 208/230 (90%), Gaps = 1/230 (0%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKFS+DRV QVDPLS + S   DS DIE ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SIKQPIFSCKFSRDRVAQVDPLSTYWSGSADSLDIETERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPGAWLIVRPD C  ESW PWGKLEAWRERGIRDSICCRFHL
Sbjct  249  FITTPFVPSTGCDWVARSNPGAWLIVRPDICRPESWLPWGKLEAWRERGIRDSICCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  + G ++LMSEILISAEKGGEF+IDTD+Q+R A +P+PSP+SSGDFSALSP+ GGF
Sbjct  309  LSEA-QDGAEVLMSEILISAEKGGEFFIDTDRQMRRAPTPIPSPQSSGDFSALSPIAGGF  367

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF  122
            VMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC+PF
Sbjct  368  VMSCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACKPF  417



>ref|XP_010324887.1| PREDICTED: uncharacterized protein LOC101268299 [Solanum lycopersicum]
Length=419

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 190/227 (84%), Gaps = 5/227 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             IKQPIFSCKFSQDRV   DPLSNF SS  D S++++ +RERKGW VKIHDLSGSAVAAA
Sbjct  183  TIKQPIFSCKFSQDRVSPRDPLSNFWSSSFDGSELDVGKRERKGWNVKIHDLSGSAVAAA  242

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPGAWLIVR D C  ESW PWGKLEAWRERGIRDSICCRFHL
Sbjct  243  FITTPFVPSTGCDWVSRSNPGAWLIVRSDVCRPESWHPWGKLEAWRERGIRDSICCRFHL  302

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            L++G E  GDLLMSEILISAEKGGEFYIDTDKQ         SP  SGDF+ALS   GGF
Sbjct  303  LTEGQE-LGDLLMSEILISAEKGGEFYIDTDKQ----VRAASSPGGSGDFAALSLAAGGF  357

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            VMSCRVQGEGK SK LVQLAMRHVTCVED  IFMALAAAVDLSIEAC
Sbjct  358  VMSCRVQGEGKCSKPLVQLAMRHVTCVEDVGIFMALAAAVDLSIEAC  404



>ref|XP_006346697.1| PREDICTED: uncharacterized protein LOC102596535 [Solanum tuberosum]
Length=429

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/227 (82%), Positives = 198/227 (87%), Gaps = 1/227 (0%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             IKQPIFSCKFSQDRV   DPLSNF SS  D S+++I +RERKGW VKIHDLSGSAVAAA
Sbjct  189  TIKQPIFSCKFSQDRVSPRDPLSNFWSSSFDGSELDIGKRERKGWNVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPGAWLIVR D C  ESW PWGKLEAWRERGIRDSICCRFHL
Sbjct  249  FITTPFVPSTGCDWVARSNPGAWLIVRSDVCRPESWHPWGKLEAWRERGIRDSICCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            L++G E  GDLLMSEILISAEKGGEFYIDTDKQVRAA++P+ SPR SGDF+A+S    GF
Sbjct  309  LTEGHE-LGDLLMSEILISAEKGGEFYIDTDKQVRAASTPMHSPRGSGDFAAVSLAAEGF  367

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            VMSCRVQGEGK SK LVQLAMRHVTCVED  IFMALAAAVDLSIEAC
Sbjct  368  VMSCRVQGEGKCSKPLVQLAMRHVTCVEDVGIFMALAAAVDLSIEAC  414



>emb|CAJ19269.1| putative stress-induced protein [Solanum commersonii]
Length=433

 Score =   331 bits (848),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 194/228 (85%), Positives = 208/228 (91%), Gaps = 1/228 (0%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            NIKQPIFSCKFS DRV  VDPL+NF S+ VD S++++E+RER+GWKVKIHDLSGSAVAAA
Sbjct  191  NIKQPIFSCKFSHDRVSPVDPLNNFWSNSVDGSELDVEKRERRGWKVKIHDLSGSAVAAA  250

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLIV PD C    WQPWGKLEAWRERGIRD+ICCRFHL
Sbjct  251  FITTPFVPSTGCDWVAKSNPGAWLIVHPDVCRPGCWQPWGKLEAWRERGIRDTICCRFHL  310

Query  451  LSDGPEGGGDLLMSEILIS-AEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGG  275
            LS+G E GGDLLMSEILIS AEKGGEFYIDTD+QVRAA SP+PSPRSSGDF+ALSPV GG
Sbjct  311  LSEGQENGGDLLMSEILISAAEKGGEFYIDTDRQVRAATSPLPSPRSSGDFAALSPVAGG  370

Query  274  FVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            FVMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC
Sbjct  371  FVMSCRVQGEGKCSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  418



>ref|XP_010097676.1| hypothetical protein L484_023816 [Morus notabilis]
 gb|EXB70631.1| hypothetical protein L484_023816 [Morus notabilis]
Length=431

 Score =   330 bits (845),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 193/242 (80%), Positives = 216/242 (89%), Gaps = 3/242 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQ IFSCKFS+DRV QVDPL N+ S   D++D+E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  190  SIKQRIFSCKFSRDRVPQVDPLCNYWSGSTDNADLEAERRERKGWKVKIHDLSGSAVAAA  249

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            F+TTPFVPSTGCDWV +SNPGAWLIVRPD C  ESWQPWGKLEAWRERGIRDS+CCRF L
Sbjct  250  FMTTPFVPSTGCDWVAKSNPGAWLIVRPDVCRAESWQPWGKLEAWRERGIRDSVCCRFRL  309

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQv-raaaspvpsprsSGDFSALSPVVGG  275
            +S+G E  G+LLMSEI I+ EKGGEF+IDTD+Q+  AAASP+PSP+SSGDF+AL  VVGG
Sbjct  310  MSEGQE-VGELLMSEIYINTEKGGEFFIDTDRQMPAAAASPIPSPQSSGDFAALGTVVGG  368

Query  274  FVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTR  98
            FVMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR +++G+ 
Sbjct  369  FVMSCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRKMKKGSC  428

Query  97   HS  92
            HS
Sbjct  429  HS  430



>gb|KEH18002.1| stress-induced protein, putative [Medicago truncatula]
Length=433

 Score =   329 bits (844),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 192/245 (78%), Positives = 212/245 (87%), Gaps = 6/245 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKFS+DRV Q+D LS + S   D SD+E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SIKQPIFSCKFSKDRVSQIDSLSTYWSGSPDISDLESERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMR-ESWQPWGKLEAWRERGIRDSICCRFH  455
            FITTPFVPS+GCDWV RSNPGAWLIVRPD   R ESWQPWGKLEAWRERGI+DSICC+FH
Sbjct  249  FITTPFVPSSGCDWVARSNPGAWLIVRPDVVGRSESWQPWGKLEAWRERGIKDSICCKFH  308

Query  454  LLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---sprsSGDFSALSPV  284
            LLS+ P+ GG+LLMSEI I+AEKGGEF+IDT+K +R  AS      SP+SSGDF ALSPV
Sbjct  309  LLSE-PQDGGNLLMSEIHINAEKGGEFFIDTEKHMRTVASAASPIPSPQSSGDFGALSPV  367

Query  283  VGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRR  107
             GGFVMSCRVQGEGK  K LVQLA+RHVTCVEDAAIFMALAAAVDLSIEAC+PFRR +RR
Sbjct  368  AGGFVMSCRVQGEGKRGKPLVQLALRHVTCVEDAAIFMALAAAVDLSIEACKPFRRKIRR  427

Query  106  GTRHS  92
            G R+S
Sbjct  428  GFRNS  432



>ref|XP_010056513.1| PREDICTED: uncharacterized protein LOC104444526 [Eucalyptus grandis]
 ref|XP_010056515.1| PREDICTED: uncharacterized protein LOC104444526 [Eucalyptus grandis]
 ref|XP_010056516.1| PREDICTED: uncharacterized protein LOC104444526 [Eucalyptus grandis]
 gb|KCW73287.1| hypothetical protein EUGRSUZ_E01747 [Eucalyptus grandis]
Length=431

 Score =   329 bits (844),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 194/245 (79%), Positives = 215/245 (88%), Gaps = 6/245 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +I+QPIFSCKFSQDRV QVDPLS + S+   S   E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SIRQPIFSCKFSQDRVTQVDPLSTYWSAIEGSDQ-ETERRERKGWKVKIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPS GCDWV +SNPGAW+IVRPDP   ESWQPWGKLEAWRERG+RDSICCRF L
Sbjct  248  FITTPFVPSNGCDWVAKSNPGAWVIVRPDPYRPESWQPWGKLEAWRERGMRDSICCRFRL  307

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraa-aspvpsprsSGDFSALSPVVGG  275
            LS+G E GG+ L+SEI I+AEKGGEF+IDTD+Q+RA+  +P+PSPRSSGDF  LSPVVGG
Sbjct  308  LSEGQE-GGEFLVSEININAEKGGEFFIDTDRQMRASGPTPIPSPRSSGDFGGLSPVVGG  366

Query  274  FVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGT-  101
            FVMSC+V+GEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR +RR + 
Sbjct  367  FVMSCKVRGEGKNSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRKIRRASQ  426

Query  100  -RHSW  89
             RHSW
Sbjct  427  MRHSW  431



>ref|XP_006437344.1| hypothetical protein CICLE_v10031611mg [Citrus clementina]
 ref|XP_006484748.1| PREDICTED: uncharacterized protein LOC102622177 isoform X1 [Citrus 
sinensis]
 ref|XP_006484749.1| PREDICTED: uncharacterized protein LOC102622177 isoform X2 [Citrus 
sinensis]
 gb|ESR50584.1| hypothetical protein CICLE_v10031611mg [Citrus clementina]
 gb|KDO49406.1| hypothetical protein CISIN_1g014188mg [Citrus sinensis]
Length=429

 Score =   327 bits (838),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 188/227 (83%), Positives = 204/227 (90%), Gaps = 1/227 (0%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKFS+DR  QVD LS++ S  VD + +E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SIKQPIFSCKFSRDRGPQVDLLSSYWSGSVDCNALETERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPGAWLIVRPD C  ESWQPWGKLEAWRERGIRDS+CCRFHL
Sbjct  249  FITTPFVPSTGCDWVARSNPGAWLIVRPDACRAESWQPWGKLEAWRERGIRDSVCCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+G E  G++LMSEILISAEKGGEF+IDTDKQ+R A SP+PSP+SSGDFS L PV+GGF
Sbjct  309  LSEGQE-AGEVLMSEILISAEKGGEFFIDTDKQLRTATSPIPSPQSSGDFSGLGPVIGGF  367

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            VM CRVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSIEAC
Sbjct  368  VMCCRVQGEGKRSKPMVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  414



>gb|ACV88395.1| putative stress-induced protein [Cucumis sativus]
Length=230

 Score =   319 bits (817),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 185/225 (82%), Positives = 204/225 (91%), Gaps = 1/225 (0%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKFS+DRV Q D LSN+ S   D SD+E+ERRERKGWKVKIHDLSGSAVAAA
Sbjct  7    SIKQPIFSCKFSRDRVSQADSLSNYWSGLGDGSDLEVERRERKGWKVKIHDLSGSAVAAA  66

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPG+WLIVRPD C+ ESWQPWGKLEAWRERGIRD++CCRFHL
Sbjct  67   FITTPFVPSTGCDWVARSNPGSWLIVRPDVCIPESWQPWGKLEAWRERGIRDTVCCRFHL  126

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  E GG+LLMSEI I+AEKGGEF+IDTDKQ+RAA SP+PSP+SSGDF+AL  VVGGF
Sbjct  127  LSEAQE-GGELLMSEIHINAEKGGEFFIDTDKQLRAATSPIPSPQSSGDFAALGQVVGGF  185

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
            VMSCRVQGEG+ SK  VQLAMRHVTC+EDAAIFMALAAAVDLSIE
Sbjct  186  VMSCRVQGEGRSSKPTVQLAMRHVTCIEDAAIFMALAAAVDLSIE  230



>ref|XP_007134346.1| hypothetical protein PHAVU_010G039800g [Phaseolus vulgaris]
 gb|ESW06340.1| hypothetical protein PHAVU_010G039800g [Phaseolus vulgaris]
Length=433

 Score =   326 bits (835),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 186/245 (76%), Positives = 210/245 (86%), Gaps = 6/245 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnf-sssfvdssDIEIERRERKGWKVKIHDLSGSAVAA  635
            +IKQPIFSCKFS+DRV Q+DPLS + S S  + S++E ERRERKGWKV IHDLSGSAVAA
Sbjct  189  SIKQPIFSCKFSKDRVSQIDPLSAYWSGSTTEISNLETERRERKGWKVTIHDLSGSAVAA  248

Query  634  AFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFH  455
            AFITTPFVPS+GCDWV RSNPG+WLIVRPD    ESW PWGKLEAWRERGIRD++CC+FH
Sbjct  249  AFITTPFVPSSGCDWVARSNPGSWLIVRPDTGRSESWHPWGKLEAWRERGIRDTVCCKFH  308

Query  454  LLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---sprsSGDFSALSPV  284
            LLS+  E GG+LLMSEI I+AEKGGEF+IDT+K +R A +      SP+SSGDF ALSP+
Sbjct  309  LLSEAQE-GGELLMSEIHINAEKGGEFFIDTEKHLRTATTAASPIPSPQSSGDFGALSPL  367

Query  283  VGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRR  107
            VGGFVMSCR+QGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSI AC+PFRR +RR
Sbjct  368  VGGFVMSCRIQGEGKQSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSILACKPFRRKVRR  427

Query  106  GTRHS  92
            G  HS
Sbjct  428  GFWHS  432



>gb|KJB46076.1| hypothetical protein B456_007G347500 [Gossypium raimondii]
 gb|KJB46077.1| hypothetical protein B456_007G347500 [Gossypium raimondii]
 gb|KJB46079.1| hypothetical protein B456_007G347500 [Gossypium raimondii]
Length=432

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 185/241 (77%), Positives = 209/241 (87%), Gaps = 2/241 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DR  QVD L+ +     D+ DIE  RRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SVKQPIFSCKFSRDRASQVDLLNAYWPGSADNLDIETGRRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLI+RPD    ESW PWGKLEAWRERGIRD++CCRFHL
Sbjct  249  FITTPFVPSTGCDWVAKSNPGAWLILRPDVVRPESWLPWGKLEAWRERGIRDAVCCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  + G ++LMSEI ISAEKGGEF+IDTD+ +R A +P+PSP+SSGDFSALSP+ GGF
Sbjct  309  LSEA-QDGAEVLMSEIRISAEKGGEFFIDTDRLMRQAPTPIPSPQSSGDFSALSPISGGF  367

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMSCRVQGEGK SK LVQLAMRHVTC+EDAAIFMALAAAVDLSIEAC+PFRR  RRG+R 
Sbjct  368  VMSCRVQGEGKNSKPLVQLAMRHVTCIEDAAIFMALAAAVDLSIEACKPFRRKFRRGSRG  427

Query  94   S  92
            S
Sbjct  428  S  428



>ref|XP_003521028.1| PREDICTED: uncharacterized protein LOC100815012 isoform X1 [Glycine 
max]
 ref|XP_006576673.1| PREDICTED: uncharacterized protein LOC100815012 isoform X2 [Glycine 
max]
 gb|KHM98980.1| hypothetical protein glysoja_044010 [Glycine soja]
Length=432

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 188/244 (77%), Positives = 207/244 (85%), Gaps = 5/244 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKFS+DRV Q+D LS + S   D SD+E ERRERKGWKV IHDLSGSAVAAA
Sbjct  189  SIKQPIFSCKFSKDRVSQIDSLSAYWSGSNDISDLETERRERKGWKVTIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPS+GCDWV RSNPG+WLIVRPD    ESWQPWGKLEAWRERGIRD++CCRFHL
Sbjct  249  FITTPFVPSSGCDWVARSNPGSWLIVRPDIGRSESWQPWGKLEAWRERGIRDTVCCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---sprsSGDFSALSPVV  281
            LS+  E GG+ LMSEI ISAEKGGEF+IDT+K +R  A+      SP+SSGDF ALSP+V
Sbjct  309  LSEAQE-GGEFLMSEIHISAEKGGEFFIDTEKHMRTVATAASPIPSPQSSGDFGALSPLV  367

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRG  104
            GGFVMSCRVQGEGK SK  VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+PFRR +RRG
Sbjct  368  GGFVMSCRVQGEGKRSKPSVQLAMRHVTCVEDAAIFMALAAAVDLSIVACKPFRRKVRRG  427

Query  103  TRHS  92
              HS
Sbjct  428  FWHS  431



>gb|KHG03019.1| Wilms tumor [Gossypium arboreum]
Length=432

 Score =   324 bits (830),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 184/241 (76%), Positives = 208/241 (86%), Gaps = 2/241 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DR  QVD L+ +     D+ DIE  RRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SVKQPIFSCKFSRDRASQVDLLNAYWPGSADNLDIETSRRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLI+RPD    ESW PWGKLEAWRERGIRD++CCRFHL
Sbjct  249  FITTPFVPSTGCDWVAKSNPGAWLILRPDVVRPESWLPWGKLEAWRERGIRDAVCCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  + G ++LMSEI ISAEKGGEF+IDTD+ +R A +P+PSP+SSGDFSALSP+ GGF
Sbjct  309  LSEA-QDGAEVLMSEIRISAEKGGEFFIDTDRLMRQAPTPIPSPQSSGDFSALSPISGGF  367

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRGTRH  95
            VMSCRVQGE K SK LVQLAMRHVTC+EDAAIFMALAAAVDLSIEAC+PFRR  RRG+R 
Sbjct  368  VMSCRVQGESKNSKPLVQLAMRHVTCIEDAAIFMALAAAVDLSIEACKPFRRKFRRGSRG  427

Query  94   S  92
            S
Sbjct  428  S  428



>gb|KDP39605.1| hypothetical protein JCGZ_02625 [Jatropha curcas]
Length=428

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 187/227 (82%), Positives = 206/227 (91%), Gaps = 2/227 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +I+QPIFSCKFS+DRV QVDPLSN+ S+ V+  D+E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SIRQPIFSCKFSRDRVSQVDPLSNYWSTAVEGMDLETERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLIVRPD C  ESWQPWGKLEAWRERGIRDSICCRFHL
Sbjct  249  FITTPFVPSTGCDWVAKSNPGAWLIVRPDVCRPESWQPWGKLEAWRERGIRDSICCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  E GG++LMSEI +SAEKGGEF+IDTD+Q+R AA+P+PSP+SSGDFS L P  GGF
Sbjct  309  LSESQE-GGEVLMSEIFMSAEKGGEFFIDTDRQMRTAATPIPSPQSSGDFSGLGP-TGGF  366

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            VMSCRVQGEGK+SK LVQLAMRHVTCVEDAAIFMALAAAVDLSI AC
Sbjct  367  VMSCRVQGEGKHSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIVAC  413



>ref|XP_011004940.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105111323 
[Populus euphratica]
Length=427

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 171/241 (71%), Positives = 203/241 (84%), Gaps = 2/241 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKFS+D++ +VDPLS + S F D +D+E +RRERKGWKVK+HDLS S +A  
Sbjct  187  SIKQPIFSCKFSRDKLTRVDPLSTYWSIFDDGADVETKRRERKGWKVKLHDLSSSTIATT  246

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVP+TGCDWV RSNP AWLIV PD C  + WQPWGKLE WRE GIRDSICCRFHL
Sbjct  247  FITTPFVPATGCDWVARSNPRAWLIVFPDACKPDRWQPWGKLEVWRECGIRDSICCRFHL  306

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+G E GG++LMSEILISAEKG +F+I+TD+Q+R  A+P+PSP+S GDFS L P++GGF
Sbjct  307  LSEGXE-GGEVLMSEILISAEKGTKFFINTDRQLRTTATPIPSPQSRGDFSGLGPIIGGF  365

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRLRRGTRH  95
            VMSCRV+G+G  +K LVQLAM HVT VEDAAIFMALA  VDLSI ACRPF R+LR+ +RH
Sbjct  366  VMSCRVEGKGSXNKPLVQLAMXHVTYVEDAAIFMALAVVVDLSIVACRPFHRKLRKRSRH  425

Query  94   S  92
            S
Sbjct  426  S  426



>ref|XP_004510160.1| PREDICTED: uncharacterized protein LOC101490219 isoform X1 [Cicer 
arietinum]
 ref|XP_004510161.1| PREDICTED: uncharacterized protein LOC101490219 isoform X2 [Cicer 
arietinum]
 ref|XP_004510162.1| PREDICTED: uncharacterized protein LOC101490219 isoform X3 [Cicer 
arietinum]
 ref|XP_004510163.1| PREDICTED: uncharacterized protein LOC101490219 isoform X4 [Cicer 
arietinum]
 ref|XP_004510164.1| PREDICTED: uncharacterized protein LOC101490219 isoform X5 [Cicer 
arietinum]
 ref|XP_004510165.1| PREDICTED: uncharacterized protein LOC101490219 isoform X6 [Cicer 
arietinum]
Length=429

 Score =   322 bits (824),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 211/244 (86%), Gaps = 5/244 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV Q+D LSN+    +D SD+E ++RERKGWKVKIHDLSGSAVAAA
Sbjct  186  SLKQPIFSCKFSKDRVSQIDALSNYWPDSIDISDLECKKRERKGWKVKIHDLSGSAVAAA  245

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPS+G DWV RSNPGAWLIVRPD    ESWQPWGKLEAWRERGI+DS+CCRFHL
Sbjct  246  FITTPFVPSSGYDWVARSNPGAWLIVRPDVGRSESWQPWGKLEAWRERGIKDSVCCRFHL  305

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---sprsSGDFSALSPVV  281
            L +  + GG+LLMSEI I+AEKGGEF+IDT+K +R A S      SP+SSGDF ALSP+V
Sbjct  306  LPEAHD-GGNLLMSEIHINAEKGGEFFIDTEKHMRTATSAASPIPSPQSSGDFGALSPIV  364

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRG  104
            GGFVMSCRVQGEGK SK LVQLA+RHVTCVEDAAIFMALAAAVDLSIEACRPFRR ++RG
Sbjct  365  GGFVMSCRVQGEGKRSKPLVQLALRHVTCVEDAAIFMALAAAVDLSIEACRPFRRKIKRG  424

Query  103  TRHS  92
             R+S
Sbjct  425  FRNS  428



>ref|XP_002523978.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38346.1| conserved hypothetical protein [Ricinus communis]
Length=427

 Score =   321 bits (822),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 185/227 (81%), Positives = 205/227 (90%), Gaps = 2/227 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +I+QPIFSCKFS+DRV QVDPLS + S+  D  D+E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  188  SIRQPIFSCKFSRDRVPQVDPLSIYWSTSADGIDMETERRERKGWKVKIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLIVRPD C  ESWQPWGKLEAWRERGIRDSICCRFHL
Sbjct  248  FITTPFVPSTGCDWVAKSNPGAWLIVRPDMCRPESWQPWGKLEAWRERGIRDSICCRFHL  307

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  E GG++LMSEI ++AEKGGEF+IDTD+Q++AAA+P+PSP+SSGDFS L P  GGF
Sbjct  308  LSESQE-GGEVLMSEIFMNAEKGGEFFIDTDRQMQAAATPIPSPQSSGDFSGLGP-AGGF  365

Query  271  VMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            VMSCRVQGEGK+SK LVQLAMRHVTCVEDAAIFMALAAAVDLSI AC
Sbjct  366  VMSCRVQGEGKHSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIVAC  412



>ref|XP_010266416.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
 ref|XP_010266417.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
 ref|XP_010266418.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
 ref|XP_010266419.1| PREDICTED: uncharacterized protein LOC104603937 [Nelumbo nucifera]
Length=431

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 191/241 (79%), Positives = 212/241 (88%), Gaps = 5/241 (2%)
 Frame = -3

Query  808  IKQPIFSCKFSQDR-VQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +KQPIFSCKFS+DR   Q+DP+SN+ SS  +  D E ERRERKGWKV I+DLSGSAVAAA
Sbjct  190  VKQPIFSCKFSRDRRASQLDPMSNYWSSTRNGMDEEAERRERKGWKVMIYDLSGSAVAAA  249

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GIRDSICCRFH  455
            F+ TPFVPSTGCD V RSNPGAWLIVRPD CM ESWQPWGKLEAWRER GIRDSICCRFH
Sbjct  250  FMATPFVPSTGCDRVARSNPGAWLIVRPDACMPESWQPWGKLEAWRERGGIRDSICCRFH  309

Query  454  LLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGG  275
            LLS+G EGGG LL+SE LISA+KGG F IDTD+Q   +A+PVPSPRSSGDF++L+P+VGG
Sbjct  310  LLSEGQEGGG-LLVSEKLISADKGGVFVIDTDRQ-TPSATPVPSPRSSGDFASLAPIVGG  367

Query  274  FVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRL-RRGTR  98
            FVM+CRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLS+EACRPFRR  +RGTR
Sbjct  368  FVMNCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSVEACRPFRRKSKRGTR  427

Query  97   H  95
            H
Sbjct  428  H  428



>ref|XP_008232195.1| PREDICTED: uncharacterized protein LOC103331357 [Prunus mume]
 ref|XP_008232196.1| PREDICTED: uncharacterized protein LOC103331357 [Prunus mume]
 ref|XP_008232197.1| PREDICTED: uncharacterized protein LOC103331357 [Prunus mume]
 ref|XP_008232198.1| PREDICTED: uncharacterized protein LOC103331357 [Prunus mume]
Length=434

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 185/246 (75%), Positives = 204/246 (83%), Gaps = 7/246 (3%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKF +DRV   DPLS + S   ++ D+E ERRERKGWKV IHDLSGSAVAAA
Sbjct  189  SIKQPIFSCKFIRDRVPHADPLSTYWSGSANNPDLESERRERKGWKVTIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV RSNPGAW+IV PDPC  +SWQPWGKLEAWRERGIRDS+CCRF L
Sbjct  249  FITTPFVPSTGCDWVARSNPGAWMIVSPDPCRPDSWQPWGKLEAWRERGIRDSVCCRFRL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsp-----rsSGDFSALSP  287
            LS+  E   +LL SEI I+AEKGGEF+IDTDKQ+RAAA    +      +SSGDF+ L P
Sbjct  309  LSECQE-AVELLQSEIRINAEKGGEFFIDTDKQMRAAAEAAAASPIPSPQSSGDFAGLGP  367

Query  286  VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LR  110
            VVGGFVMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR  R
Sbjct  368  VVGGFVMSCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRKFR  427

Query  109  RGTRHS  92
            + + HS
Sbjct  428  KPSFHS  433



>ref|XP_007218028.1| hypothetical protein PRUPE_ppa005972mg [Prunus persica]
 gb|EMJ19227.1| hypothetical protein PRUPE_ppa005972mg [Prunus persica]
Length=434

 Score =   319 bits (817),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 184/246 (75%), Positives = 205/246 (83%), Gaps = 7/246 (3%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKF +DRV   DPLS + S   +++D+E ERRERKGWKV IHDLSGSAVAAA
Sbjct  189  SIKQPIFSCKFIRDRVPHADPLSTYWSGSANNTDLESERRERKGWKVTIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAW+IV PDPC  +SWQPWGKLEAWRERGIRDS+CCRF L
Sbjct  249  FITTPFVPSTGCDWVAKSNPGAWMIVSPDPCRPDSWQPWGKLEAWRERGIRDSVCCRFRL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsp-----rsSGDFSALSP  287
            LS+  E   +LL SEI I+AEKGGEF+IDTDKQ+RAAA    +      +SSGDF+ L P
Sbjct  309  LSECQE-AVELLQSEIRINAEKGGEFFIDTDKQMRAAAEAAAASPIPSPQSSGDFAGLGP  367

Query  286  VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LR  110
            VVGGFVMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR  R
Sbjct  368  VVGGFVMSCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRKFR  427

Query  109  RGTRHS  92
            + + HS
Sbjct  428  KPSFHS  433



>ref|XP_010549738.1| PREDICTED: uncharacterized protein LOC104820818 [Tarenaya hassleriana]
Length=436

 Score =   318 bits (816),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 181/248 (73%), Positives = 207/248 (83%), Gaps = 8/248 (3%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSC+FS+DRV   DPLS + SS  D S++E ERRERKGWKVKIHDLSG AVAAA
Sbjct  190  SVKQPIFSCEFSRDRVSHGDPLSGYCSSLGDVSELEAERRERKGWKVKIHDLSGFAVAAA  249

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWL+VRPDPC  +SWQPWGKLEAWRERG++DSICCRFHL
Sbjct  250  FITTPFVPSTGCDWVTKSNPGAWLVVRPDPCRPDSWQPWGKLEAWRERGLQDSICCRFHL  309

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaa-spvpsprsSGDFS--ALSPVV  281
            LS+  +G GD+LMSE+LISAEKGG+F ID D+Q+   A +PVPSP+SSGDFS    S   
Sbjct  310  LSNW-QGDGDVLMSEVLISAEKGGDFVIDMDRQMLTTAGTPVPSPQSSGDFSGLGPSGQG  368

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRLRRGT  101
            GGFVMSCRVQGEGK SK +VQLAMRH+ CVEDAAIFMAL+AAVDLSI AC+PFRR  R  
Sbjct  369  GGFVMSCRVQGEGKSSKPVVQLAMRHIMCVEDAAIFMALSAAVDLSIVACKPFRRTGRSQ  428

Query  100  R----HSW  89
            R    +SW
Sbjct  429  RRFRHYSW  436



>ref|XP_008345095.1| PREDICTED: uncharacterized protein LOC103407996 [Malus domestica]
Length=457

 Score =   317 bits (812),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 184/241 (76%), Positives = 202/241 (84%), Gaps = 7/241 (3%)
 Frame = -3

Query  805  KQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAAFI  626
            KQPIFSCKF +DRV QVDPL+ + S   ++ D+E ERRERKGWKV IHDLSGSAVAAAFI
Sbjct  213  KQPIFSCKFIRDRVPQVDPLNTYWSGAANNPDLETERRERKGWKVTIHDLSGSAVAAAFI  272

Query  625  TTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHLLS  446
            TTPFVP+TGCDWV RSNPGAWLIV PDPC  +SWQPWGKLEAWRERGIRD +CCRF LLS
Sbjct  273  TTPFVPATGCDWVARSNPGAWLIVSPDPCRPDSWQPWGKLEAWRERGIRDXVCCRFRLLS  332

Query  445  DGPEGGGDLLMSEILISAEKGGEFYIDTDKQv------raaaspvpsprsSGDFSALSPV  284
            +  E   DL MSEI I+AEKGGEF+IDTD+Q+       A+ASP+PSP+SSGDF+ L P 
Sbjct  333  ECQE-AVDLFMSEIRINAEKGGEFFIDTDRQMRAVAAAAASASPIPSPQSSGDFAGLYPF  391

Query  283  VGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRLRRG  104
            VGGFVMSCRVQGEGK SK LVQ AMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR  R 
Sbjct  392  VGGFVMSCRVQGEGKASKPLVQJAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRKFRK  451

Query  103  T  101
            T
Sbjct  452  T  452



>ref|XP_006400305.1| hypothetical protein EUTSA_v10013602mg [Eutrema salsugineum]
 gb|ESQ41758.1| hypothetical protein EUTSA_v10013602mg [Eutrema salsugineum]
Length=432

 Score =   316 bits (809),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 202/232 (87%), Gaps = 4/232 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV QVDPL+ + SS  D +++E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  188  SVKQPIFSCKFSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWL+VRPDPC   SWQPWGKLEAWRERGIRDS+CCRFHL
Sbjct  248  FITTPFVPSTGCDWVAKSNPGAWLVVRPDPCRPNSWQPWGKLEAWRERGIRDSVCCRFHL  307

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVV--  281
            LS+G E  GD+LMSEILISAEKGGEF IDTDKQ+   A+  +PSP+SSGD+S L   V  
Sbjct  308  LSNGQE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVAATPIPSPQSSGDYSGLGQCVSG  366

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
            GGFVMS RVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+P
Sbjct  367  GGFVMSSRVQGEGKSSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILACKP  418



>gb|EYU27182.1| hypothetical protein MIMGU_mgv1a006729mg [Erythranthe guttata]
 gb|EYU27183.1| hypothetical protein MIMGU_mgv1a006729mg [Erythranthe guttata]
Length=433

 Score =   316 bits (809),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 190/252 (75%), Positives = 207/252 (82%), Gaps = 11/252 (4%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            N+KQPIFSCKF +DRV QVDPLS F+SS  D S  + ERRERKGW VKIHDLSGSAVAAA
Sbjct  182  NVKQPIFSCKFIRDRVSQVDPLSTFASSSGDGSHQDTERRERKGWNVKIHDLSGSAVAAA  241

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG----IRDSICC  464
            FITTPFVPSTGCDWV RSNPGAWLIVRPDP   +SWQPWGKLEAWRER     IRDS+  
Sbjct  242  FITTPFVPSTGCDWVARSNPGAWLIVRPDPYQHDSWQPWGKLEAWRERRGGGIIRDSVNF  301

Query  463  RFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQ-----vraaaspvpsprsSGDFS  299
            RFH+ SDG EGG +LL+SEI + AEKGGEF+IDTD+Q       AAA+ VPSP+SSGDF+
Sbjct  302  RFHVFSDGQEGGKNLLISEISLGAEKGGEFFIDTDRQIRATAEAAAAAAVPSPQSSGDFT  361

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFR  119
             LSPV GGFVMSCRV GEGK SK  VQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFR
Sbjct  362  ELSPVAGGFVMSCRVCGEGKSSKPTVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFR  421

Query  118  RLRR--GTRHSW  89
            R  R   +R+SW
Sbjct  422  RKIRVSSSRNSW  433



>gb|KFK25983.1| hypothetical protein AALP_AA8G187900 [Arabis alpina]
Length=432

 Score =   315 bits (808),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 183/232 (79%), Positives = 202/232 (87%), Gaps = 4/232 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV QVDPL+ + SS  D +++E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  188  SVKQPIFSCKFSRDRVSQVDPLNGYWSSVGDGTELESERRERKGWKVKIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWL+VRPDPC   SWQPWGKLEAWRERGIRDS+CCRFHL
Sbjct  248  FITTPFVPSTGCDWVAKSNPGAWLVVRPDPCRPNSWQPWGKLEAWRERGIRDSVCCRFHL  307

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVV--  281
            L++G E  GD+LMSEILISAEKGGEF IDTDKQ+   A+  VPSP+SSGDFS L   V  
Sbjct  308  LANGQE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVAATPVPSPQSSGDFSGLGQCVSG  366

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
            GGFVMS RVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+P
Sbjct  367  GGFVMSSRVQGEGKLSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILACKP  418



>ref|XP_004307193.1| PREDICTED: uncharacterized protein LOC101307926 [Fragaria vesca 
subsp. vesca]
Length=433

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 187/234 (80%), Positives = 204/234 (87%), Gaps = 5/234 (2%)
 Frame = -3

Query  805  KQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAAFI  626
            KQPIFSC+FS+DRV QVDPLSN+ S  VD S++E ERRERKGWKV IHDLSGSAVAAAFI
Sbjct  191  KQPIFSCRFSRDRVPQVDPLSNYWSGSVDDSNLETERRERKGWKVTIHDLSGSAVAAAFI  250

Query  625  TTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG-IRDSICCRFHLL  449
            TTPFVPSTGCDWV RSNPGAWLIV PDPC  ESWQPW KLEAWRERG IRDS+CCRF LL
Sbjct  251  TTPFVPSTGCDWVARSNPGAWLIVSPDPCRPESWQPWAKLEAWRERGSIRDSVCCRFRLL  310

Query  448  SDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspv---psprsSGDFSALSPVVG  278
            S+  E   +LLMSEI I+AEKGGEF+IDTD+Q++AAA+     PSP+SSGD++AL PV G
Sbjct  311  SECQE-AAELLMSEIHINAEKGGEFFIDTDRQMQAAAAAAPPLPSPQSSGDYAALGPVEG  369

Query  277  GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR  116
            GFVMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAA DLSIEACRPFRR
Sbjct  370  GFVMSCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAADLSIEACRPFRR  423



>ref|NP_197266.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAC01908.1| putative protein [Arabidopsis thaliana]
 gb|ABM06007.1| At5g17640 [Arabidopsis thaliana]
 gb|AED92451.1| uncharacterized protein AT5G17640 [Arabidopsis thaliana]
Length=432

 Score =   313 bits (803),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 201/232 (87%), Gaps = 4/232 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV QVDPL+ + SS  D +++E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  188  SVKQPIFSCKFSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWL+VRPDP    SWQPWGKLEAWRERGIRDS+CCRFHL
Sbjct  248  FITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHL  307

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVV--  281
            LS+G E  GD+LMSEILISAEKGGEF IDTDKQ+   A+  +PSP+SSGDFS L   V  
Sbjct  308  LSNGLE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVAATPIPSPQSSGDFSGLGQCVSG  366

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
            GGFVMS RVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+P
Sbjct  367  GGFVMSSRVQGEGKSSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILACKP  418



>ref|XP_002873840.1| hypothetical protein ARALYDRAFT_909762 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50099.1| hypothetical protein ARALYDRAFT_909762 [Arabidopsis lyrata subsp. 
lyrata]
Length=432

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 202/232 (87%), Gaps = 4/232 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV QVDPL+ + SS  D +++E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  188  SVKQPIFSCKFSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPS+GCDWV +SNPGAWL+VRPDP    SWQPWGKLEAWRERGIRDS+CCRFHL
Sbjct  248  FITTPFVPSSGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHL  307

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVV--  281
            LS+G E  GD+LMSEILISAEKGGEF+IDTDKQ+   A+  +PSP+SSGDFS L   V  
Sbjct  308  LSNGLE-IGDVLMSEILISAEKGGEFFIDTDKQMLTVAATPIPSPQSSGDFSGLGQCVSG  366

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
            GGFVMS RVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+P
Sbjct  367  GGFVMSSRVQGEGKSSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILACKP  418



>ref|XP_010420495.1| PREDICTED: uncharacterized protein LOC104706063 isoform X2 [Camelina 
sativa]
Length=431

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 201/232 (87%), Gaps = 4/232 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV QVDPL+ + SS  D +++E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  187  SVKQPIFSCKFSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAA  246

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWL+VRPDP    SWQPWGKLEAWRERGIRDS+CCRFHL
Sbjct  247  FITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHL  306

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVV--  281
            LS+G E  GD+LMSEILISAEKGGEF IDTDKQ+   A+  +PSP+SSGDFS L   V  
Sbjct  307  LSNGLE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVAATPIPSPQSSGDFSGLGQCVSG  365

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
            GGFVMS RVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+P
Sbjct  366  GGFVMSSRVQGEGKSSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILACKP  417



>ref|XP_010420494.1| PREDICTED: uncharacterized protein LOC104706063 isoform X1 [Camelina 
sativa]
Length=431

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 201/232 (87%), Gaps = 4/232 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV QVDPL+ + SS  D +++E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  187  SVKQPIFSCKFSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAA  246

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWL+VRPDP    SWQPWGKLEAWRERGIRDS+CCRFHL
Sbjct  247  FITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHL  306

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVV--  281
            LS+G E  GD+LMSEILISAEKGGEF IDTDKQ+   A+  +PSP+SSGDFS L   V  
Sbjct  307  LSNGLE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVAATPIPSPQSSGDFSGLGQCVSG  365

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
            GGFVMS RVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+P
Sbjct  366  GGFVMSSRVQGEGKSSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILACKP  417



>ref|XP_006289579.1| hypothetical protein CARUB_v10003124mg [Capsella rubella]
 gb|EOA22477.1| hypothetical protein CARUB_v10003124mg [Capsella rubella]
Length=432

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 201/232 (87%), Gaps = 4/232 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV QVDPL+ + SS  D +++E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  188  SVKQPIFSCKFSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWL+VRPDP    SWQPWGKLEAWRERGIRDS+CCRFHL
Sbjct  248  FITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHL  307

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVV--  281
            LS+G E  GD+LMSEILISAEKGGEF IDTDKQ+   A+  +PSP+SSGDFS L   V  
Sbjct  308  LSNGLE-IGDVLMSEILISAEKGGEFLIDTDKQMLTVAATPIPSPQSSGDFSGLGQCVSG  366

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
            GGFVMS RVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+P
Sbjct  367  GGFVMSSRVQGEGKSSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILACKP  418



>ref|XP_010492723.1| PREDICTED: uncharacterized protein LOC104770072 [Camelina sativa]
Length=432

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 201/232 (87%), Gaps = 4/232 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV QVDPL+ + SS  D +++E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  188  SVKQPIFSCKFSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWL+VRPDP    SWQPWGKLEAWRERGIRDS+CCRFHL
Sbjct  248  FITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHL  307

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVV--  281
            LS+G E  GD+LMSEILISAEKGGEF IDTDKQ+   A+  +PSP+SSGDFS L   V  
Sbjct  308  LSNGLE-IGDVLMSEILISAEKGGEFLIDTDKQMLTVAATPIPSPQSSGDFSGLGQCVSG  366

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
            GGFVMS RVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+P
Sbjct  367  GGFVMSSRVQGEGKSSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILACKP  418



>ref|XP_010453965.1| PREDICTED: uncharacterized protein LOC104735808 [Camelina sativa]
Length=432

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 201/232 (87%), Gaps = 4/232 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV QVDPL+ + SS  D +++E ERRERKGWKVKIHDLSGSAVAAA
Sbjct  188  SVKQPIFSCKFSRDRVSQVDPLNGYWSSSGDGTELESERRERKGWKVKIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWL+VRPDP    SWQPWGKLEAWRERGIRDS+CCRFHL
Sbjct  248  FITTPFVPSTGCDWVAKSNPGAWLVVRPDPSRPNSWQPWGKLEAWRERGIRDSVCCRFHL  307

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVV--  281
            LS+G E  GD+LMSEILISAEKGGEF +DTDKQ+   A+  +PSP+SSGDFS L   V  
Sbjct  308  LSNGLE-VGDVLMSEILISAEKGGEFLVDTDKQMLTVAATPIPSPQSSGDFSGLGQCVSG  366

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
            GGFVMS RVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+P
Sbjct  367  GGFVMSSRVQGEGKSSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILACKP  418



>emb|CDY16904.1| BnaC09g40310D [Brassica napus]
Length=433

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 200/232 (86%), Gaps = 4/232 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV QVDPL+ + SS  D +++  ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SVKQPIFSCKFSRDRVSQVDPLNGYWSSSGDGTELGSERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAW +VRPDPC   SWQPWGKLEAWRERGIRDS+CCRFH+
Sbjct  249  FITTPFVPSTGCDWVAKSNPGAWHVVRPDPCRPNSWQPWGKLEAWRERGIRDSVCCRFHI  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVV--  281
            LS+G E  GD+LMSEILISAEKGGEF IDTDKQ+   A+  +PSP+SSGD+S L   V  
Sbjct  309  LSNGQE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVAATPIPSPQSSGDYSGLGQCVSG  367

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
            GGFVMS RVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+P
Sbjct  368  GGFVMSSRVQGEGKSSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILACKP  419



>ref|XP_009107533.1| PREDICTED: uncharacterized protein LOC103833189 [Brassica rapa]
 ref|XP_009107534.1| PREDICTED: uncharacterized protein LOC103833189 [Brassica rapa]
 ref|XP_009107535.1| PREDICTED: uncharacterized protein LOC103833189 [Brassica rapa]
 emb|CDY38449.1| BnaA10g17090D [Brassica napus]
Length=433

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 200/232 (86%), Gaps = 4/232 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DRV QVDPL+ + SS  D +++  ERRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SVKQPIFSCKFSRDRVSQVDPLNGYWSSSGDGTELGSERRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAW +VRPDPC   SWQPWGKLEAWRERGIRDS+CCRFH+
Sbjct  249  FITTPFVPSTGCDWVAKSNPGAWHVVRPDPCRPNSWQPWGKLEAWRERGIRDSVCCRFHI  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVV--  281
            LS+G E  GD+LMSEILISAEKGGEF IDTDKQ+   A+  +PSP+SSGD+S L   V  
Sbjct  309  LSNGQE-VGDVLMSEILISAEKGGEFLIDTDKQMLTVAATPIPSPQSSGDYSGLGQCVSG  367

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
            GGFVMS RVQGEGK SK +VQLAMRHVTCVEDAAIFMALAAAVDLSI AC+P
Sbjct  368  GGFVMSSRVQGEGKSSKPVVQLAMRHVTCVEDAAIFMALAAAVDLSILACKP  419



>ref|XP_009361368.1| PREDICTED: uncharacterized protein LOC103951663 [Pyrus x bretschneideri]
Length=461

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 176/240 (73%), Positives = 199/240 (83%), Gaps = 6/240 (3%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKF +DRV QVDPLS + S   ++ D++ ERRERKGWKV IHDLSGSA+AAA
Sbjct  217  SIKQPIFSCKFIRDRVPQVDPLSTYWSGAANNPDLDTERRERKGWKVTIHDLSGSAIAAA  276

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVP+TGCDWV RSNPGAWLIV PD    +SWQPWGKLEAWRERGIRDS+ CRF L
Sbjct  277  FITTPFVPATGCDWVARSNPGAWLIVSPDAYRPDSWQPWGKLEAWRERGIRDSVFCRFRL  336

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsp-----rsSGDFSALSP  287
            LS+  E   DL MSEI I+AEKGG+F IDTDKQ++AAA+   +      ++SGDF+ L P
Sbjct  337  LSECQE-AVDLFMSEIRINAEKGGDFSIDTDKQMQAAAATAAASPIPSPQTSGDFAGLYP  395

Query  286  VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRLRR  107
             VGGFVMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFR+ R+
Sbjct  396  DVGGFVMSCRVQGEGKASKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRKFRK  455



>ref|XP_009345575.1| PREDICTED: uncharacterized protein LOC103937356 [Pyrus x bretschneideri]
 ref|XP_009345576.1| PREDICTED: uncharacterized protein LOC103937356 [Pyrus x bretschneideri]
 ref|XP_009345577.1| PREDICTED: uncharacterized protein LOC103937356 [Pyrus x bretschneideri]
Length=434

 Score =   306 bits (783),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 175/240 (73%), Positives = 199/240 (83%), Gaps = 6/240 (3%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +IKQPIFSCKF +DRV QVDPLS + S   ++ D++ ERRERKGWKV IHDLSGSA+AAA
Sbjct  190  SIKQPIFSCKFIRDRVPQVDPLSTYWSGAANNPDLDTERRERKGWKVTIHDLSGSAIAAA  249

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVP+TGCDWV RSNPGAWLIV PD    +SWQPWGKLEAWRERGIRDS+ CRF L
Sbjct  250  FITTPFVPATGCDWVARSNPGAWLIVSPDAYRPDSWQPWGKLEAWRERGIRDSVFCRFRL  309

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsp-----rsSGDFSALSP  287
            LS+  E   DL MSEI I+AE+GG+F IDTDKQ++AAA+   +      ++SGDF+ L P
Sbjct  310  LSECQE-AVDLFMSEIRINAERGGDFSIDTDKQMQAAAATAAASPIPSPQTSGDFAGLYP  368

Query  286  VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRLRR  107
             VGGFVMSCRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFR+ R+
Sbjct  369  DVGGFVMSCRVQGEGKASKPLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRKFRK  428



>ref|XP_010275162.1| PREDICTED: uncharacterized protein LOC104610306 [Nelumbo nucifera]
Length=432

 Score =   300 bits (768),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 205/242 (85%), Gaps = 4/242 (2%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDR-VQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAA  635
             IKQPIFSCKFS+DR   Q+D +SN   S    +D + +RRERKGW+V IHDLSGSAVAA
Sbjct  189  TIKQPIFSCKFSRDRRASQLDSVSNHRVSTTYGTDQDTDRRERKGWRVMIHDLSGSAVAA  248

Query  634  AFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFH  455
            AF+ TPFVPS GCD V RSNPGAWLIVRPD    +SWQPWGKLEAWRERGI+DSICCRFH
Sbjct  249  AFMATPFVPSMGCDRVARSNPGAWLIVRPDAFGPDSWQPWGKLEAWRERGIKDSICCRFH  308

Query  454  LLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGG  275
            LLS+G E GGDLL+SEILISA+KGG F+IDT+++   + +P+PSPRSSGDF++L PV GG
Sbjct  309  LLSEGQE-GGDLLVSEILISADKGGVFFIDTERR-TPSVTPLPSPRSSGDFASLGPVFGG  366

Query  274  FVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRL-RRGTR  98
            FVM+CRVQGEGK SK LVQLAMRHVTCVEDAAIFMALAAAVDLS+ ACRPFRR  ++G+R
Sbjct  367  FVMNCRVQGEGKSSKPLVQLAMRHVTCVEDAAIFMALAAAVDLSMVACRPFRRKPKKGSR  426

Query  97   HS  92
            +S
Sbjct  427  YS  428



>gb|KJB46078.1| hypothetical protein B456_007G347500 [Gossypium raimondii]
Length=382

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQPIFSCKFS+DR  QVD L+ +     D+ DIE  RRERKGWKVKIHDLSGSAVAAA
Sbjct  189  SVKQPIFSCKFSRDRASQVDLLNAYWPGSADNLDIETGRRERKGWKVKIHDLSGSAVAAA  248

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
            FITTPFVPSTGCDWV +SNPGAWLI+RPD    ESW PWGKLEAWRERGIRD++CCRFHL
Sbjct  249  FITTPFVPSTGCDWVAKSNPGAWLILRPDVVRPESWLPWGKLEAWRERGIRDAVCCRFHL  308

Query  451  LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPVVGGF  272
            LS+  + G ++LMSEI ISAEKGGEF+IDTD+ +R A +P+PSP+SSGDFSALSP+ GGF
Sbjct  309  LSEA-QDGAEVLMSEIRISAEKGGEFFIDTDRLMRQAPTPIPSPQSSGDFSALSPISGGF  367

Query  271  VMSCRVQGEGKYSK  230
            VMSCRVQGEGK S 
Sbjct  368  VMSCRVQGEGKNSN  381



>ref|XP_010905311.1| PREDICTED: uncharacterized protein LOC105032546 [Elaeis guineensis]
Length=432

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 180/246 (73%), Gaps = 8/246 (3%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDR-VQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAA  635
             IKQPIFSCKFS+DR   Q+D + N+  S       + +RRERKGWK+ IHDLSGSAVAA
Sbjct  188  TIKQPIFSCKFSRDRRASQLDTVGNYWLSSNREDQ-DADRRERKGWKIMIHDLSGSAVAA  246

Query  634  AFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFH  455
            AF+ TPFVPS GCD V RSNPGAWLI+RPD      W PWG+LEAWRE G RD +C R H
Sbjct  247  AFMATPFVPSMGCDRVARSNPGAWLILRPDAAGSSGWYPWGRLEAWRETGSRDFVCLRLH  306

Query  454  LLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDF---SALSPV  284
            LL DG E G  +L+SE+LIS+EKGGEFYID D+Q         S   +GD+   S    +
Sbjct  307  LLPDGQEAG--VLVSEVLISSEKGGEFYIDMDRQTPVGTPVPSSQGGTGDYFTTSLAGSL  364

Query  283  VGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRR  107
             GGFVM+CRVQGEGK SK  VQLAMRHVTCVEDAAIFMALAAA DLSI+ACRPFRR  R+
Sbjct  365  AGGFVMNCRVQGEGKISKPSVQLAMRHVTCVEDAAIFMALAAAADLSIKACRPFRRNARK  424

Query  106  GTRHSW  89
            G RHS+
Sbjct  425  GFRHSF  430



>ref|XP_008777938.1| PREDICTED: uncharacterized protein LOC103697788 [Phoenix dactylifera]
 ref|XP_008777939.1| PREDICTED: uncharacterized protein LOC103697788 [Phoenix dactylifera]
 ref|XP_008777940.1| PREDICTED: uncharacterized protein LOC103697788 [Phoenix dactylifera]
Length=431

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 179/245 (73%), Gaps = 7/245 (3%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDR-VQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAA  635
             IKQPIFSCKFS+DR   Q+D + N   S       + +RRERKGWK+ IHDLSGSAVAA
Sbjct  188  TIKQPIFSCKFSRDRRASQLDTVGNNWLSSNCEDQ-DADRRERKGWKIMIHDLSGSAVAA  246

Query  634  AFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFH  455
            AF+ TPFVPS GCD V RSNPGAWLI+RPD      W PWG+LEAWRE G RDS+C R H
Sbjct  247  AFMATPFVPSMGCDRVARSNPGAWLILRPDAAGSSGWHPWGRLEAWRETGSRDSVCLRLH  306

Query  454  LLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDF--SALSPVV  281
            LL +G E G  +L+SE LIS+EKGGEFYID D+Q         S   +G F  S    + 
Sbjct  307  LLPEGQEAG--VLVSEALISSEKGGEFYIDMDRQTPVGTPVPSSQGGTGYFTTSLAGLMA  364

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR-LRRG  104
            GGFVM+CRVQGEGK SK  VQLAMRHVTCVEDAAIFMALAAAVDLSI+ACRPFRR  R+G
Sbjct  365  GGFVMNCRVQGEGKISKPSVQLAMRHVTCVEDAAIFMALAAAVDLSIKACRPFRRNARKG  424

Query  103  TRHSW  89
             RHS+
Sbjct  425  FRHSF  429



>gb|EYU42265.1| hypothetical protein MIMGU_mgv1a007286mg [Erythranthe guttata]
Length=412

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 159/250 (64%), Positives = 184/250 (74%), Gaps = 26/250 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnf-sssfvdssDIEIERRERKGWKVKIHDLSGSAVAA  635
            + KQPIFSCKFS DR  + DPL +   S+  + S  + ERRERKGWKVKIHDLSGSA+AA
Sbjct  180  STKQPIFSCKFSGDRGSEGDPLISTFRSNSSNGSHTDAERRERKGWKVKIHDLSGSAIAA  239

Query  634  AFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER---GIRDSICC  464
            AFITTPFVPSTGCDWV +SNPGAWLIV PDP    SWQPWGKLEAWR+R      DSI  
Sbjct  240  AFITTPFVPSTGCDWVSKSNPGAWLIVHPDPYRPHSWQPWGKLEAWRQRSGTAREDSIFL  299

Query  463  RFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPV  284
            RFHLLSDG +   +LLMSE+ I+AEKGGEF IDTD+                +  A +PV
Sbjct  300  RFHLLSDGNK---ELLMSEVSINAEKGGEFLIDTDRP--------------AEEGAEAPV  342

Query  283  ----VGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR  116
                V GFVMS R++G GK S+ +VQLA++HVTCVEDAAIFMALAAAVDLS+EACRPFRR
Sbjct  343  GSTEVVGFVMSFRMRGGGKCSEPVVQLAVKHVTCVEDAAIFMALAAAVDLSVEACRPFRR  402

Query  115  -LRRGTRHSW  89
             +R+G RH W
Sbjct  403  GVRKGNRHCW  412



>ref|XP_009398606.1| PREDICTED: uncharacterized protein LOC103983151 [Musa acuminata 
subsp. malaccensis]
Length=436

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 185/246 (75%), Gaps = 7/246 (3%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             IKQPIFSCKF QDR      + +   +  ++ + + ERRERKGWKV IHDLSGSAVAAA
Sbjct  188  TIKQPIFSCKFIQDRRTSPLDMISGHWTNSNTENHDAERRERKGWKVMIHDLSGSAVAAA  247

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPC-MRESWQPWGKLEAWRERGIRDSICCRFH  455
            F+ TPFVPS GCD V RSNPGAWLI+RPDP    ESW PWG+LEAWRE G RD++C R H
Sbjct  248  FMATPFVPSMGCDRVARSNPGAWLILRPDPVSSSESWHPWGRLEAWRETGPRDTVCLRLH  307

Query  454  LLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDF--SALSPVV  281
            +L +G + G  +L+S++ IS++KGGEFYID D+Q+           S+G+F  ++L+P V
Sbjct  308  ILPEGQDAG--ILVSDVAISSDKGGEFYIDMDRQMPVGIPVGKPQGSTGEFCSASLAPRV  365

Query  280  GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR--LRR  107
            G FVM+C+VQGEG+ SK LVQLA++HVTCVEDAAIFMALAAAVDLSI+ACRPF R   ++
Sbjct  366  GRFVMNCKVQGEGQCSKPLVQLAVQHVTCVEDAAIFMALAAAVDLSIKACRPFGRKSKKK  425

Query  106  GTRHSW  89
            G  HS+
Sbjct  426  GIFHSF  431



>ref|XP_002443918.1| hypothetical protein SORBIDRAFT_07g004370 [Sorghum bicolor]
 gb|EES13413.1| hypothetical protein SORBIDRAFT_07g004370 [Sorghum bicolor]
Length=443

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 139/242 (57%), Positives = 172/242 (71%), Gaps = 16/242 (7%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDR-VQQVDPLsnf----sssfvdssDIEIERRERKGWKVKIHDLSGS  647
            +I+QP+FSCKF +DR   Q DPL       SSS  +  D+E+ RRERKGWKV IHDLSGS
Sbjct  190  SIRQPVFSCKFIRDRRPSQSDPLGGGGQYWSSSSSEEKDMEMVRRERKGWKVVIHDLSGS  249

Query  646  AVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPC-MRESWQPWGKLEAWRE----RGI  482
            AVAAAF+ TPFVP+ G D V RSNPGAWLIVR D     +SWQPWG+LEAWR+     G 
Sbjct  250  AVAAAFMATPFVPAPGGDTVARSNPGAWLIVRADTTGSSDSWQPWGRLEAWRDAAAASGG  309

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDF  302
            +D++  R HLL D  +    +L+SE  +S++KGGEF+ID D+Q  +A +      S G  
Sbjct  310  KDTVRLRLHLLPDRHDDC--VLVSEAPLSSDKGGEFFIDMDRQAPSATAAEHCAASLGAA  367

Query  301  SALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF  122
             A     GGFVMSCRV+GE + S+  VQLAMRHVTC+EDAA+F+ALAAAVDLS++ACRPF
Sbjct  368  CA----GGGFVMSCRVEGEARSSRPFVQLAMRHVTCMEDAAMFVALAAAVDLSVKACRPF  423

Query  121  RR  116
            RR
Sbjct  424  RR  425



>gb|ACN28488.1| unknown [Zea mays]
 gb|AFW57207.1| hypothetical protein ZEAMMB73_373927 [Zea mays]
Length=438

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 138/243 (57%), Positives = 170/243 (70%), Gaps = 17/243 (7%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDR-VQQVDPLsnf---sssfvdssDIEIERRERKGWKVKIHDLSGSA  644
            +I+QP+FSCKF +DR   Q DPL      SSS  +  D+E+ RRERK WKV IHDLSGSA
Sbjct  184  SIRQPVFSCKFIRDRRPSQSDPLGGGQYWSSSSSEEQDMEMVRRERKAWKVVIHDLSGSA  243

Query  643  VAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPC-MRESWQPWGKLEAWRERGI-----  482
            VAAAF+ TPFVP+ G D V RSNPGAWLIVR D     +SWQPWG+LEAWRE        
Sbjct  244  VAAAFMATPFVPAPGGDTVARSNPGAWLIVRADTTGSSDSWQPWGRLEAWREAAAAAASS  303

Query  481  -RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGD  305
             +D++  R HLL D  +    +L+SE  +S++KGGEF+ID D+Q  +A +      S G 
Sbjct  304  GKDTVRLRLHLLPDRHDDC--VLVSEAPLSSDKGGEFFIDMDRQAPSATAAEHCAASLGA  361

Query  304  FSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
              A     GGFVMSCRV+GE + S+  VQLAMRHVTC+EDAA+F+ALAAAVDLS++ACRP
Sbjct  362  ACA----GGGFVMSCRVEGEARSSRPFVQLAMRHVTCMEDAAMFVALAAAVDLSVKACRP  417

Query  124  FRR  116
            FRR
Sbjct  418  FRR  420



>ref|NP_001061067.1| Os08g0163500 [Oryza sativa Japonica Group]
 dbj|BAC99812.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAC99909.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22981.1| Os08g0163500 [Oryza sativa Japonica Group]
 gb|EAZ05703.1| hypothetical protein OsI_27935 [Oryza sativa Indica Group]
 gb|EAZ41618.1| hypothetical protein OsJ_26152 [Oryza sativa Japonica Group]
 dbj|BAG87492.1| unnamed protein product [Oryza sativa Japonica Group]
Length=439

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 134/252 (53%), Positives = 168/252 (67%), Gaps = 20/252 (8%)
 Frame = -3

Query  805  KQPIFSCKFSQDRV-QQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAAF  629
            +QPIFSCKF +DR     D L   SS   +     + RRERKGWKV IHDLSGSAVAAAF
Sbjct  180  RQPIFSCKFIRDRRGSHSDQLYWSSSGGEEKEAEMMRRRERKGWKVVIHDLSGSAVAAAF  239

Query  628  ITTPFVPSTGCDWVDRSNPGAWLIVRP---------DPCMRESWQPWGKLEAWRERG---  485
            + TPFV ++GCD V RSNPGAWLI R               ESWQPWG+LEAWR++G   
Sbjct  240  MATPFVAASGCDTVARSNPGAWLIARAGATAPGSTSSSAAVESWQPWGRLEAWRDQGGAA  299

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvps-prsSG  308
             +D++C R  LL DG +    +L++E  + +++GGEF ID D+Q  A A+       S G
Sbjct  300  RQDTVCLRLRLLPDGQDAC--MLVAETPLRSDRGGEFAIDMDRQAPALAAGAEHCAASLG  357

Query  307  DFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACR  128
            +  A     GGFVMSCRV+GE + S+ LVQLAMRHVTC+EDAA+F+ALAAAVDLS++ACR
Sbjct  358  EACA----GGGFVMSCRVEGESRSSRPLVQLAMRHVTCMEDAAMFVALAAAVDLSVKACR  413

Query  127  PFRRLRRGTRHS  92
            PFRR    T+ +
Sbjct  414  PFRRKTTATKKT  425



>ref|XP_001760212.1| predicted protein [Physcomitrella patens]
 gb|EDQ74968.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 164/242 (68%), Gaps = 23/242 (10%)
 Frame = -3

Query  805  KQPIFSCKFSQDRVQQVD-PLsnfsssfvdssDIEIE----RRERKGWKVKIHDLSGSAV  641
            +Q IFSCKFS+D++ +    L +F  S   +    +E    R+ERKGW V IHDLSGS V
Sbjct  183  QQSIFSCKFSRDKLSRCRLVLFSFDISSSTAWHTSLESREKRKERKGWLVMIHDLSGSPV  242

Query  640  AAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCR  461
            AAA + TPFVPS G D+V RSNPGAWLI+RP+    ++W+PWG+LEAWR+RG +D + CR
Sbjct  243  AAASMVTPFVPSAGSDYVARSNPGAWLILRPESPGADNWRPWGRLEAWRDRGGKD-MGCR  301

Query  460  FHLLSD---GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
            F L+++          +L SEI +SA+KGGEF +D  K  + ++            S +S
Sbjct  302  FQLMAEGGGVTGVSSGVLTSEITLSAKKGGEFTMDARKFTQESS------------SGIS  349

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRL  113
            P V  FVM C V+G+   SK LVQ+AMRHV+CVED A+F+ALAAAVDLS++AC+PF RRL
Sbjct  350  P-VEKFVMICGVRGDRDSSKPLVQVAMRHVSCVEDVAVFIALAAAVDLSVDACQPFKRRL  408

Query  112  RR  107
            R+
Sbjct  409  RK  410



>ref|XP_001778621.1| predicted protein [Physcomitrella patens]
 gb|EDQ56516.1| predicted protein [Physcomitrella patens]
Length=434

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 162/249 (65%), Gaps = 23/249 (9%)
 Frame = -3

Query  805  KQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAAFI  626
            KQ IFSCKFS+D+V   D  S+ SS          +R+ERKGW V IHDLSGS VAAA +
Sbjct  183  KQSIFSCKFSRDKVGTSDISSSSSSLEGRE-----KRKERKGWLVMIHDLSGSPVAAASM  237

Query  625  TTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHLLS  446
             TPFVPS G D+V RSNPGAWLI+RP+    +SW+PWG+LE WRERG +  +  RF L++
Sbjct  238  VTPFVPSAGSDYVARSNPGAWLILRPESSGADSWRPWGRLEVWRERGGK-GMGSRFKLMA  296

Query  445  D---GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSPV---  284
            +    P  G  +L SE  +SA+KGGEF ID  ++ +       SP      S+LSP    
Sbjct  297  EGGGVPGVGSGVLSSETFLSAKKGGEFTIDA-RRFKMEVPSGTSPAGVSRASSLSPKSSG  355

Query  283  ----------VGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEA  134
                      VG FVMSC V+G+   +K LVQ+AMRHV+CVED A+F+ALAAA+DLS++A
Sbjct  356  ELYSGSGLHGVGEFVMSCGVRGDRDSTKPLVQVAMRHVSCVEDVAVFIALAAAMDLSVDA  415

Query  133  CRPFRRLRR  107
            C+PFRR  R
Sbjct  416  CQPFRRRLR  424



>gb|KHG29270.1| hypothetical protein F383_14119 [Gossypium arboreum]
Length=418

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 163/248 (66%), Gaps = 25/248 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQ--VDP-LsnfsssfvdssDIEIER--RERKGWKVKIHDLSGS  647
            NI+QP+FSCKFS DR +   + P  SN +  ++ +   E ER  RERKGW + IHDLSGS
Sbjct  179  NIRQPVFSCKFSADRSRSRSLPPDFSNKNRGWMRTFSGEKERQGRERKGWMIMIHDLSGS  238

Query  646  AVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSIC  467
             VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D + 
Sbjct  239  PVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGFSVSSWKPWGRLEAWRERGPIDGLG  298

Query  466  CRFHLLS-DGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
             +F L++ +GP  G  + ++E  +S +KGG+F ID                   D SALS
Sbjct  299  YKFELVTENGPNNG--IPIAEATMSIKKGGQFCIDRRVSR--------------DPSALS  342

Query  289  --PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-R  119
                V GFVM   V+GEGK SK +VQ+ M+HVTC+ DAA+F+AL+AA+DLS++AC+ F R
Sbjct  343  SRSPVKGFVMGATVEGEGKVSKPVVQVGMQHVTCMADAALFIALSAAIDLSMDACQLFSR  402

Query  118  RLRRGTRH  95
            +LR+   H
Sbjct  403  KLRKELCH  410



>gb|KJB54312.1| hypothetical protein B456_009G028600 [Gossypium raimondii]
Length=418

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 165/248 (67%), Gaps = 25/248 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQ--VDP-LsnfsssfvdssDIEIER--RERKGWKVKIHDLSGS  647
            NI+QP+FSCKFS DR +   + P  SN +  ++ +   E ER  RERKGW + IHDLSGS
Sbjct  179  NIRQPVFSCKFSADRSRSRSLPPDFSNKNRGWMRTFSGEKERQGRERKGWMIMIHDLSGS  238

Query  646  AVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSIC  467
             VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D + 
Sbjct  239  PVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGFSVSSWKPWGRLEAWRERGPIDGLG  298

Query  466  CRFHLLS-DGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
             +F L++ +GP  G  + ++E  +S +KGG+F ID               R S D SALS
Sbjct  299  YKFELVTENGPNNG--IPIAEATMSIKKGGQFCID--------------RRVSRDPSALS  342

Query  289  --PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-R  119
                V GFVM   V+GEGK SK +VQ+ M+HVTC+ DAA+F+AL+AA+DLS++AC+ F R
Sbjct  343  LRSPVKGFVMGATVEGEGKVSKPVVQVGMQHVTCMADAALFIALSAAIDLSMDACQLFSR  402

Query  118  RLRRGTRH  95
            +LR+   H
Sbjct  403  KLRKELCH  410



>emb|CDP03235.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 156/245 (64%), Gaps = 27/245 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDI-------EIERRERKGWKVKIHDLS  653
            NI+QP+FSCKFS DR  +   L +  +   +   +       E   RERKGW + IHDLS
Sbjct  187  NIRQPVFSCKFSADRNNRSRSLPSDFTMGGNKGWVRTFSGEREKSGRERKGWMIMIHDLS  246

Query  652  GSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDS  473
            GSAVAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D 
Sbjct  247  GSAVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGPSVSSWKPWGRLEAWRERGPVDG  306

Query  472  ICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSAL  293
            +  RF L++D     G + ++E  +S ++GG+F ID  ++                 S L
Sbjct  307  LGYRFALVTDSGLTSG-VPIAEGTMSVKRGGQFCIDNARKD----------------SVL  349

Query  292  SPV--VGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            S V  V GFVM   V+ EGK SK +VQ+ +RHVTC+ DAA+F+AL+AA+DLS++ACR F 
Sbjct  350  SLVLPVRGFVMGSSVEAEGKVSKPMVQVGVRHVTCMADAALFVALSAAIDLSMDACRLFS  409

Query  121  RRLRR  107
            R+LR+
Sbjct  410  RKLRK  414



>ref|XP_010049600.1| PREDICTED: uncharacterized protein LOC104438202 [Eucalyptus grandis]
 gb|KCW82300.1| hypothetical protein EUGRSUZ_C03707 [Eucalyptus grandis]
Length=419

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/245 (47%), Positives = 154/245 (63%), Gaps = 26/245 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssf-----vdssDIEIERRERKGWKVKIHDLSGS  647
            NI+QP+FSCKFS DR  +   L++   S        S + E   RERKGW V IHDLSGS
Sbjct  188  NIRQPVFSCKFSADRNCRSRSLASDFPSSRGWMRTLSGERERHSRERKGWMVTIHDLSGS  247

Query  646  AVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSIC  467
             VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D + 
Sbjct  248  PVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGYSVSSWKPWGRLEAWRERGPTDGLG  307

Query  466  CRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSP  287
             +F L+++G    G + ++E  +S ++GG+F ID                     S+L  
Sbjct  308  YKFELVTEGGPTRG-IPIAEATLSVKRGGQFSIDVG-------------------SSLKS  347

Query  286  VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRLR  110
             V GFVM+  V+ EGK SK  VQ+ M+HVTC+ DAA+F+AL+AA+DLS++AC+ F  +LR
Sbjct  348  PVKGFVMASTVEAEGKTSKPAVQVGMQHVTCMPDAALFIALSAAIDLSMDACQLFSHKLR  407

Query  109  RGTRH  95
            +   H
Sbjct  408  KELCH  412



>ref|XP_002514196.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48150.1| conserved hypothetical protein [Ricinus communis]
Length=421

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 160/250 (64%), Gaps = 25/250 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdss------DIEIER--RERKGWKVKIHDL  656
            NI+QP+FSCKFS DR  +   L +  +   ++         E ER  RERKGW + IHDL
Sbjct  179  NIRQPVFSCKFSADRNSRSRSLPSDFTLHNNNRGWRRTFSGEKERAGRERKGWMIMIHDL  238

Query  655  SGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRD  476
            SGS VAAA + TPFVPS G D V RSNPGAWLI+RP+     +W+PWG+LEAWRERG  D
Sbjct  239  SGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGFSVSNWKPWGRLEAWRERGPLD  298

Query  475  SICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDF  302
             +  +  L++D  GP GG  + ++E  +   KGG+F ID+              + SG  
Sbjct  299  GLGYKVELVTDNGGPSGG--IPIAEGTMGMRKGGQFCIDS-----------RIMKDSGLL  345

Query  301  SALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF  122
            S+ SP V GFVM   V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F
Sbjct  346  SSRSP-VKGFVMGATVEGEGKVSKPVVQIGVQHVTCMADAALFIALSAAIDLSMDACRLF  404

Query  121  -RRLRRGTRH  95
              +LR+   H
Sbjct  405  SHKLRKELCH  414



>gb|KJB07238.1| hypothetical protein B456_001G009800 [Gossypium raimondii]
Length=487

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 162/246 (66%), Gaps = 19/246 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQ--VDP-LsnfsssfvdssDIEIER--RERKGWKVKIHDLSGS  647
            NI QP+FSCKFS DR +   + P  SN +  ++ +   E ER  RERKGW V I+DLSGS
Sbjct  247  NISQPVFSCKFSADRSRSRSLPPNFSNKNRGWMRTLAREKERQGRERKGWMVMIYDLSGS  306

Query  646  AVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSIC  467
             VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D + 
Sbjct  307  PVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPVDGLG  366

Query  466  CRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
             +F L++D GP  G  + ++E  +S +KGG F ID           V    S+   S+ S
Sbjct  367  YKFELVTDNGPSNG--VPIAEATMSVKKGGLFSID---------GRVSKSDSAASTSSRS  415

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRL  113
            P + GFVM   V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F R+L
Sbjct  416  P-IKGFVMGSTVEGEGKVSKPMVQVGIKHVTCMADAALFIALSAAIDLSMDACRLFSRKL  474

Query  112  RRGTRH  95
            R+   H
Sbjct  475  RKELCH  480



>gb|KHG26934.1| hypothetical protein F383_08453 [Gossypium arboreum]
Length=422

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 162/246 (66%), Gaps = 19/246 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQ--VDP-LsnfsssfvdssDIEIER--RERKGWKVKIHDLSGS  647
            NI QP+FSCKFS DR +   + P  SN +  ++ +   E ER  RERKGW V I+DLSGS
Sbjct  182  NISQPVFSCKFSADRSRSRSLPPNFSNKNRGWMRTLAREKERQGRERKGWMVMIYDLSGS  241

Query  646  AVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSIC  467
             VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D + 
Sbjct  242  PVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPVDGLG  301

Query  466  CRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
             +F L++D GP  G  + ++E  +S +KGG F ID           V    S+   S+ S
Sbjct  302  YKFELVTDNGPSNG--VPIAEATMSVKKGGLFCID---------RRVSKSDSAASTSSRS  350

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRL  113
            P + GFVM   V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F R+L
Sbjct  351  P-IKGFVMGSTVEGEGKVSKPMVQVGIQHVTCMADAALFIALSAAIDLSMDACRLFSRKL  409

Query  112  RRGTRH  95
            R+   H
Sbjct  410  RKELCH  415



>ref|XP_007012983.1| Uncharacterized protein TCM_037753 [Theobroma cacao]
 gb|EOY30602.1| Uncharacterized protein TCM_037753 [Theobroma cacao]
Length=416

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 154/246 (63%), Gaps = 22/246 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVD-PLsnfsssfvdssDIEIER----RERKGWKVKIHDLSGS  647
            NI+QP+FSCKFS DR +    P    + +      +  ER    RERKGW + I+DLSGS
Sbjct  179  NIRQPVFSCKFSADRSRSRSLPPDFTNKNRGWMRTLSGERERQGRERKGWMIMIYDLSGS  238

Query  646  AVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSIC  467
             VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D + 
Sbjct  239  PVAAASVITPFVPSPGSDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPIDGLG  298

Query  466  CRFHLLS-DGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
             +F L++ +GP  G  + ++E  +S +KGG+F ID                     S  S
Sbjct  299  YKFELVTENGPTNG--IPIAESTMSVKKGGQFCID------------KRVSRDSALSLRS  344

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRL  113
            P V GFVM   V+ EGK SK +VQ+ M+HVTC+ DAA+F+AL+AA+DLS++ACR F R+L
Sbjct  345  P-VKGFVMGSTVEAEGKVSKPVVQVGMQHVTCMADAALFIALSAAIDLSMDACRLFSRKL  403

Query  112  RRGTRH  95
            R+   H
Sbjct  404  RKELCH  409



>emb|CDY06823.1| BnaC01g09220D [Brassica napus]
Length=425

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 147/245 (60%), Gaps = 22/245 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            NIKQP+FSCKFS DR  +   L +  +                   + RERKGW + IHD
Sbjct  182  NIKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWMITIHD  241

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  242  LSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWRERGAV  301

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L++D       + ++E  +S ++GG+F ID                  G+  
Sbjct  302  DGLGYKFELVTDNTSTSTGVPIAEGTMSTKQGGKFIID------------RRVSGQGESP  349

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            A S  V GFVM   V+GEGK SK +V +  +HVTC+ DAA+F+AL+AAVDLS++AC+ F 
Sbjct  350  ARSSPVKGFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFS  409

Query  121  RRLRR  107
            R+LR+
Sbjct  410  RKLRK  414



>gb|KDP33775.1| hypothetical protein JCGZ_07346 [Jatropha curcas]
Length=422

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 160/250 (64%), Gaps = 25/250 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdss------DIEIER--RERKGWKVKIHDL  656
            NI+QP+FSCKFS DR  +   L +  +   ++         E ER  RERKGW + I+DL
Sbjct  179  NIRQPVFSCKFSADRNARSRSLPSDFTLNNNNRGWRRTFTGEKERAGRERKGWMIMIYDL  238

Query  655  SGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRD  476
            SGS VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D
Sbjct  239  SGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPID  298

Query  475  SICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDF  302
             +  +F L++D  GP  G  + ++E  +S  KGG+F ID+              + SG  
Sbjct  299  GLGYKFELVTDNGGPSRG--IPIAEATLSVRKGGQFCIDS-----------RIMKDSGLN  345

Query  301  SALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF  122
            S+ SP V GFVM   V+GEGK SK +VQ+ M+HVTC+ DAA+F+AL+AA+DLS++AC+ F
Sbjct  346  SSRSP-VKGFVMDSTVEGEGKVSKPVVQVGMQHVTCMADAALFIALSAAIDLSMDACQLF  404

Query  121  -RRLRRGTRH  95
              +LR+   H
Sbjct  405  SHKLRKELCH  414



>ref|XP_009602498.1| PREDICTED: uncharacterized protein LOC104097612 [Nicotiana tomentosiformis]
Length=418

 Score =   199 bits (505),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 149/236 (63%), Gaps = 21/236 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVD--PLsnfsssfvdssDIEIER----RERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +    P      +         ER    RERKGW + I+DLSG
Sbjct  181  NIRQPVFSCKFSADRNNRTRSLPTDFNLGNRGWMRTFSAERDRPGRERKGWMIIIYDLSG  240

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            SAVAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D +
Sbjct  241  SAVAAASVITPFVPSPGSDRVSRSNPGAWLILRPNGSCVSSWKPWGRLEAWRERGPVDGL  300

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L++D     G + ++E  +S ++GG+F ID   +  A              S+LS
Sbjct  301  GYKFELVTDIGLTSG-VPIAEGTMSMKRGGQFCIDNTVKDSA-------------LSSLS  346

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF  122
            P+  GFVM   V+GEGK S   VQ+ +RHVTC+ DAA+F+AL+AA+DLS++ACR F
Sbjct  347  PIR-GFVMGSSVEGEGKPSAPTVQVGVRHVTCMADAALFIALSAAIDLSMDACRLF  401



>gb|KDO55858.1| hypothetical protein CISIN_1g017474mg [Citrus sinensis]
Length=371

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 156/249 (63%), Gaps = 23/249 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssD---------IEIERRERKGWKVKIHD  659
            NI+QP+FSCKFS DR  +   L +  ++   SS           E   RERKGW + I+D
Sbjct  128  NIRQPVFSCKFSADRNSRSRCLPSDFTNNNGSSRGWMRTFSGDRERSGRERKGWMIMIYD  187

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  
Sbjct  188  LSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGFSVSSWKPWGRLEAWRERGAV  247

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L++D       + ++E  +S +KGG+F ID+     +              +
Sbjct  248  DGLGYKFELVTDSTGPNSRISIAEATLSVKKGGKFCIDSRITRESL------------LN  295

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            + SP V GFVM   V+GEGK SK +V++ ++HVTC+ DAA+F+AL+AA+DLS++ACR F 
Sbjct  296  SRSP-VKGFVMGSTVEGEGKVSKPVVEVGVQHVTCMADAALFIALSAAIDLSMDACRLFS  354

Query  121  RRLRRGTRH  95
             +LR+   H
Sbjct  355  HKLRKELCH  363



>gb|KFK29490.1| hypothetical protein AALP_AA7G141200 [Arabis alpina]
Length=424

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 149/249 (60%), Gaps = 23/249 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            NIKQP+FSCKFS DR  +   L +  +                   + RERKGW + IHD
Sbjct  182  NIKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWMTRTLSGDQWEKKQARERKGWMITIHD  241

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  242  LSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWRERGTI  301

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L+SD     G + +++  +S ++GG+F ID                  G+  
Sbjct  302  DGLGYKFELVSDNSTSTG-IPIAQGTMSTKQGGKFSID------------RRVSGQGESP  348

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            A S  V GFVM   V+GEGK SK +V +  +HVTC+ DAA+F+AL+AAVDLS++AC+ F 
Sbjct  349  ARSSPVKGFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFS  408

Query  121  RRLRRGTRH  95
            R+LR+   H
Sbjct  409  RKLRKELCH  417



>ref|XP_008458969.1| PREDICTED: uncharacterized protein LOC103498220 [Cucumis melo]
Length=421

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/250 (47%), Positives = 155/250 (62%), Gaps = 26/250 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvds----sDIEIER----RERKGWKVKIHDL  656
            NI+QP+FSCKFS DR  +   L +  S              ER    RERKGW + ++DL
Sbjct  179  NIRQPVFSCKFSADRNSRTRSLPSDFSFNSTKGKWMRTFSGEREKPGRERKGWMIMVYDL  238

Query  655  SGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRD  476
            SGS VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D
Sbjct  239  SGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPID  298

Query  475  SICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS-  299
             +  +F L++D     G + ++E  +S +KGG+F ID                   DF+ 
Sbjct  299  GLGYKFELVADSGLATG-IPIAEATMSVKKGGQFCIDRKTVR--------------DFTT  343

Query  298  -ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF  122
             + S V G FVM+  V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F
Sbjct  344  NSKSTVKGSFVMASSVEGEGKVSKPIVQVGVQHVTCMADAALFVALSAAIDLSMDACRHF  403

Query  121  -RRLRRGTRH  95
             ++LRR   H
Sbjct  404  TQKLRRELCH  413



>ref|XP_002965215.1| hypothetical protein SELMODRAFT_230537 [Selaginella moellendorffii]
 gb|EFJ34053.1| hypothetical protein SELMODRAFT_230537 [Selaginella moellendorffii]
Length=436

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 134/249 (54%), Positives = 168/249 (67%), Gaps = 16/249 (6%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             I QP+FSCKFS+DR+ +         S         ER+ERKGW + IHDLSGS VAAA
Sbjct  187  KITQPLFSCKFSRDRLSRSS--GAGKWSGPLGGHDHKERKERKGWLIMIHDLSGSPVAAA  244

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
             + TPFVPS G D V RSNPGAWLI+RPD    +SW+PWG+LEAW+ERG +  +  RF L
Sbjct  245  SMVTPFVPSAGSDRVSRSNPGAWLILRPDSTSGDSWEPWGRLEAWKERGSKGGLGLRFQL  304

Query  451  LSD----GPEGGGDLLMSEILISAEKGGEFYIDTDK----QvraaaspvpsprsSGDFSA  296
            +++    G    G  L+SE +IS+  GGEF IDT +        A +PV SPRSSGD + 
Sbjct  305  VAENGGGGTANVGGALVSETVISSHSGGEFSIDTARFRPATPSPARTPVQSPRSSGDCNF  364

Query  295  LS---PVVGGFVMSCRVQGEGKYS--KLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            ++   P  GGFVMSC  +GE + S  + LVQLAMRH+TC EDAA+FMALAAAVDLSI+AC
Sbjct  365  INVGLPASGGFVMSCTTRGERQSSSGRPLVQLAMRHITCAEDAAVFMALAAAVDLSIDAC  424

Query  130  RPF-RRLRR  107
            +PF R+LR+
Sbjct  425  QPFSRKLRK  433



>ref|XP_002962295.1| hypothetical protein SELMODRAFT_77561 [Selaginella moellendorffii]
 gb|EFJ37555.1| hypothetical protein SELMODRAFT_77561 [Selaginella moellendorffii]
Length=436

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 134/249 (54%), Positives = 168/249 (67%), Gaps = 16/249 (6%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
             I QP+FSCKFS+DR+ +         S         ER+ERKGW + IHDLSGS VAAA
Sbjct  187  KITQPLFSCKFSRDRLSRSS--GAGKWSGPLGGHDHKERKERKGWLIMIHDLSGSPVAAA  244

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
             + TPFVPS G D V RSNPGAWLI+RPD    +SW+PWG+LEAW+ERG +  +  RF L
Sbjct  245  SMVTPFVPSAGSDRVSRSNPGAWLILRPDSTSGDSWEPWGRLEAWKERGSKGGLGLRFQL  304

Query  451  LSD----GPEGGGDLLMSEILISAEKGGEFYIDTDK----QvraaaspvpsprsSGDFSA  296
            +++    G    G  L+SE +IS+  GGEF IDT +        A +PV SPRSSGD + 
Sbjct  305  VAENGGGGTANVGGALVSETVISSHSGGEFSIDTARFRPATPSPARTPVQSPRSSGDCNF  364

Query  295  LS---PVVGGFVMSCRVQGEGKYS--KLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            ++   P  GGFVMSC  +GE + S  + LVQLAMRH+TC EDAA+FMALAAAVDLSI+AC
Sbjct  365  INVGLPASGGFVMSCTTRGERQSSSGRPLVQLAMRHITCAEDAAVFMALAAAVDLSIDAC  424

Query  130  RPF-RRLRR  107
            +PF R+LR+
Sbjct  425  QPFSRKLRK  433



>ref|XP_004287493.1| PREDICTED: uncharacterized protein LOC101301714 [Fragaria vesca 
subsp. vesca]
Length=421

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/244 (48%), Positives = 155/244 (64%), Gaps = 23/244 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDR---VQQVDPLsnfsssfvdssDIEIER----RERKGWKVKIHDLS  653
            +I+QP+FSCKFS DR    + + P     ++         ER    RERKGW + IHDLS
Sbjct  181  DIQQPVFSCKFSADRNSRFRSLPPDFTSKNNRGWRRTFSGERERPGRERKGWMITIHDLS  240

Query  652  GSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDS  473
            GS VAAA + TPFVPS G D V RSNPGAWLI+RP      +W+PWG+LEAWRERG  D 
Sbjct  241  GSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGFSVNNWKPWGRLEAWRERGPVDG  300

Query  472  ICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSA  296
            +  +F L++D GP     + ++E  +S +KGGEF ID+              R  G   +
Sbjct  301  LGYKFELVTDNGPS--SSITIAEATLSMKKGGEFCIDS-----------RLLRDQGLNYS  347

Query  295  LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-R  119
             SP V GFVM   V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++AC+ F  
Sbjct  348  RSP-VKGFVMGSSVEGEGKVSKPMVQVGVQHVTCMADAALFVALSAAIDLSMDACKLFSH  406

Query  118  RLRR  107
            +LR+
Sbjct  407  KLRK  410



>ref|XP_009766756.1| PREDICTED: uncharacterized protein LOC104218054 [Nicotiana sylvestris]
Length=418

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 150/238 (63%), Gaps = 21/238 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVD--PLsnfsssfvdssDIEIER----RERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +    P      +         ER    RERKGW + I+DLSG
Sbjct  181  NIRQPVFSCKFSADRNNRTRSLPTDFNLGNRGWMRTFSAERDRPGRERKGWMIIIYDLSG  240

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            SAVAAA + TPFVPS G D V RSNPGAWLI++P+     SW+PWG+LEAWRERG  D +
Sbjct  241  SAVAAASVITPFVPSPGSDRVSRSNPGAWLILQPNGSCVSSWKPWGRLEAWRERGPVDGL  300

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L++D     G + ++E  +S +KGG+F ID   +  A              S+LS
Sbjct  301  GYKFELVTDIGLTSG-VPIAEGTMSMKKGGQFCIDNTIKDSA-------------LSSLS  346

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRR  116
            P+  GFVM   V+GEGK S   VQ+ +RHVTC+ DAA+F+AL+AA+DLS++ACR F +
Sbjct  347  PIR-GFVMGSSVEGEGKPSAPTVQVGVRHVTCMADAALFIALSAAIDLSMDACRLFSQ  403



>ref|XP_004141026.1| PREDICTED: uncharacterized protein LOC101219082 [Cucumis sativus]
Length=421

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 153/248 (62%), Gaps = 22/248 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvds----sDIEIER----RERKGWKVKIHDL  656
            NI+QP+FSCKFS DR  +   L +  S              ER    RERKGW + ++DL
Sbjct  179  NIRQPVFSCKFSADRNSRTRSLPSDFSFNSTKGKWMRTFSGEREKPGRERKGWMIMVYDL  238

Query  655  SGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRD  476
            SGS VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D
Sbjct  239  SGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPID  298

Query  475  SICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSA  296
             +  +F L++D     G + ++E  +S +KGG+F ID                     ++
Sbjct  299  GLGYKFELVADTGLATG-IPIAEATMSVKKGGQFCIDRKTVRDLT------------INS  345

Query  295  LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-R  119
             S V G FVM+  V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F +
Sbjct  346  KSTVKGSFVMASSVEGEGKVSKPIVQVGVQHVTCMADAALFVALSAAIDLSMDACRHFTQ  405

Query  118  RLRRGTRH  95
            +LRR   H
Sbjct  406  KLRRELCH  413



>gb|KGN60567.1| hypothetical protein Csa_2G000750 [Cucumis sativus]
Length=421

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 153/248 (62%), Gaps = 22/248 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvds----sDIEIER----RERKGWKVKIHDL  656
            NI+QP+FSCKFS DR  +   L +  S              ER    RERKGW + ++DL
Sbjct  179  NIRQPVFSCKFSADRNSRTRSLPSDFSFNSTKGKWMRTFSGEREKPGRERKGWMIMVYDL  238

Query  655  SGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRD  476
            SGS VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D
Sbjct  239  SGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPID  298

Query  475  SICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSA  296
             +  +F L++D     G + ++E  +S +KGG+F ID                     ++
Sbjct  299  GLGYKFELVADTGLATG-IPIAEATMSVKKGGQFCIDRKTVRDLT------------INS  345

Query  295  LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-R  119
             S V G FVM+  V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F +
Sbjct  346  KSTVKGSFVMASSVEGEGKVSKPIVQVGVQHVTCMADAALFVALSAAIDLSMDACRHFTQ  405

Query  118  RLRRGTRH  95
            +LRR   H
Sbjct  406  KLRRELCH  413



>ref|XP_010438312.1| PREDICTED: uncharacterized protein LOC104721933 [Camelina sativa]
Length=425

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 149/249 (60%), Gaps = 23/249 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            N+KQP+FSCKFS DR  +   L +  +                   + RERKGW + IHD
Sbjct  183  NLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWMITIHD  242

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  243  LSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWRERGAI  302

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L+ D     G + ++E  +S ++GG+F ID                  G+  
Sbjct  303  DGLGYKFELVRDNSTSTG-IPIAEGTMSTKQGGKFSID------------RRVSGQGESP  349

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            A+S  V GFVM   V+GEGK SK +V +  +HVTC+ DAA+F+AL+AAVDLS++AC+ F 
Sbjct  350  AISSPVKGFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFS  409

Query  121  RRLRRGTRH  95
            R+LR+   H
Sbjct  410  RKLRKELCH  418



>ref|XP_010433108.1| PREDICTED: uncharacterized protein LOC104717264 [Camelina sativa]
Length=425

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 149/249 (60%), Gaps = 23/249 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            N+KQP+FSCKFS DR  +   L +  +                   + RERKGW + IHD
Sbjct  183  NLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWMITIHD  242

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  243  LSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWRERGAI  302

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L+ D     G + ++E  +S ++GG+F ID                  G+  
Sbjct  303  DGLGYKFELVRDNSTSTG-IPIAEGTMSTKQGGKFSID------------RRVSGQGESP  349

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            A+S  V GFVM   V+GEGK SK +V +  +HVTC+ DAA+F+AL+AAVDLS++AC+ F 
Sbjct  350  AISSPVKGFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFS  409

Query  121  RRLRRGTRH  95
            R+LR+   H
Sbjct  410  RKLRKELCH  418



>ref|XP_002283391.1| PREDICTED: uncharacterized protein LOC100245695 [Vitis vinifera]
Length=417

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 160/247 (65%), Gaps = 23/247 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvd----ssDIEIER--RERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +   L++  +S       S   E ER  RERKGW + I+DLSG
Sbjct  179  NIRQPVFSCKFSADRNSRSRSLASDFNSNNRGWMRSFSNERERPGRERKGWMIMIYDLSG  238

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VA+A + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D +
Sbjct  239  SPVASASMITPFVPSPGSDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPIDGL  298

Query  469  CCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSAL  293
              +F L++D GP  G  + ++E  ++ ++GG+F ID+                    S+L
Sbjct  299  GYKFELVTDSGPTSG--IPIAESTMNIKRGGQFCIDS------------RIMRDSTLSSL  344

Query  292  SPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RR  116
             P+  GFVM   V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F R+
Sbjct  345  LPLR-GFVMGSTVEGEGKVSKPVVQVGVQHVTCMADAALFIALSAAIDLSMDACRLFSRK  403

Query  115  LRRGTRH  95
            LR+   H
Sbjct  404  LRKELCH  410



>ref|NP_194660.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB79689.1| putative protein [Arabidopsis thaliana]
 gb|AAM13213.1| unknown protein [Arabidopsis thaliana]
 gb|AAO30065.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85617.1| uncharacterized protein AT4G29310 [Arabidopsis thaliana]
Length=424

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 149/249 (60%), Gaps = 23/249 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            N+KQP+FSCKFS DR  +   L +  +                   + RERKGW + IHD
Sbjct  182  NLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWMITIHD  241

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  242  LSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWRERGAI  301

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L+ D     G + ++E  +S ++GG+F ID                  G+  
Sbjct  302  DGLGYKFELVRDNSTSTG-IPIAEGTMSTKQGGKFSID------------RRVSGQGESP  348

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            A+S  V GFVM   V+GEGK SK +V +  +HVTC+ DAA+F+AL+AAVDLS++AC+ F 
Sbjct  349  AISSPVKGFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFS  408

Query  121  RRLRRGTRH  95
            R+LR+   H
Sbjct  409  RKLRKELCH  417



>ref|XP_002867413.1| hypothetical protein ARALYDRAFT_913577 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43672.1| hypothetical protein ARALYDRAFT_913577 [Arabidopsis lyrata subsp. 
lyrata]
Length=424

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 149/249 (60%), Gaps = 23/249 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            N+KQP+FSCKFS DR  +   L +  +                   + RERKGW + IHD
Sbjct  182  NLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWMITIHD  241

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  242  LSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWRERGAI  301

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L+ D     G + ++E  +S ++GG+F ID                  G+  
Sbjct  302  DGLGYKFELVRDNSTSTG-IPIAEGTMSTKQGGKFSID------------RRVSGQGESP  348

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            A+S  V GFVM   V+GEGK SK +V +  +HVTC+ DAA+F+AL+AAVDLS++AC+ F 
Sbjct  349  AISSPVKGFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFS  408

Query  121  RRLRRGTRH  95
            R+LR+   H
Sbjct  409  RKLRKELCH  417



>ref|XP_007152956.1| hypothetical protein PHAVU_004G174300g [Phaseolus vulgaris]
 gb|ESW24950.1| hypothetical protein PHAVU_004G174300g [Phaseolus vulgaris]
Length=420

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 151/247 (61%), Gaps = 23/247 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssf------vdssDIEIERRERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +   L +   +             E   RERKGW V IHDLSG
Sbjct  182  NIRQPVFSCKFSADRNSRSRSLPSDFGNNPSRWRRSLKGVRERHGRERKGWMVTIHDLSG  241

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D +
Sbjct  242  SPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGASVSSWKPWGRLEAWRERGPIDGL  301

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L+++   G G + ++E  ++ +KGG+F ID                   D    S
Sbjct  302  GYKFELVAENGPGNG-IPIAEATMNVKKGGQFCIDYKVMR--------------DSGLSS  346

Query  289  PVVG-GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RR  116
             + G GFVM   V+GEGK SK LVQ+  +HVTC+ DAA+F+AL+AA+DLS++AC+ F  +
Sbjct  347  RLPGKGFVMGSSVEGEGKVSKPLVQVGAQHVTCMADAALFIALSAAIDLSMDACQLFSHK  406

Query  115  LRRGTRH  95
            LR+   H
Sbjct  407  LRKELCH  413



>ref|XP_010447867.1| PREDICTED: uncharacterized protein LOC104730404 [Camelina sativa]
Length=474

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 148/245 (60%), Gaps = 23/245 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            N+KQP+FSCKFS DR  +   L +  +                   + RERKGW + IHD
Sbjct  232  NLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWMITIHD  291

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  292  LSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWRERGAI  351

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L+ D     G + ++E  +S ++GG+F ID                  G+  
Sbjct  352  DGLGYKFELVRDNSTSTG-IPIAEGTMSTKQGGKFSID------------RRVSGQGESP  398

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            A+S  V GFVM   V+GEGK SK +V +  +HVTC+ DAA+F+AL+AAVDLS++AC+ F 
Sbjct  399  AISSPVKGFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFS  458

Query  121  RRLRR  107
            R+LR+
Sbjct  459  RKLRK  463



>ref|XP_002992680.1| hypothetical protein SELMODRAFT_135747 [Selaginella moellendorffii]
 gb|EFJ06265.1| hypothetical protein SELMODRAFT_135747 [Selaginella moellendorffii]
Length=435

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 171/246 (70%), Gaps = 16/246 (7%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +++QPIFSCKFS+DR       S   +        E ER+ERKGW V IHDLSGS VAAA
Sbjct  187  SLRQPIFSCKFSRDRNTPAKSWSTSLTGDR-----ERERKERKGWLVMIHDLSGSPVAAA  241

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
             I TPFVPS+G D+V RSNPGAWLI+RPD    +SW+PWG+LEAWRE+G +  +  RF L
Sbjct  242  SIVTPFVPSSGSDYVSRSNPGAWLILRPDSTGVDSWEPWGRLEAWREKGGKGGLGLRFQL  301

Query  451  LSDG---PEGGGDLLMSEILISAEKGGEFYIDTDK---QvraaaspvpsprsSGD-FSAL  293
            +++G      G  +L+SE +IS + GGEF IDT +   +  +++S   SP SSGD F  L
Sbjct  302  VAEGGGITSVGSGILVSETVISTQSGGEFSIDTVRLRVEAASSSSSTESPHSSGDGFLGL  361

Query  292  S-PVVGGFVMSCRVQGE-GKYSK-LLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF  122
               V GGFVMSC V GE  K +K   +Q+A+RHVTCVEDAA+FMALAAA DLS++AC+PF
Sbjct  362  GFQVAGGFVMSCPVHGERNKTNKGRCIQMAVRHVTCVEDAAVFMALAAAADLSMDACQPF  421

Query  121  -RRLRR  107
             R+LRR
Sbjct  422  SRKLRR  427



>ref|XP_002980096.1| hypothetical protein SELMODRAFT_111932 [Selaginella moellendorffii]
 gb|EFJ18966.1| hypothetical protein SELMODRAFT_111932 [Selaginella moellendorffii]
Length=435

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 171/246 (70%), Gaps = 16/246 (7%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            +++QPIFSCKFS+DR       S   +        E ER+ERKGW V IHDLSGS VAAA
Sbjct  187  SLRQPIFSCKFSRDRNTPAKSWSTPLTGDR-----ERERKERKGWLVMIHDLSGSPVAAA  241

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHL  452
             I TPFVPS+G D+V RSNPGAWLI+RPD    +SW+PWG+LEAWRE+G +  +  RF L
Sbjct  242  SIVTPFVPSSGSDYVSRSNPGAWLILRPDSTGVDSWEPWGRLEAWREKGGKGGLGLRFQL  301

Query  451  LSDG---PEGGGDLLMSEILISAEKGGEFYIDTDK---QvraaaspvpsprsSGD-FSAL  293
            +++G      G  +L+SE +IS + GGEF IDT +   +  +++S   SP SSGD F  L
Sbjct  302  VAEGGGITSVGSGILVSETVISTQSGGEFSIDTVRLRVEAASSSSSTESPHSSGDGFLGL  361

Query  292  S-PVVGGFVMSCRVQGE-GKYSK-LLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF  122
               V GGFVMSC V GE  K +K   +Q+A+RHVTCVEDAA+FMALAAA DLS++AC+PF
Sbjct  362  GFQVAGGFVMSCPVHGERNKTNKGRCIQMAVRHVTCVEDAAVFMALAAAADLSMDACQPF  421

Query  121  -RRLRR  107
             R+LRR
Sbjct  422  SRKLRR  427



>ref|XP_006283793.1| hypothetical protein CARUB_v10004884mg [Capsella rubella]
 gb|EOA16691.1| hypothetical protein CARUB_v10004884mg [Capsella rubella]
Length=424

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 148/249 (59%), Gaps = 23/249 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            N+KQP+FSCKFS DR  +   L +  +                   + RERKGW + IHD
Sbjct  182  NLKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWMITIHD  241

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  242  LSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWRERGAI  301

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L+ D     G+ + +E  +S + GG+F ID                  G+  
Sbjct  302  DGLGYKFELVRDNSTSTGNPI-AEGTMSTKLGGKFSID------------RRVSGQGESP  348

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            A+S  V GFVM   V+GEGK SK +V +  +HVTC+ DAA+F+AL+AAVDLS++AC+ F 
Sbjct  349  AISSPVKGFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFS  408

Query  121  RRLRRGTRH  95
            R+LR+   H
Sbjct  409  RKLRKELCH  417



>ref|XP_011093657.1| PREDICTED: uncharacterized protein LOC105173566 [Sesamum indicum]
Length=419

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 155/242 (64%), Gaps = 22/242 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvd--ssDIEIER----RERKGWKVKIHDLSG  650
            NI+QP+FSCKFS +R  ++  L +  +            E+    RERKGW + ++DLSG
Sbjct  182  NIRQPVFSCKFSAERSNRLRSLPSDFNINNRGWMRTFAGEKGRVGRERKGWMIIVYDLSG  241

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            SAVAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D +
Sbjct  242  SAVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGVSISSWKPWGRLEAWRERGPVDGL  301

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L+++     G + ++E  ++ +KGG F ID  ++  A              S LS
Sbjct  302  GYKFELITNNGLTSG-VPIAEGTMNIKKGGRFCIDNSRKDSA-------------LSFLS  347

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRL  113
            PV  GFVM   V+GEGK SK +VQ+ ++HVTC  DAA+F+AL+AAVDLS++ACR F  +L
Sbjct  348  PVR-GFVMGSSVEGEGKVSKPVVQVGVQHVTCTADAALFVALSAAVDLSMDACRLFSHKL  406

Query  112  RR  107
            R+
Sbjct  407  RK  408



>ref|XP_006451341.1| hypothetical protein CICLE_v10008480mg [Citrus clementina]
 gb|ESR64581.1| hypothetical protein CICLE_v10008480mg [Citrus clementina]
Length=409

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 156/249 (63%), Gaps = 23/249 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssD---------IEIERRERKGWKVKIHD  659
            NI+QP+FSCKFS DR  +   L +  ++   SS           E   RERKGW + I+D
Sbjct  166  NIRQPVFSCKFSADRNSRSRCLPSDFTNNNGSSRGWMRTFSGDRERSGRERKGWMIMIYD  225

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  
Sbjct  226  LSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGFSVSSWKPWGRLEAWRERGAV  285

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L++D       + ++E  +S +KGG+F ID+     +              +
Sbjct  286  DGLGYKFELVTDSTGPNSRISIAEATLSVKKGGKFCIDSRITRESL------------LN  333

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            + SP V GFVM   V+GEGK SK +V++ ++HVTC+ DAA+F+AL+AA+DLS++ACR F 
Sbjct  334  SRSP-VKGFVMGSTVEGEGKVSKPVVEVGVQHVTCMADAALFIALSAAIDLSMDACRLFS  392

Query  121  RRLRRGTRH  95
             +LR+   H
Sbjct  393  HKLRKELCH  401



>ref|XP_006412853.1| hypothetical protein EUTSA_v10025288mg [Eutrema salsugineum]
 gb|ESQ54306.1| hypothetical protein EUTSA_v10025288mg [Eutrema salsugineum]
Length=424

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 147/245 (60%), Gaps = 23/245 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            NIKQP+FSCKFS DR  +   L +  +                   + RERKGW + IHD
Sbjct  182  NIKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQGRERKGWMITIHD  241

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  242  LSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWRERGAI  301

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L+ D     G + ++E  ++ ++GG+F ID                  G+  
Sbjct  302  DGLGYKFELVRDNSTSTG-IPIAEGTMNTKQGGKFSID------------RRVSGQGESP  348

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            A S  V GFVM   V+GEGK SK +V +  +HVTC+ DAA+F+AL+AAVDLS++AC+ F 
Sbjct  349  ARSSPVKGFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFS  408

Query  121  RRLRR  107
            R+LR+
Sbjct  409  RKLRK  413



>dbj|BAJ98408.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 135/246 (55%), Positives = 159/246 (65%), Gaps = 20/246 (8%)
 Frame = -3

Query  802  QPIFSCKFSQD--RVQQVDPL-----snfsssfvdssDIEIERRERKGWKVKIHDLSGSA  644
            QPIFSCKF +D  R  Q D L     S+  S     +++   RRERKGWKV IHDLSGSA
Sbjct  176  QPIFSCKFIRDVRRATQPDHLGGKYWSSSGSGEEKETEMAGRRRERKGWKVAIHDLSGSA  235

Query  643  VAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPC-MRESWQPWGKLEAWRE----RGIR  479
            VAAAF+ TPFVP+TG D V RSNPGAWLIVR D     ESWQPWG+LEAWRE     G +
Sbjct  236  VAAAFMATPFVPATGSDTVARSNPGAWLIVRADTTGSSESWQPWGRLEAWRECAAPAGSK  295

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D++C R HLL +  +    +L+SE  +S +KGGEF ID D+        V S   S  + 
Sbjct  296  DAVCLRLHLLPERRDAC--VLVSETPLSCDKGGEFSIDMDRHSILPEDAVASAAPSSSYC  353

Query  298  AL----SPVVGGFVMSCRVQGEGKYSKL--LVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
            A     S   GGFVMSC VQGE   S    LV LA RHV C+EDAA+F+ALAAAVDLS++
Sbjct  354  AASMGESCAGGGFVMSCSVQGEAATSSRPPLVHLAARHVMCMEDAAMFLALAAAVDLSVK  413

Query  136  ACRPFR  119
            ACRPFR
Sbjct  414  ACRPFR  419



>ref|XP_003525292.1| PREDICTED: uncharacterized protein LOC100785838 [Glycine max]
Length=423

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 148/243 (61%), Gaps = 22/243 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssf------vdssDIEIERRERKGWKVKIHDLSG  650
            NI+QPIFSCKFS DR  +   L +  +          + + E + R+RKGW + IHDLSG
Sbjct  184  NIRQPIFSCKFSADRNYRSRSLPSDFTKNRSGWRRSTTGEKEHQGRDRKGWMIMIHDLSG  243

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D +
Sbjct  244  SPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASESSWKPWGRLEAWRERGPVDGL  303

Query  469  CCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSAL  293
              +  L SD GP     + ++E  +S +KGG+F ID                      + 
Sbjct  304  GYKVELFSDNGP--ANRIPIAEGTMSVKKGGQFCID------------YKVMKDAGLGSR  349

Query  292  SPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RR  116
             P   GFVM   V GEGK SK +VQ+  +HVTC+ DAA+F+AL+A+VDLS++ACR F  +
Sbjct  350  LPGEEGFVMGSTVDGEGKVSKPVVQVGAQHVTCMADAALFIALSASVDLSMDACRLFSHK  409

Query  115  LRR  107
            LR+
Sbjct  410  LRK  412



>emb|CDY48610.1| BnaA01g07550D [Brassica napus]
Length=424

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 147/245 (60%), Gaps = 23/245 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            NIKQP+FSCKFS DR  +   L +  +                   + RERKGW + IHD
Sbjct  182  NIKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWMITIHD  241

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  242  LSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWRERGAV  301

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L+++     G + ++E  ++  +GG+F ID                  G+  
Sbjct  302  DGLGYKFELVTNNSTSTG-VPIAEGTMNTRQGGKFIID------------RRVSGQGESP  348

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            A S  V GFVM   V+GEGK SK +V +  +HVTC+ DAA+F+AL+AAVDLS++AC+ F 
Sbjct  349  ARSSPVKGFVMGSSVEGEGKVSKPVVHVGAQHVTCMADAALFVALSAAVDLSVDACQLFS  408

Query  121  RRLRR  107
            R+LR+
Sbjct  409  RKLRK  413



>ref|XP_008242466.1| PREDICTED: uncharacterized protein LOC103340798 [Prunus mume]
Length=420

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/248 (47%), Positives = 156/248 (63%), Gaps = 24/248 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDI-------EIERRERKGWKVKIHDLS  653
            +I+QP+FSCKFS DR  +   L +  +S  +   +       E   RERKGW + IHDLS
Sbjct  181  DIRQPVFSCKFSADRNSRFRSLQSDFTSMNNRGWMGTFSGDRERPGRERKGWMITIHDLS  240

Query  652  GSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDS  473
            GS VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D 
Sbjct  241  GSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGFNVSSWKPWGRLEAWRERGPIDG  300

Query  472  ICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSA  296
            +  +F L++D GP     + ++E  +S +KGG+F ID+     +A             ++
Sbjct  301  LGYKFELVTDNGPS--SSITIAEGTMSVKKGGQFCIDSSLMRDSA------------LNS  346

Query  295  LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-R  119
             SP V GFVM   V+GEGK SK  VQ+  +HVTC+ DAA+F+AL+AA+DLS+++CR F  
Sbjct  347  RSP-VKGFVMGSTVEGEGKVSKPSVQVGAQHVTCMADAALFVALSAAIDLSMDSCRLFSH  405

Query  118  RLRRGTRH  95
            +LR+   H
Sbjct  406  KLRKELCH  413



>ref|XP_003530524.1| PREDICTED: uncharacterized protein LOC100811541 isoform X1 [Glycine 
max]
 ref|XP_006584805.1| PREDICTED: uncharacterized protein LOC100811541 isoform X2 [Glycine 
max]
Length=424

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/247 (46%), Positives = 149/247 (60%), Gaps = 22/247 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssf------vdssDIEIERRERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +   L +  +          + + E + R+RKGW + IHDLSG
Sbjct  185  NIRQPVFSCKFSADRNYRSRSLPSDFTKNRSGWRRSSTGEKEHQGRDRKGWMIMIHDLSG  244

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D +
Sbjct  245  SPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASESSWKPWGRLEAWRERGPVDGL  304

Query  469  CCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSAL  293
              +  L SD GP     + ++E  +S +KGG+F ID                      + 
Sbjct  305  GYKVELFSDNGP--ANRIPIAEGTMSVKKGGQFCID------------YKVIKDAGLGSR  350

Query  292  SPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RR  116
             P   GFVM   V GEGK SK +VQ+  +HVTC+ DAA+F+AL+AA+DLS++ACR F  +
Sbjct  351  LPGEEGFVMGSTVDGEGKVSKPVVQVGAQHVTCMADAALFIALSAAIDLSMDACRLFSHK  410

Query  115  LRRGTRH  95
            LR+   H
Sbjct  411  LRKELCH  417



>ref|XP_007202154.1| hypothetical protein PRUPE_ppa006267mg [Prunus persica]
 gb|EMJ03353.1| hypothetical protein PRUPE_ppa006267mg [Prunus persica]
Length=420

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 157/248 (63%), Gaps = 24/248 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI-----ER--RERKGWKVKIHDLS  653
            +I+QP+FSCKFS DR  +   L +  +S  +   +       ER  RERKGW + IHDLS
Sbjct  181  DIRQPVFSCKFSADRNSRFRSLQSDFTSMNNRGWMRTFSGDRERPGRERKGWMITIHDLS  240

Query  652  GSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDS  473
            GS VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D 
Sbjct  241  GSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGFSVSSWKPWGRLEAWRERGPIDG  300

Query  472  ICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSA  296
            +  +F L++D GP     + ++E  +S +KGG+F ID+     +A             ++
Sbjct  301  LGYKFELVTDNGPS--SSITIAEGTMSVKKGGQFCIDSSLMRDSA------------LNS  346

Query  295  LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-R  119
             SP V GFV    V+GEGK SK  VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F  
Sbjct  347  RSP-VKGFVTGSTVEGEGKVSKPSVQVGVQHVTCMADAALFVALSAAIDLSMDACRLFSH  405

Query  118  RLRRGTRH  95
            +LR+   H
Sbjct  406  KLRKELCH  413



>ref|XP_009352575.1| PREDICTED: uncharacterized protein LOC103943924 [Pyrus x bretschneideri]
Length=420

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/249 (47%), Positives = 155/249 (62%), Gaps = 25/249 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdss--------DIEIERRERKGWKVKIHDL  656
            +I+QP+FSCKFS DR  +   L +  S+  ++         D E   RERKGW + IHDL
Sbjct  180  DIRQPVFSCKFSADRNSRNRSLQSDYSTINNNRGWMRTLSGDTEKPWRERKGWMITIHDL  239

Query  655  SGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRD  476
            SGS VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D
Sbjct  240  SGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSISSWKPWGRLEAWRERGPID  299

Query  475  SICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
             +  +F L++D GP     + ++E  +S +KGG+F ID+                     
Sbjct  300  GLGYKFELVTDNGPS--SSITIAEGTLSVKKGGQFCIDS------------RLNRDSGLK  345

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            + SP V GFV    V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F 
Sbjct  346  SRSP-VKGFVTGSTVEGEGKVSKPVVQVGVQHVTCMADAALFVALSAAIDLSMDACRLFS  404

Query  121  RRLRRGTRH  95
             +LR+   H
Sbjct  405  HKLRKELCH  413



>ref|XP_010688362.1| PREDICTED: uncharacterized protein LOC104902329 [Beta vulgaris 
subsp. vulgaris]
Length=426

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 154/249 (62%), Gaps = 28/249 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDI------------EIERRERKGWKVK  668
            NI+QP+FSCKFS DR  +   L    +   ++++             +   RERKGW + 
Sbjct  180  NIRQPVFSCKFSADRNSRSRSLPANFAISNNNNNNRKWMVRSLSGEKDKPARERKGWMIM  239

Query  667  IHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER  488
            I+DLSGS VAAA + TPFVPS G D V RSNPGAWLI+RP      +W+PWG+LEAWRER
Sbjct  240  IYDLSGSPVAAASVITPFVPSPGSDRVSRSNPGAWLILRPHGSHVNNWKPWGRLEAWRER  299

Query  487  GIRDSICCRFHLLS-DGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsS  311
            G  D +  +F L++ DGP   G + ++E  +S +KGG+F ID                  
Sbjct  300  GPVDGLGYKFELVTEDGPTRTG-IPIAEATMSIKKGGKFCIDKRDSSLE-----------  347

Query  310  GDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
             +    SPV  GFVM   V+GEGK SK LVQ+ M+HVTC+ DA +F+AL+AA+DLS++AC
Sbjct  348  -EVMVRSPVR-GFVMGSTVEGEGKISKPLVQVGMQHVTCMADAGLFVALSAAIDLSMDAC  405

Query  130  RPF-RRLRR  107
            R F ++LR+
Sbjct  406  RLFSQKLRK  414



>ref|XP_003620756.1| hypothetical protein MTR_6g090060 [Medicago truncatula]
 gb|AES76974.1| DUF1005 family protein [Medicago truncatula]
Length=423

 Score =   194 bits (492),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 112/246 (46%), Positives = 151/246 (61%), Gaps = 22/246 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssf------vdssDIEIERRERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +    +   ++          S  E   RERKGW + +HDLSG
Sbjct  186  NIRQPVFSCKFSADRNSRSRSNATDFANTPSRWKRALKSVQERHGRERKGWMITVHDLSG  245

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D +
Sbjct  246  SPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASVSSWKPWGRLEAWRERGHVDGL  305

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L+++       + ++E  ++ +KGG+F ID +                G  S L 
Sbjct  306  GYKFELVTE----NNGIPIAESTMNVKKGGQFCIDYN----------VMKEYYGLCSRLP  351

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRL  113
            P   GFVMS  V+GEGK SK  VQ+  +HVTC+ DAA+F+AL+AA+DLS++AC+ F  +L
Sbjct  352  P-GKGFVMSSSVEGEGKISKPFVQVGAQHVTCMADAALFVALSAAIDLSMDACQLFSHKL  410

Query  112  RRGTRH  95
            R+   H
Sbjct  411  RKELCH  416



>ref|XP_008799780.1| PREDICTED: uncharacterized protein LOC103714350 [Phoenix dactylifera]
Length=429

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/246 (49%), Positives = 155/246 (63%), Gaps = 26/246 (11%)
 Frame = -3

Query  808  IKQPIFSCKFSQDRVQQVD--PLsnfsssfv-----dssDIEIERRERKGWKVKIHDLSG  650
            ++QP+FSC+FS DR +     PL   SSS        S    + R +RKGW V IHDLSG
Sbjct  189  LRQPVFSCRFSADRRRNAGSGPLPPHSSSSSIRGWFGSERNHLRREQRKGWTVTIHDLSG  248

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPD--PCMRESWQPWGKLEAWRERGIRD  476
            S VAAA + TPFVPS G D V RSNPGAWLI+RP        +W+PWG+LEAWRERG  D
Sbjct  249  SPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPTGFSGSTPNWKPWGRLEAWRERGPVD  308

Query  475  SICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            ++  RF L++D GP GG  + ++E   S  KGG F ID D               +GD  
Sbjct  309  ALGYRFELVTDSGPSGG--IPIAESSFSVRKGGRFCIDPDP------------GVAGDTV  354

Query  298  ALS-PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF  122
            + S P VGGFVM+  V+GE K SK  VQ+  +HV+C+ D A+F+AL+AAVDLSI+AC+ F
Sbjct  355  SRSWPFVGGFVMAADVEGERKVSKPTVQVGAQHVSCMADVALFIALSAAVDLSIDACQLF  414

Query  121  -RRLRR  107
             ++LR+
Sbjct  415  SQKLRK  420



>ref|XP_008387423.1| PREDICTED: uncharacterized protein LOC103449874 [Malus domestica]
Length=418

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 155/247 (63%), Gaps = 23/247 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvd----ssDIEIER--RERKGWKVKIHDLSG  650
            +I+QP+FSCKFS DR  +   L +  ++       +   + ER  RERKGW + IHDLSG
Sbjct  180  DIRQPVFSCKFSADRNSRNRSLQSDFTTINRGWMRTPSADRERPGRERKGWMITIHDLSG  239

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D +
Sbjct  240  SPVAAASMITPFVASPGTDRVSRSNPGAWLILRPHGFSISSWKPWGRLEAWRERGPIDGL  299

Query  469  CCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSAL  293
              +F L++D GP     + ++E  +S +KGGEF ID+                    ++ 
Sbjct  300  GYKFELVTDNGPS--SSITIAEGTMSVKKGGEFCIDS------------RLNRDSGLNSR  345

Query  292  SPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RR  116
            SP V GFV    V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F  +
Sbjct  346  SP-VKGFVTGSTVEGEGKVSKPVVQVGVQHVTCMADAALFVALSAAIDLSMDACRLFSHK  404

Query  115  LRRGTRH  95
            LR+   H
Sbjct  405  LRKELCH  411



>ref|XP_008337614.1| PREDICTED: uncharacterized protein LOC103400735 [Malus domestica]
Length=418

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 154/247 (62%), Gaps = 23/247 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdss----DIEIER--RERKGWKVKIHDLSG  650
            +I+QP+FSCKFS DR  +   L +  ++  ++      +  E+  RERKGW + IHDLSG
Sbjct  180  DIRQPVFSCKFSADRNSRNRSLQSDYTTINNNRGWMRTLSGEKPWRERKGWMITIHDLSG  239

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D +
Sbjct  240  SPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSISSWKPWGRLEAWRERGPIDGL  299

Query  469  CCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSAL  293
              +F L++D GP     + ++E  +S +KGG+F ID+                     + 
Sbjct  300  GYKFELVTDNGPS--SSITIAEGTMSVKKGGQFCIDS------------RLNRDSGLKSR  345

Query  292  SPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RR  116
            SP V GFV    V+G GK SK +VQ+ ++HVTC  DAA+F+AL+AA+DLS++ACR F  +
Sbjct  346  SP-VKGFVTGSTVEGXGKVSKPVVQVGVQHVTCXADAALFVALSAAIDLSMDACRLFSHK  404

Query  115  LRRGTRH  95
            LRR   H
Sbjct  405  LRRELCH  411



>ref|XP_003530182.1| PREDICTED: uncharacterized protein LOC100790306 [Glycine max]
Length=429

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 148/247 (60%), Gaps = 22/247 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssf------vdssDIEIERRERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +   L +  +              E   RERKGW + IHDLSG
Sbjct  189  NIRQPVFSCKFSADRNSRSRSLPSDFAKNPSRWRRTLKGVRERHGRERKGWMIIIHDLSG  248

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D +
Sbjct  249  SPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGACVSSWKPWGRLEAWRERGPVDGL  308

Query  469  CCRFHL-LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSAL  293
              +F L + +GP  G  + ++E  ++ +KGG+F ID      +                 
Sbjct  309  GYKFELVIENGPTNG--IPIAEATMNVKKGGQFCIDYKVMRDSGLLGSRLQGK-------  359

Query  292  SPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RR  116
                 GFVM   V+GEGK SK +VQ+  +HVTC+ DAA+F+AL+AAVDLS++AC+ F  +
Sbjct  360  -----GFVMGSTVEGEGKVSKPVVQVGAQHVTCMADAALFIALSAAVDLSMDACQLFSHK  414

Query  115  LRRGTRH  95
            LR+   H
Sbjct  415  LRKELCH  421



>ref|XP_010267102.1| PREDICTED: uncharacterized protein LOC104604464 [Nelumbo nucifera]
Length=417

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 150/243 (62%), Gaps = 23/243 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvd--ssDIEIER----RERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +   L   S++           ER    RERKGW + I+DLSG
Sbjct  179  NIRQPVFSCKFSADRNSRSRSLRLDSNNRGGGWMKSFSKERDRLGRERKGWMIMIYDLSG  238

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D +
Sbjct  239  SPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPQGFSVSSWKPWGRLEAWRERGPADGL  298

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L++D     G +  +E  +S  KGG+F IDT+                GD ++ S
Sbjct  299  GYKFELVTDTGTNTG-VPFAESTMSVRKGGQFCIDTN--------------LVGDTASSS  343

Query  289  PVV-GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RR  116
                 GFVM   V+GEGK SK +VQ+ ++HV    DAA+F+AL+AA+DLS++ACR F R+
Sbjct  344  SSSRRGFVMGSTVEGEGKVSKPVVQVGVQHVKSTADAALFVALSAAIDLSMDACRLFSRK  403

Query  115  LRR  107
            LR+
Sbjct  404  LRK  406



>ref|XP_010249469.1| PREDICTED: uncharacterized protein LOC104592027 [Nelumbo nucifera]
Length=417

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 151/247 (61%), Gaps = 23/247 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvd--ssDIEIER----RERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +   L   S+       +    +R    RERKGW + I+DLSG
Sbjct  179  NIRQPVFSCKFSADRNSRSRSLQLDSNMKSRGWMNSFASDRDRPGRERKGWMIMIYDLSG  238

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D +
Sbjct  239  SPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPQGFSVSSWKPWGRLEAWRERGPIDGL  298

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L++D     G + ++E  +S  KGG+F IDT                 GD ++ S
Sbjct  299  GYKFELVTDTGTNSG-ISIAEATMSIRKGGQFCIDTS--------------LVGDTASSS  343

Query  289  -PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RR  116
                 GF+M   V+GEGK SK +VQ+ ++HVT   DAA+F+AL+AA+DLS++ACR F  +
Sbjct  344  WSSRRGFIMGSTVEGEGKVSKPVVQVGVQHVTSTADAALFIALSAAIDLSMDACRLFSHK  403

Query  115  LRRGTRH  95
            LR+   H
Sbjct  404  LRKELCH  410



>ref|XP_010110868.1| hypothetical protein L484_006983 [Morus notabilis]
 gb|EXC28687.1| hypothetical protein L484_006983 [Morus notabilis]
Length=415

 Score =   191 bits (485),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 153/252 (61%), Gaps = 33/252 (13%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvd----ssDIEIER----RERKGWKVKIHDL  656
            +I+QP+FSCKFS DR  +   L +  +   +    +     ER    RERKGW V IHDL
Sbjct  177  SIRQPVFSCKFSADRNSRSRSLPSDFTLNSNNRGWTRTFSGEREKPGRERKGWMVTIHDL  236

Query  655  SGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRD  476
            SGS VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  D
Sbjct  237  SGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSLSSWKPWGRLEAWRERGPVD  296

Query  475  SICCRFHL-LSDGPEGG---GDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSG  308
             +  +F L ++D    G   G++ ++E  +S +KGG F I                    
Sbjct  297  GLGYKFELVVADANHCGPTTGNIPIAEATMSMKKGGLFSIVNS-----------------  339

Query  307  DFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACR  128
              S  SP V GFVM   V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR
Sbjct  340  --STRSP-VKGFVMGSTVEGEGKVSKPVVQVGVQHVTCMADAALFVALSAAIDLSMDACR  396

Query  127  PF-RRLRRGTRH  95
             F  +LR+   H
Sbjct  397  LFSHKLRKELCH  408



>ref|XP_001754636.1| predicted protein [Physcomitrella patens]
 gb|EDQ80606.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 161/250 (64%), Gaps = 18/250 (7%)
 Frame = -3

Query  805  KQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIE-RRERKGWKVKIHDLSGSAVAAAF  629
            +Q IFSCKFS+D++ +   +  F S    S   + E RRERKGW V IHDLSGS VAAA 
Sbjct  183  QQSIFSCKFSRDKLSRCRSVFLFFSDAWGSKSEDREKRRERKGWLVMIHDLSGSPVAAAS  242

Query  628  ITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHLL  449
            + TPFVPS G D+V RSNPGAWLI+RP+    ++W+PWG+LEAWR+RG +D I CRF L+
Sbjct  243  MVTPFVPSAGSDYVARSNPGAWLILRPESPGADNWRPWGRLEAWRDRGGKD-IGCRFQLM  301

Query  448  SD---GPEGGGDLLMSEILISAEKGGEFYIDTD--KQvraaaspvpsprsSGDFSALSP-  287
            ++          +L SE ++SA+KGG+F ID    KQ  +              S  S  
Sbjct  302  AEGGGVTGVSSGVLTSETILSAKKGGDFTIDARRFKQEVSLGPSPVESPRRNSLSPRSSG  361

Query  286  ---------VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEA  134
                      VG FVMSC V+G+   SK LVQ+AMRHV+CVED A+F+ALAAAVDLS+ A
Sbjct  362  ELSFGLGLHAVGEFVMSCGVRGDRNSSKPLVQVAMRHVSCVEDVAVFVALAAAVDLSVYA  421

Query  133  CRPF-RRLRR  107
            C+PF RRLR+
Sbjct  422  CQPFKRRLRK  431



>ref|XP_009128862.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103853708 
[Brassica rapa]
Length=429

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/250 (45%), Positives = 147/250 (59%), Gaps = 28/250 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            NIKQP+FSCKFS DR  +   L +  +                   + RERKGW + IHD
Sbjct  182  NIKQPVFSCKFSSDRNGRSRSLPSGFTYSSRGWITRTLSGDQWEKKQARERKGWMITIHD  241

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  242  LSGSPVAAASMITPFVASPGSDRVSRSNPGAWLILRPHGTCVSSWKPWGRLEAWRERGAV  301

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  +F L+++     G + ++E  +S  +GG+F ID                  G+  
Sbjct  302  DGLGYKFELVTNNSTSTG-VPIAEGTMSTRQGGKFIID------------RRVSGQGESP  348

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVT-----CVEDAAIFMALAAAVDLSIEA  134
            A S  V GFVM   V+GEGK SK +V +  +HVT     C+ DAA+F+AL+AAVDLS++A
Sbjct  349  ARSSPVKGFVMGSSVEGEGKVSKPVVHVGAQHVTAQHVICMADAALFVALSAAVDLSVDA  408

Query  133  CRPF-RRLRR  107
            C+ F R+LR+
Sbjct  409  CQLFSRKLRK  418



>ref|XP_010526420.1| PREDICTED: uncharacterized protein LOC104803996 [Tarenaya hassleriana]
Length=420

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 148/249 (59%), Gaps = 26/249 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI---------ERRERKGWKVKIHD  659
            NI+QP+FSCKFS DR  +   L +  +                   + +ERKGW + IHD
Sbjct  181  NIRQPVFSCKFSADRNGRSRSLPSGFTYSSRGWITRTLSGETREKKQAKERKGWMITIHD  240

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PWG+LEAWRERG  
Sbjct  241  LSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPHGNSVSSWKPWGRLEAWRERGAI  300

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +   F L+ D       + ++E  +S ++GG+F ID+                  +  
Sbjct  301  DGLGYSFELVRDNTT-TTRIPIAEGTMSVKRGGKFSIDSKLTR--------------EIQ  345

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
              SP V GFVM   V+GEGK SK +V++  +HVTC+ DAA+F+AL+AAVDLS++AC+ F 
Sbjct  346  RSSP-VKGFVMGSSVEGEGKVSKPVVEVGAQHVTCMADAALFVALSAAVDLSMDACQLFS  404

Query  121  RRLRRGTRH  95
            R+LR+   H
Sbjct  405  RKLRKELCH  413



>ref|XP_007160272.1| hypothetical protein PHAVU_002G307300g [Phaseolus vulgaris]
 gb|ESW32266.1| hypothetical protein PHAVU_002G307300g [Phaseolus vulgaris]
Length=419

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 148/247 (60%), Gaps = 22/247 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssf------vdssDIEIERRERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +   L +  SS         + D E + +ERKGW + IHDLSG
Sbjct  180  NIRQPVFSCKFSADRNYRSRSLPSDFSSNGNGWRRSSTGDRERQGKERKGWMIMIHDLSG  239

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWRERG  D +
Sbjct  240  SPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASVSSWKPWGRLEAWRERGPVDGL  299

Query  469  CCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSAL  293
              +  L SD GP     + ++E  +S +KGG+F ID                        
Sbjct  300  GYKVELFSDSGP--ANRVPIAEGTVSVKKGGQFCIDYK------------VMKDAGLGWR  345

Query  292  SPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RR  116
             P   GFVM   V GEGK SK +VQ+  +H+TC+ DAA+F+AL+AA+DLS++AC  F  +
Sbjct  346  LPGEEGFVMGSSVDGEGKVSKPVVQVGAQHITCMADAALFIALSAAIDLSMDACTLFSHK  405

Query  115  LRRGTRH  95
            LR+   H
Sbjct  406  LRKELCH  412



>ref|XP_009395733.1| PREDICTED: uncharacterized protein LOC103980924 [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 149/242 (62%), Gaps = 22/242 (9%)
 Frame = -3

Query  808  IKQPIFSCKFSQDR----VQQVDPLsnfss---sfvdssDIEIERRERKGWKVKIHDLSG  650
            ++QP+FSC+F+ DR    + +  P         SF    D EI   +RKGW V IHDLSG
Sbjct  195  VRQPVFSCRFTADRRRTTISRSLPTKRSFKRCLSFGGERDHEIRWEQRKGWTVTIHDLSG  254

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA I TPFVPS G D V RSNPGAWLI+        +W+PWG+LEAWRERG  D++
Sbjct  255  SPVAAASIVTPFVPSPGSDRVSRSNPGAWLILHAIGPSTTNWKPWGRLEAWRERGPADAL  314

Query  469  CCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSAL  293
              RF L++D GP  G  L ++E  +S  KGGEF ID           V      G +   
Sbjct  315  GLRFELVTDAGPNNG--LPIAESSLSVRKGGEFCIDPS--------VVAGAVMPGSW---  361

Query  292  SPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFRRL  113
             P VGGFVM+  V+G+GK SK  VQ+ ++HV+C+ D A+F+AL+AA+DLS++AC+ F + 
Sbjct  362  -PFVGGFVMAAAVEGQGKASKPTVQVGLQHVSCMADVALFIALSAAIDLSMDACQSFSQK  420

Query  112  RR  107
             R
Sbjct  421  LR  422



>ref|XP_004251646.1| PREDICTED: uncharacterized protein LOC101262285 [Solanum lycopersicum]
Length=423

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 151/242 (62%), Gaps = 22/242 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVD--PLsnfsssfvdssDIEIER----RERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +    P     ++         ER    RERKGW + I+DLSG
Sbjct  186  NIRQPVFSCKFSADRNNRSRSLPTDFNLNNRGWMRTFSGERDRTGRERKGWMIIIYDLSG  245

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            SAVAAA + TPFVPS G D V RSN GAWLI+RP+     SW+ WG+L+AWRERG  D +
Sbjct  246  SAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGACVSSWKHWGRLQAWRERGPVDGL  305

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L++D       + ++E  +S +KGG+F ID   +  A              S  S
Sbjct  306  GYKFELVTDTGL-TSTIPIAEGTMSMKKGGQFCIDNTVKDTA-------------LSTNS  351

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRL  113
            P+  GFVM   V+GEGK S  +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F ++L
Sbjct  352  PIR-GFVMVSNVEGEGKISTPMVQVGVQHVTCMADAALFIALSAAIDLSMDACRLFSQKL  410

Query  112  RR  107
            R+
Sbjct  411  RK  412



>ref|XP_006353504.1| PREDICTED: uncharacterized protein LOC102579879 [Solanum tuberosum]
Length=423

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 112/246 (46%), Positives = 152/246 (62%), Gaps = 22/246 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVD--PLsnfsssfvdssDIEIER----RERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +    P     ++         ER    RERKGW + I+DLSG
Sbjct  186  NIRQPVFSCKFSADRNNRSRSLPTDFNLNNRGWMRTFSGERDRTGRERKGWMIIIYDLSG  245

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            SAVAAA + TPFVPS G D V RSN GAWLI+RP+     SW+ WG+L+AWRERG  D +
Sbjct  246  SAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGACVSSWKHWGRLQAWRERGPVDGL  305

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L++D       + ++E  +S +KGG+F ID   +  A              S  S
Sbjct  306  GYKFELVTDTGL-TSTIPIAEGTMSMKKGGQFCIDNTVKDTA-------------LSTNS  351

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRL  113
            P+  GFVM   V+GEGK S  +VQ+ ++HVTC+ DAA+F+AL+AA+DLS++ACR F ++L
Sbjct  352  PIR-GFVMVSNVEGEGKISTPMVQVGVQHVTCMADAALFIALSAAIDLSMDACRLFSQKL  410

Query  112  RRGTRH  95
            R+   H
Sbjct  411  RKELCH  416



>ref|XP_004157897.1| PREDICTED: uncharacterized LOC101219082, partial [Cucumis sativus]
Length=228

 Score =   182 bits (463),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 133/201 (66%), Gaps = 14/201 (7%)
 Frame = -3

Query  694  RERKGWKVKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPW  515
            RERKGW + ++DLSGS VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PW
Sbjct  33   RERKGWMIMVYDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSVSSWKPW  92

Query  514  GKLEAWRERGIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaas  335
            G+LEAWRERG  D +  +F L++D     G + ++E  +S +KGG+F ID          
Sbjct  93   GRLEAWRERGPIDGLGYKFELVADTGLATG-IPIAEATMSVKKGGQFCIDRKTVRDLT--  149

Query  334  pvpsprsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAA  155
                       ++ S V G FVM+  V+GEGK SK +VQ+ ++HVTC+ DAA+F+AL+AA
Sbjct  150  ----------INSKSTVKGSFVMASSVEGEGKVSKPIVQVGVQHVTCMADAALFVALSAA  199

Query  154  VDLSIEACRPF-RRLRRGTRH  95
            +DLS++ACR F ++LRR   H
Sbjct  200  IDLSMDACRHFTQKLRRELCH  220



>ref|XP_009597038.1| PREDICTED: uncharacterized protein LOC104093034 [Nicotiana tomentosiformis]
Length=419

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/246 (45%), Positives = 151/246 (61%), Gaps = 21/246 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvd----ssDIEIER--RERKGWKVKIHDLSG  650
            N  QP+FSCKFS DR  +   L +  +        +   E +R  +ERKGW + I+DLSG
Sbjct  181  NRSQPVFSCKFSADRNNRSRSLPSDFNLNNRGWMRTFSGEKDRTGKERKGWMIIIYDLSG  240

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            SAVAAA + TPFVPS G D V RSN GAWLI+RP+     SW+PWG+LEAWRERG  D +
Sbjct  241  SAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGASVSSWKPWGRLEAWRERGPVDGL  300

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L++D       + ++E  +S +KGG+F ID   +                 S+ S
Sbjct  301  GYKFELVTDTGLTSAAIPIAEGTMSMKKGGQFCIDNTVKDSV-------------LSSNS  347

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRL  113
            P + GFVM   V+GEGK S   VQ+ ++HV C+ DAA+F+AL+AA+DLS++ACR F ++L
Sbjct  348  P-IRGFVMVSTVEGEGKTSVPTVQVGVQHVKCMADAALFVALSAAIDLSMDACRLFSQKL  406

Query  112  RRGTRH  95
            R+   H
Sbjct  407  RKELCH  412



>ref|XP_010539384.1| PREDICTED: uncharacterized protein LOC104813482 [Tarenaya hassleriana]
Length=426

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 117/251 (47%), Positives = 152/251 (61%), Gaps = 30/251 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDI------EIERR---ERKGWKVKIHD  659
            NIKQP+FSC FS DR  +  P S  S +      I      E+ +R   ERKGW + ++D
Sbjct  189  NIKQPVFSCNFSADRNSRTRPPSPVSGAGERGGCIMRTFSGEVNKRQVKERKGWMIIVYD  248

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMR-ESWQPWGKLEAWRER-G  485
            LSGSAVAAA + TPFVPS G D V R+NPGAWLI++P   +   SW+PWG+LEAWRER G
Sbjct  249  LSGSAVAAASMATPFVPSPGSDRVSRANPGAWLILQPHCGLSVGSWKPWGRLEAWRERGG  308

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGD  305
              D +  RF L++D   GGG + ++E  +S + GG F ID  +                 
Sbjct  309  SDDGLGYRFELVTD--VGGGGISIAEGTMSVKHGGRFCIDGRRSSP--------------  352

Query  304  FSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
                SPV  GFVMS  V+GEG+ SK  V++A  HV    DAA+F+AL+AA+DLSI+ACR 
Sbjct  353  -DPRSPVR-GFVMSATVEGEGRVSKPAVEVAAEHVGSTADAALFVALSAAIDLSIDACRL  410

Query  124  F-RRLRRGTRH  95
            F R+LR+   H
Sbjct  411  FSRKLRKELCH  421



>ref|XP_009757179.1| PREDICTED: uncharacterized protein LOC104210073 [Nicotiana sylvestris]
Length=419

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 150/246 (61%), Gaps = 21/246 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvd----ssDIEIER--RERKGWKVKIHDLSG  650
            N  QP+FSCKFS DR  +   L +  +        +   E +R  RERKGW + I+DLSG
Sbjct  181  NRSQPVFSCKFSADRNNRSRSLPSDFNLNNRGWMRTFSGEKDRTGRERKGWMIIIYDLSG  240

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            SAVAAA + TPFVPS G D V RSN GAWLI+RP+     SW+PWG+LEAWRERG  D +
Sbjct  241  SAVAAASMITPFVPSPGSDRVSRSNAGAWLILRPNGASVSSWKPWGRLEAWRERGPVDGL  300

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L++D       + ++E  +S +KGG+F ID   +                 S+ S
Sbjct  301  GYKFELVTDTGLTSAAIPIAEGTMSMKKGGQFCIDNTVKDSV-------------LSSNS  347

Query  289  PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRL  113
            P + GFVM   V+GEGK S   +Q+ ++HV  + DAA+F++L+AA+DLS++ACR F R+L
Sbjct  348  P-IRGFVMVSTVEGEGKTSVPTIQVGVQHVKSMADAALFISLSAAIDLSMDACRLFSRKL  406

Query  112  RRGTRH  95
            R+   H
Sbjct  407  RKELCH  412



>ref|XP_003516376.1| PREDICTED: uncharacterized protein LOC100805866 [Glycine max]
Length=428

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 152/249 (61%), Gaps = 26/249 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssf------vdssDIEIERRERKGWKVKIHDLSG  650
            NI+QP+FSCKFS DR  +   L +  ++             E   RERKGW + IHDLSG
Sbjct  188  NIRQPVFSCKFSADRNSRSRCLPSDFANNPSRWRRTLKGIRERHGRERKGWMIMIHDLSG  247

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMR-ESWQPWGKLEAWRERGIRDS  473
            S VAAA + TPFVPS G D V RSNPGAWLI+R +      SW+PWG+LEAWRERG  D 
Sbjct  248  SPVAAASMITPFVPSPGSDRVSRSNPGAWLILRTNNGASVSSWKPWGRLEAWRERGPVDG  307

Query  472  ICCRFHLLS-DGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSA  296
            +  +F L++ +GP  G  + ++E  ++ +KGG+F ID                   D   
Sbjct  308  LGYKFELVTENGPANG--IPIAEATMNVKKGGQFCIDYKVMR--------------DSGL  351

Query  295  LSPVVG-GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
             S + G GFVM   V+GEGK SK +VQ+  +HVTC+ DAA+F+AL+AA+DLS++AC+ F 
Sbjct  352  GSRLKGKGFVMGSTVEGEGKVSKPVVQVGAQHVTCMADAALFIALSAAIDLSMDACKLFS  411

Query  121  RRLRRGTRH  95
             +LR+   H
Sbjct  412  HKLRKELCH  420



>ref|XP_008367920.1| PREDICTED: uncharacterized protein LOC103431533 [Malus domestica]
Length=239

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 131/202 (65%), Gaps = 17/202 (8%)
 Frame = -3

Query  694  RERKGWKVKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPW  515
            RERKGW + IHDLSGS VAAA + TPFVPS G D V RSNPGAWLI+RP      SW+PW
Sbjct  46   RERKGWMITIHDLSGSPVAAASMITPFVPSPGTDRVSRSNPGAWLILRPHGFSISSWKPW  105

Query  514  GKLEAWRERGIRDSICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaa  338
            G+LEAWRERG  D +  +F L++D GP     + ++E  +S +KGG+F ID+        
Sbjct  106  GRLEAWRERGPIDGLGYKFELVTDNGPS--SSITIAEGTMSVKKGGQFCIDS--------  155

Query  337  spvpsprsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAA  158
                         + SP V GFV    V+G GK SK +VQ+ ++HVTC+ DAA+F+AL+A
Sbjct  156  ----RLNRDSGLKSRSP-VKGFVTGSTVEGXGKVSKPVVQVGVQHVTCMADAALFVALSA  210

Query  157  AVDLSIEACRPF-RRLRRGTRH  95
            A+DLS++ACR F  +LRR   H
Sbjct  211  AIDLSMDACRLFSHKLRRELCH  232



>ref|XP_010042246.1| PREDICTED: uncharacterized protein LOC104431287 [Eucalyptus grandis]
Length=297

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 130/201 (65%), Gaps = 21/201 (10%)
 Frame = -3

Query  706  EIERRERKGWKVKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRES  527
            E   RE KGW V IHDLSGS VAAA + TPFVPS G D V RSNPGAWLI+RP+     S
Sbjct  106  ERHSREPKGWMVTIHDLSGSPVAAASMVTPFVPSPGSDLVSRSNPGAWLILRPNGYSISS  165

Query  526  WQPWGKLEAWRERGIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvr  347
            W+PWG+LEAWRERG  D +  +F L+++G    G + ++E  +S +KGG+F ID      
Sbjct  166  WKPWGRLEAWRERGPTDGLGYKFELVTEGGPTRG-IPIAEATMSVKKGGQFSIDVG----  220

Query  346  aaaspvpsprsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMA  167
                           S+L   V GFVM+  V+ EGK SK  VQ+ ++HVTC+ DAA+F+A
Sbjct  221  ---------------SSLKSPVKGFVMASTVEAEGKTSKPAVQVGVQHVTCMPDAALFIA  265

Query  166  LAAAVDLSIEACRPF-RRLRR  107
            L+AA DLS++AC+ F  +LR+
Sbjct  266  LSAAFDLSMDACQLFSHKLRK  286



>gb|AIE44349.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44350.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44351.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44352.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44353.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44354.1| putative stress-induced protein, partial [Ostryopsis davidiana]
 gb|AIE44356.1| putative stress-induced protein, partial [Ostryopsis nobilis]
 gb|AIE44357.1| putative stress-induced protein, partial [Ostryopsis nobilis]
 gb|AIE44358.1| DUF1005 protein, partial [Ostryopsis nobilis]
Length=121

 Score =   174 bits (442),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 2/121 (2%)
 Frame = -3

Query  589  VDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHLLSDGPEGGGDLLMS  410
            V RSNPGAWLIVRPD C  ESWQPWGKLEAWRERGIRDS+CCRF LLS+G E GG+LLMS
Sbjct  1    VARSNPGAWLIVRPDVCRAESWQPWGKLEAWRERGIRDSVCCRFRLLSEGQE-GGELLMS  59

Query  409  EILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVVGGFVMSCRVQGEGKYS  233
            EI I+AEKGGEF+ID+D+Q+RAAA+  +PSP+SSGDF+AL PVVGGFVMSCRVQGEGK S
Sbjct  60   EIFINAEKGGEFFIDSDRQMRAAAASPIPSPQSSGDFAALGPVVGGFVMSCRVQGEGKSS  119

Query  232  K  230
            K
Sbjct  120  K  120



>ref|XP_008795504.1| PREDICTED: uncharacterized protein LOC103711219 [Phoenix dactylifera]
Length=442

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 151/250 (60%), Gaps = 32/250 (13%)
 Frame = -3

Query  808  IKQPIFSCKFSQDRVQQVDPLsnfsssfvd-----------ssDIEIERRERKGWKVKIH  662
            ++QP+FSC+FS DR +     S  S+S  +           S      R +RKGW V IH
Sbjct  198  LRQPVFSCRFSADRRRNTRSRSLPSNSSNNSIIKGWFGCLGSERNHRRRDKRKGWTVTIH  257

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPD--PCMRESWQPWGKLEAWRER  488
            DLSGS VAAA + TPFVPS G D V RSNPGAWLI+R         +W+PWG+LEAWRER
Sbjct  258  DLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRATGFSGSTANWKPWGRLEAWRER  317

Query  487  GIRDSICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsS  311
            G  +++  RF L++D GP     + ++E  +S  KGG+F ID                 +
Sbjct  318  GPVNTLGYRFELVTDSGPT--DRVPIAESSLSVRKGGQFSIDPS--------------VA  361

Query  310  GDFSALS-PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEA  134
            GD  + S P VGGFVM   V GEGK SK  VQ+ + HV+C+ D A+F+ALAAAVDLS++A
Sbjct  362  GDVVSRSEPFVGGFVMGSTVNGEGKVSKPTVQVGLHHVSCMADVALFIALAAAVDLSMDA  421

Query  133  CRPF-RRLRR  107
            C+ F ++LRR
Sbjct  422  CQLFAKKLRR  431



>gb|AIE44359.1| DUF1005 protein, partial [Corylus mandshurica]
Length=121

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 2/121 (2%)
 Frame = -3

Query  589  VDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHLLSDGPEGGGDLLMS  410
            V RSNPGAWLIVRPD C  ESWQPWGKLEAWRERGIRDS+CCRF LLS+G E GG+LLMS
Sbjct  1    VARSNPGAWLIVRPDVCRAESWQPWGKLEAWRERGIRDSVCCRFRLLSEGQE-GGELLMS  59

Query  409  EILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVVGGFVMSCRVQGEGKYS  233
            EI I+AEKGGEF+ID+D+Q+RAAA+  +PSP+SSGDF+AL PVVGGFVMSCRVQGEGK S
Sbjct  60   EIFINAEKGGEFFIDSDRQMRAAAASPIPSPQSSGDFAALCPVVGGFVMSCRVQGEGKSS  119

Query  232  K  230
            K
Sbjct  120  K  120



>ref|XP_010924447.1| PREDICTED: uncharacterized protein LOC105047284 [Elaeis guineensis]
Length=441

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/248 (44%), Positives = 151/248 (61%), Gaps = 29/248 (12%)
 Frame = -3

Query  808  IKQPIFSCKFSQDRVQQVDPLsnfsssfvdssD----------IEIERRERKGWKVKIHD  659
            ++QP+FSC+FS DR       S  S+S   ++             + R +RKGW + IHD
Sbjct  198  LRQPVFSCRFSADRRHNTRSRSLPSNSPDRTNKGWFGCFGSERSHVRREQRKGWTITIHD  257

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRP--DPCMRESWQPWGKLEAWRERG  485
            LSGS VAAA + TPFVPS G D V RSNPGAWLI+R         +W+PWG+LEAWRERG
Sbjct  258  LSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRATGSSGSTPNWKPWGRLEAWRERG  317

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGD  305
              D++  RF +++D       + ++E  +S  KGG+F ID                 +GD
Sbjct  318  PVDALGYRFEIVTDA-APTERVPIAESSLSVRKGGQFSIDPS--------------VAGD  362

Query  304  FSALS-PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACR  128
              + S P VG FVM   V+GEGK SK +VQ+ ++HV+C+ D A+F+AL+AAVDLS++AC+
Sbjct  363  VVSTSEPFVGAFVMVSTVEGEGKVSKPMVQVGVQHVSCMADVALFIALSAAVDLSMDACQ  422

Query  127  PF-RRLRR  107
             F ++LR+
Sbjct  423  LFSQKLRK  430



>gb|AIE44355.1| putative stress-induced protein, partial [Ostryopsis intermedia]
Length=121

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 109/121 (90%), Gaps = 2/121 (2%)
 Frame = -3

Query  589  VDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHLLSDGPEGGGDLLMS  410
            V RSNPGAWLIVRPD C  ESWQPWGKLEAWRERGI+DS+CCRF LLS+G E GG+LLMS
Sbjct  1    VARSNPGAWLIVRPDVCRAESWQPWGKLEAWRERGIKDSVCCRFRLLSEGQE-GGELLMS  59

Query  409  EILISAEKGGEFYIDTDKQvraaasp-vpsprsSGDFSALSPVVGGFVMSCRVQGEGKYS  233
            EI I+AEKGGEF+ID+D+Q+RAAA+  +PSP+SSGDF+AL PVVGGFVMSCRVQGEGK S
Sbjct  60   EIFINAEKGGEFFIDSDRQMRAAAASPIPSPQSSGDFAALGPVVGGFVMSCRVQGEGKSS  119

Query  232  K  230
            K
Sbjct  120  K  120



>ref|XP_010915009.1| PREDICTED: uncharacterized protein LOC105040251 [Elaeis guineensis]
 ref|XP_010915015.1| PREDICTED: uncharacterized protein LOC105040251 [Elaeis guineensis]
Length=448

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 154/250 (62%), Gaps = 32/250 (13%)
 Frame = -3

Query  808  IKQPIFSCKFSQDRVQQVDPLsnfss-----------sfvdssDIEIERRERKGWKVKIH  662
            ++QP+FSC+FS DR +     S  S+           S   S    + R +RKGW V IH
Sbjct  204  LRQPVFSCRFSADRRRNTGSGSLPSNSSNNSTIKGWFSSFGSERNHLRREQRKGWTVTIH  263

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPD--PCMRESWQPWGKLEAWRER  488
            DLSGS VAAA + TPFVPS G D V RSN GAWLI++P        +W+PWG+LEAWRER
Sbjct  264  DLSGSPVAAASMVTPFVPSPGSDRVSRSNAGAWLILQPTGFSGSTPNWKPWGRLEAWRER  323

Query  487  GIRDSICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsS  311
            G  D++  RF L++D GP GG  + ++E  +S  KGG+F I              +P   
Sbjct  324  GPVDALGYRFELVTDSGPTGG--IPIAESSLSVRKGGQFCI--------------APGVI  367

Query  310  GDFSALS-PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEA  134
            GD  + S P VGGFVM   V+GEGK SK  VQ+  +HV+C+ D A+F+AL+AAVDLS++A
Sbjct  368  GDGISRSWPSVGGFVMGSIVEGEGKVSKPTVQVGAQHVSCMADVALFIALSAAVDLSMDA  427

Query  133  CRPF-RRLRR  107
            C+ F ++LR+
Sbjct  428  CQLFSQKLRK  437



>ref|XP_004503501.1| PREDICTED: uncharacterized protein LOC101489321 [Cicer arietinum]
Length=423

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 151/248 (61%), Gaps = 32/248 (13%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdss----------DIEIERRERKGWKVKIH  662
            NIKQP+FSCKF+ DR  +   L +   +  +SS          +  ++  ERKGW + IH
Sbjct  183  NIKQPVFSCKFTADRNYRSQSLPSDFRNNNNSSRWRKSLRGDREQSVQGNERKGWMIVIH  242

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPD-PCMRESWQPWGKLEAWRERG  485
            DLSGS VAAA + TPFVPS G + V RSN GAWLI+RP+      SW+PWG+LEAWRERG
Sbjct  243  DLSGSPVAAASMITPFVPSPGSNRVSRSNAGAWLILRPNGASTVSSWKPWGRLEAWRERG  302

Query  484  IRDSICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSG  308
              D +  +  L SD GP     + ++E  +S +KGG+F ID+        + + S    G
Sbjct  303  SIDGLGYKVELFSDNGPVNA--ITIAEGTMSVKKGGKFCIDS--------AILGSKWLPG  352

Query  307  DFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACR  128
            +         GFVM   V GEGK SK +VQ+  RHVTC+ DAA+F+AL+AA+DLS++AC 
Sbjct  353  E---------GFVMGSTVSGEGKVSKPVVQVGARHVTCMPDAALFIALSAAIDLSMDACM  403

Query  127  PF-RRLRR  107
             F  +LR+
Sbjct  404  LFSHKLRK  411



>ref|XP_009416467.1| PREDICTED: uncharacterized protein LOC103997060 [Musa acuminata 
subsp. malaccensis]
Length=442

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 154/252 (61%), Gaps = 33/252 (13%)
 Frame = -3

Query  808  IKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDI------------EIERRE-RKGWKVK  668
            I+QP+FSC+F+ DR +    +S+  +S    S+             + +RRE RKGW V 
Sbjct  195  IRQPVFSCRFTVDRRRNSRSMSSSLASDGSRSNSIRSWFSSLGGERDHQRREQRKGWTVT  254

Query  667  IHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRP---DPCMRESWQPWGKLEAW  497
            IHDLSGS VAAA + TPFVPS G D V RSNPGAWLI+RP         +W+PWG+LEAW
Sbjct  255  IHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPIGGSTSAATNWKPWGRLEAW  314

Query  496  RERGIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr  317
            RERG  D++  RF L+ D    GG + ++E  +S  KGG+F ID                
Sbjct  315  RERGPVDALGYRFELVPDTGHIGG-VPIAESSLSVRKGGQFCIDPS--------------  359

Query  316  sSGDFSALS-PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSI  140
              GD  A   P  GGFVM   V+GEGK SK  VQ+ ++HV+C+ D A+F+AL+AA+DLS+
Sbjct  360  VIGDMVAGQWPFDGGFVMGSTVEGEGKASKPSVQVGVQHVSCMADVALFIALSAAIDLSM  419

Query  139  EACRPF-RRLRR  107
            +AC+ F ++LR+
Sbjct  420  DACQLFSQKLRK  431



>ref|XP_002510019.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52206.1| conserved hypothetical protein [Ricinus communis]
Length=441

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 162/249 (65%), Gaps = 19/249 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssf-vdssDIEIER--RERKGWKVKIHDLS  653
            NI+QP+F+CKFS     DR Q+   L +  +   + +   E ER  +ERKGW + +HDLS
Sbjct  188  NIRQPVFTCKFSFRNIGDRNQRSRSLPSSEARSWLSTFGSERERPGKERKGWSITVHDLS  247

Query  652  GSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDS  473
            GS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  D 
Sbjct  248  GSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGASDG  304

Query  472  ICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---TDKQvraaaspvpsprsSGDF  302
            +  RF L+ D    G  ++++E  +S +KGG F ID          AASPV SPR SGDF
Sbjct  305  LGYRFELIPDTNAAG--IVLAESTLSLKKGGNFVIDLGVNSNGRSNAASPVCSPRGSGDF  362

Query  301  S-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
               L P  V  GFVMS  V+GEGK SK  VQ++++HV C EDAA F+ALAA VDLS++AC
Sbjct  363  GYGLWPYCVYRGFVMSASVEGEGKCSKPSVQVSVQHVNCTEDAAAFVALAATVDLSMDAC  422

Query  130  RPF-RRLRR  107
            R F +RLR+
Sbjct  423  RLFSQRLRK  431



>ref|XP_009410899.1| PREDICTED: uncharacterized protein LOC103992782 [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 143/244 (59%), Gaps = 29/244 (12%)
 Frame = -3

Query  808  IKQPIFSCKFSQDRVQQV---DPLsnfsssfvdssDIEIER-----RERKGWKVKIHDLS  653
            ++QP+FSC+FS DR +      P +  +        +  ER      +RKGW V IHDLS
Sbjct  222  VRQPVFSCRFSADRRRTTRTTSPPTKNNRRRCWFGSLGGERDHESREQRKGWTVTIHDLS  281

Query  652  GSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDS  473
            GS VAAA I TPFV S G D V RSNPGAWLI+R        W+PWG+LEAWRE+G  D+
Sbjct  282  GSPVAAASIVTPFVASPGSDRVSRSNPGAWLILRAVGPSATDWKPWGRLEAWREKGPVDA  341

Query  472  ICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSA  296
            +  RF L++D GP  G  ++ S   +S  KGG F ID                  G    
Sbjct  342  LGYRFELMTDAGPNRGFPIVESS--LSMRKGGRFCIDP-----------------GVVEK  382

Query  295  LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-R  119
              P  GGFVM+  V+G+GK SK  VQ+ ++HV+C+ D A+F+AL+AA+DLS +AC+ F  
Sbjct  383  SGPFAGGFVMAATVEGQGKVSKPTVQVGVQHVSCMADVALFIALSAAIDLSGDACQLFSH  442

Query  118  RLRR  107
            +LR+
Sbjct  443  KLRK  446



>emb|CDY63745.1| BnaC05g07770D [Brassica napus]
Length=435

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 162/249 (65%), Gaps = 18/249 (7%)
 Frame = -3

Query  811  NIKQPIFSCKFS-------QDRVQQVDPLsnfsssfvdssDIEIER--RERKGWKVKIHD  659
            +I+QP+F+CKFS         R + + P ++   S+++S   E ER  +ERKGW + +HD
Sbjct  183  SIRQPVFTCKFSCRNTGDRTMRSRSLPPETSVPRSWLNSFGSERERPGKERKGWSITVHD  242

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRER G 
Sbjct  243  LSGSPVAMASIVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGGA  299

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDF  302
             D +  RF L+ DG  G G ++++E  IS+ +GG+F I+      A +      R SGD+
Sbjct  300  TDGLGYRFELIPDGSSGAG-IVLTESSISSHRGGKFSIELGSSPTAGSVSRTRRRGSGDY  358

Query  301  SA---LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
                 L     GFVMS  V+GEGK SK  V+++++HV+C+EDAA ++AL+AA+DLS++AC
Sbjct  359  GYGLWLGSGYKGFVMSASVEGEGKCSKPCVEVSVQHVSCMEDAAAYVALSAAIDLSMDAC  418

Query  130  RPF-RRLRR  107
            R F +R+R+
Sbjct  419  RLFNQRMRK  427



>ref|XP_011078236.1| PREDICTED: uncharacterized protein LOC105162032 [Sesamum indicum]
Length=415

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 116/244 (48%), Positives = 153/244 (63%), Gaps = 26/244 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvd--ssDIEIER----RERKGWKVKIHDLSG  650
            NI+QP+FSCKFS +R  +   L +  +            ER    RERKGW V I+DLSG
Sbjct  178  NIRQPVFSCKFSAERSNRSRSLPSDFNLNNKGWVRTFSGERDRVGRERKGWMVVIYDLSG  237

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFVPS G D V RSNPGAWLI+ P+     SW+PWG+LEAWRERG  D +
Sbjct  238  SPVAAASMVTPFVPSPGSDRVSRSNPGAWLILSPNGVSISSWKPWGRLEAWRERGPVDGL  297

Query  469  CCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALS  290
              +F L++      G + ++E  +S +KGG+F ID  ++                 SALS
Sbjct  298  GYKFELITHAGLTSG-IPIAEGTMSVKKGGKFCIDNSRKD----------------SALS  340

Query  289  PVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-R  119
             V+   GFVM   V+GEGK SK +VQ+ ++HVTC+ DAA+F+ALAAA+DLS++ACR F  
Sbjct  341  LVLPSRGFVMGSSVEGEGKCSKPVVQVGVQHVTCMADAALFVALAAAIDLSMDACRLFSH  400

Query  118  RLRR  107
            +LRR
Sbjct  401  KLRR  404



>ref|XP_010104534.1| hypothetical protein L484_025508 [Morus notabilis]
 gb|EXC01135.1| hypothetical protein L484_025508 [Morus notabilis]
Length=442

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 123/257 (48%), Positives = 163/257 (63%), Gaps = 23/257 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            NI+QP+F+CKFS         + R  Q +P S+ S      S+ E   +ERKGW + +HD
Sbjct  185  NIRQPVFTCKFSFRNTGDRNQRSRSLQSEPSSSRSWLGSFGSERERPIKERKGWSITVHD  244

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  245  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRP---AEGTWKPWGRLEAWRERGGS  301

Query  478  DSICCRFHLLSDGPEGGG----DLLMSEILISAEKGGEFYIDTDKQvraaaspvp-sprs  314
            D +  RF L+ D   GGG     +++SE  ++++KGG+F ID        +     SPRS
Sbjct  302  DGLGYRFELVPDA--GGGVSAAGIVLSESTLNSQKGGKFVIDLGSSRAGGSGSPACSPRS  359

Query  313  SGDFS-ALSPVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLS  143
            SGDF   L P     GFVMS +V+GEG+ SK  V+++++HV C EDAA F+ALAAA+DLS
Sbjct  360  SGDFGYGLWPYCAYRGFVMSAKVEGEGRCSKPTVEMSVQHVGCTEDAAAFVALAAAIDLS  419

Query  142  IEACRPF-RRLRRGTRH  95
            ++ACR F  RLR+   H
Sbjct  420  MDACRLFSHRLRKELCH  436



>dbj|BAJ91729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 143/249 (57%), Gaps = 28/249 (11%)
 Frame = -3

Query  805  KQPIFSCKFSQDR-VQQVDPLsnfsssfvdssD--------------IEIERRERKGWKV  671
            +QP+F+C+FS  R   +   L++ SS     S                  +R +RKGW V
Sbjct  196  RQPVFTCRFSAGRRAARTRSLTSESSMTRSPSRRLRSWLSTLHGDADARAQRDQRKGWMV  255

Query  670  KIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRE  491
             IHDLSGS VAAA + TPFVPS G   V R+NPGAWLI++P      SW+PW +LEAWRE
Sbjct  256  TIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPGAWLILQPTGAGASSWKPWARLEAWRE  315

Query  490  RGIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsS  311
            RG  D++  R  L+ D       + ++E  ISA++GG+F ID             +    
Sbjct  316  RGPVDALGYRLELVFDSGPVECAVPIAESSISAKRGGQFVIDP------------ATFPE  363

Query  310  GDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            G   A  P  GGFVM   V+GEGK S+  VQ+ ++HV C+ D A+F+AL+AAVDL ++AC
Sbjct  364  GSAGAAWPFAGGFVMGSTVEGEGKASRPTVQVGVQHVACMGDVAVFVALSAAVDLCMDAC  423

Query  130  RPF-RRLRR  107
            + F  RLR+
Sbjct  424  KLFSHRLRK  432



>ref|XP_009406176.1| PREDICTED: uncharacterized protein LOC103989135 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 114/262 (44%), Positives = 151/262 (58%), Gaps = 44/262 (17%)
 Frame = -3

Query  808  IKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEI--------------ERRERKGWKV  671
            I+QP+FSC+FS DR +     S    S   S +  +               R +RKGW V
Sbjct  195  IRQPVFSCRFSIDRRRSTRSSSISLPSDAASHNNSMRCWFGSLGAKKNQRRREQRKGWTV  254

Query  670  KIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRP-----------DPCMRESW  524
             IHDLSGS VAAA + TPFVPS G D V RS+PGAWLI+R                  +W
Sbjct  255  TIHDLSGSPVAAASMVTPFVPSPGSDRVSRSDPGAWLILRAIVPPSSSSSSSSSSSSTNW  314

Query  523  QPWGKLEAWRERGIRDSICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvr  347
            +PWG+LEAWRERG  D++ CRF L+ D GP GG  + ++E  +S  KGG F ID      
Sbjct  315  KPWGRLEAWRERGAVDALGCRFELVPDTGPIGG--VPIAESSLSVRKGGHFCIDPS----  368

Query  346  aaaspvpsprsSGDFSALS-PVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFM  170
                        GD  A   P +GGFVM   V+GEGK SK  VQ+ ++HV+C+ D A+F+
Sbjct  369  ----------VIGDVVAGPWPFLGGFVMGSTVEGEGKASKPSVQVGVQHVSCMADVALFI  418

Query  169  ALAAAVDLSIEACRPF-RRLRR  107
            AL+AA+DLS++AC+ F ++LR+
Sbjct  419  ALSAAIDLSMDACQLFSQKLRK  440



>gb|KJB64011.1| hypothetical protein B456_010G029500 [Gossypium raimondii]
Length=450

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 119/259 (46%), Positives = 157/259 (61%), Gaps = 28/259 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvdssDI---EIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+  PL +  SS          E ER  +ERKGW + +HD
Sbjct  186  NIRQPVFTCKFSFRNTGDRNQRSRPLQSEPSSSRSWLSSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  246  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGSS  302

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  RF L+ D       ++++E  +S+ KGG+F ID        AS   +   +    
Sbjct  303  DGLGYRFELIPDM-SASAAIVLAESTLSSRKGGKFVIDLGSNSGGGASNWRNTPVNATSP  361

Query  298  ALSP--------------VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALA  161
            A SP              +  GFVMS RV+GEGK SK  V+++++HV C EDAA ++ALA
Sbjct  362  ACSPRSSGDYGYGLWPFCLYRGFVMSARVEGEGKCSKPCVEVSVQHVNCTEDAAAYVALA  421

Query  160  AAVDLSIEACRPF-RRLRR  107
            AAVDLS++ACR F +RLR+
Sbjct  422  AAVDLSMDACRLFSQRLRK  440



>ref|XP_010544039.1| PREDICTED: uncharacterized protein LOC104816779 [Tarenaya hassleriana]
Length=456

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 163/268 (61%), Gaps = 33/268 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQ---VDPLsnfsssfvdssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   + P ++ S S+++S   E ER  +ERKGW + +HD
Sbjct  187  NIRQPVFTCKFSFRHTGDRTQRSRSMPPETSVSRSWLNSFGSERERPGKERKGWSITVHD  246

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP   +   W+PWG+LEAWRER G 
Sbjct  247  LSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGNGI---WKPWGRLEAWRERGGA  303

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDF  302
             + +  RF L+ DG  G G ++++E  IS+ KGG+F I+             S       
Sbjct  304  TEGLGYRFELIPDGSSGAG-IVLAESNISSHKGGKFVIELGSSTSINGGTKRSHSRGSGS  362

Query  301  SALSP------------------VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAI  176
             A SP                  +  GFVMS  V+GEGK SK  V+++++HVTC+EDAA 
Sbjct  363  GAASPSCSPRGSGDFGFGLWPWCLYRGFVMSATVEGEGKCSKPCVEVSVQHVTCMEDAAA  422

Query  175  FMALAAAVDLSIEACRPF-RRLRRGTRH  95
            ++AL+AA+DLS++ACR F +RLR+   H
Sbjct  423  YVALSAAIDLSMDACRLFNQRLRKELSH  450



>gb|KDP41556.1| hypothetical protein JCGZ_15963 [Jatropha curcas]
Length=449

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 159/256 (62%), Gaps = 24/256 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            NI+QP+F+CKFS         + R  Q +P S+ S      S+ E   +ERKGW + +HD
Sbjct  187  NIRQPVFTCKFSLRNTGDRNQRSRSLQYEPGSSRSWLSSFGSERERPGKERKGWSLTVHD  246

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VA A + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  247  LSGSPVATASMVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGAS  303

Query  478  DSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr----  317
            D +  RF L+ D  G      ++++E  + + KGGEF ID        ++PV S      
Sbjct  304  DGLGYRFELIPDTNGGMSAAGIVLAESTMRSNKGGEFIIDLGANSNGRSTPVNSMSPVCS  363

Query  316  --sSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAV  152
              SSGDF   L P  +  GFVMS  V+GEGK SK  VQ++++HV C EDAA F+ALAAA+
Sbjct  364  PRSSGDFGYGLWPFCMYRGFVMSASVEGEGKCSKPSVQVSVQHVNCTEDAAAFVALAAAI  423

Query  151  DLSIEACRPF-RRLRR  107
            DLS++ACR F +RLR+
Sbjct  424  DLSMDACRLFSQRLRK  439



>gb|KHN16657.1| hypothetical protein glysoja_002754 [Glycine soja]
Length=189

 Score =   166 bits (420),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 121/195 (62%), Gaps = 16/195 (8%)
 Frame = -3

Query  673  VKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWR  494
            + IHDLSGS VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWR
Sbjct  2    IMIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASESSWKPWGRLEAWR  61

Query  493  ERGIRDSICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr  317
            ERG  D +  +  L SD GP     + ++E  +S +KGG+F ID                
Sbjct  62   ERGPVDGLGYKVELFSDNGP--ANRIPIAEGTMSVKKGGQFCID------------YKVI  107

Query  316  sSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
                  +  P   GFVM   V GEGK SK +VQ+  +HVTC+ DAA+F+AL+AA+DLS++
Sbjct  108  KDAGLGSRLPGEEGFVMGSTVDGEGKVSKPVVQVGAQHVTCMADAALFIALSAAIDLSMD  167

Query  136  ACRPF-RRLRRGTRH  95
            ACR F  +LR+   H
Sbjct  168  ACRLFSHKLRKELCH  182



>ref|XP_002301131.1| hypothetical protein POPTR_0002s11320g [Populus trichocarpa]
 gb|EEE80404.1| hypothetical protein POPTR_0002s11320g [Populus trichocarpa]
Length=445

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 163/252 (65%), Gaps = 20/252 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFS-----QDRVQ-----QVDPLsnfsssfvdssDIEIERRERKGWKVKIH  662
            NI+QP+F+CKFS      DR Q     Q +P S+ S      S+ E   +ERKGW + IH
Sbjct  187  NIRQPVFTCKFSLRTTTGDRSQRSRSLQGEPNSSRSWLSSFGSERERPLKERKGWSITIH  246

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS VAAA + TPFVPS G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG 
Sbjct  247  DLSGSPVAAASMVTPFVPSPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGS  303

Query  481  RDSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDK-QvraaaspvpsprsS  311
             D +  RF L+ D  G      ++++E  +S+ KGG+F ID        A SPV SPR S
Sbjct  304  SDGLGYRFELIPDTKGSMSAASIVLAESTLSSHKGGKFVIDLGAGSNGRATSPVGSPRGS  363

Query  310  GDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSI  140
            GD+   L P  +  GFVMS  V GEGK SK  V+++++HV C EDAA F+ALAAAVDLS+
Sbjct  364  GDYGHGLWPYCMYRGFVMSASVDGEGKCSKPGVEVSVQHVNCTEDAAAFVALAAAVDLSM  423

Query  139  EACRPF-RRLRR  107
            +AC+ F +RLR+
Sbjct  424  DACQLFSQRLRK  435



>ref|XP_008352747.1| PREDICTED: uncharacterized protein LOC103416271 [Malus domestica]
Length=444

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 161/251 (64%), Gaps = 21/251 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssf---vdssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L +   S    + S   E ER  +ERKGW + +HD
Sbjct  189  NIRQPVFTCKFSFRTSADRTQRSRSLQSEQGSSRSWLSSFGSERERPGKERKGWSITVHD  248

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  249  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DNTWKPWGRLEAWRERGGA  305

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---sprsSG  308
            D +  RF L+ D    G  ++++E  IS  KGG+F +D          P+    SPR SG
Sbjct  306  DGLGYRFELIPD--TSGAGIVLAESTISLNKGGKFVLDLGSGSSNRLGPISPGCSPRGSG  363

Query  307  DFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
            DF   L P  +  GFVMS +V+GEG+ SK  V+++++HV C EDAA F+ALAAAVDLS++
Sbjct  364  DFGYGLWPYCMXRGFVMSAKVEGEGRCSKPAVEVSVQHVNCTEDAAAFVALAAAVDLSMD  423

Query  136  ACRPF-RRLRR  107
            ACR F +RLR+
Sbjct  424  ACRLFSQRLRK  434



>emb|CDM84004.1| unnamed protein product [Triticum aestivum]
Length=440

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 143/249 (57%), Gaps = 28/249 (11%)
 Frame = -3

Query  805  KQPIFSCKFSQDR--VQQVDPLsnfsssfvdssDIE-------------IERRERKGWKV  671
            +QP+F+C+FS  R  V+     S  S +   S  +               +R +RKGW V
Sbjct  196  RQPVFTCRFSAGRRAVRTRSLTSESSMTRSPSRRLRSWLSTLHGDGDKRTQRDQRKGWMV  255

Query  670  KIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRE  491
             IHDLSGS VAAA + TPFVPS G   V R+NPGAWLI++P      SW+PW +LEAWRE
Sbjct  256  TIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPGAWLILQPTGAGPSSWKPWARLEAWRE  315

Query  490  RGIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsS  311
            RG  D++  R  L+ D       + +++  ISA++GG+F ID             +    
Sbjct  316  RGPVDALGYRLELVFDSGPVECAVPIAQSSISAKRGGQFVIDP------------ATFPE  363

Query  310  GDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
            G   A  P  GGFVM   V+GEGK S+  VQ+ ++HV C+ D A+F+AL+AAVDL ++AC
Sbjct  364  GSAGAAWPFAGGFVMGSTVEGEGKASRPTVQVGVQHVACMGDVAVFIALSAAVDLCMDAC  423

Query  130  RPF-RRLRR  107
            + F  RLR+
Sbjct  424  KLFSHRLRK  432



>gb|KHN40365.1| hypothetical protein glysoja_000863 [Glycine soja]
Length=190

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 123/195 (63%), Gaps = 16/195 (8%)
 Frame = -3

Query  673  VKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWR  494
            + IHDLSGS VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWR
Sbjct  2    IIIHDLSGSPVAAASMITPFVPSPGSDRVSRSNPGAWLILRPNGACVSSWKPWGRLEAWR  61

Query  493  ERGIRDSICCRFHL-LSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr  317
            ERG  D +  +F L + +GP  G  + ++E  ++ +KGG+F ID      +         
Sbjct  62   ERGPVDGLGYKFELVIENGPTNG--IPIAEATMNVKKGGQFCIDYKVMRDSGLLGSRLQG  119

Query  316  sSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
                         GFVM   V+GEGK SK +VQ+  +HVTC+ DAA+F+AL+AAVDLS++
Sbjct  120  K------------GFVMGSTVEGEGKVSKPVVQVGAQHVTCMADAALFIALSAAVDLSMD  167

Query  136  ACRPF-RRLRRGTRH  95
            AC+ F  +LRR   H
Sbjct  168  ACQLFSHKLRRELCH  182



>gb|KHM99820.1| hypothetical protein glysoja_017518 [Glycine soja]
Length=189

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 120/191 (63%), Gaps = 16/191 (8%)
 Frame = -3

Query  673  VKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWR  494
            + IHDLSGS VAAA + TPFVPS G D V RSNPGAWLI+RP+     SW+PWG+LEAWR
Sbjct  2    IMIHDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLILRPNGASESSWKPWGRLEAWR  61

Query  493  ERGIRDSICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr  317
            ERG  D +  +  L SD GP     + ++E  +S +KGG+F ID                
Sbjct  62   ERGPVDGLGYKVELFSDNGP--ANRIPIAEGTMSVKKGGQFCID------------YKVI  107

Query  316  sSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
                  +  P   GFVM   V GEGK SK +VQ+  +HVTC+ DAA+F+AL+A+VDLS++
Sbjct  108  KDAGLGSRLPGEEGFVMGSTVDGEGKVSKPVVQVGAQHVTCMADAALFIALSASVDLSMD  167

Query  136  ACRPF-RRLRR  107
            ACR F  +LR+
Sbjct  168  ACRLFSHKLRK  178



>ref|XP_011017042.1| PREDICTED: uncharacterized protein LOC105120505 [Populus euphratica]
Length=445

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 162/252 (64%), Gaps = 20/252 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFS----------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIH  662
            NI+QP+F+CKFS          + R  Q +P S+ S      S+ E   +ERKGW + +H
Sbjct  187  NIRQPVFTCKFSFRTTTGDRNQRSRSLQGEPNSSRSWLSSFGSERERPLKERKGWSITVH  246

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS VAAA + TPFVPS G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG 
Sbjct  247  DLSGSPVAAASMVTPFVPSPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGS  303

Query  481  RDSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDT-DKQvraaaspvpsprsS  311
             D +  RF L+ D  G      ++++E  +S+ KGG+F ID        A SPV SPR S
Sbjct  304  SDGLGYRFELIPDTKGSMSAASIVLAESTLSSHKGGKFVIDLGGGSNGRATSPVGSPRGS  363

Query  310  GDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSI  140
            GD+   L P  +  GFVMS  V GEGK SK  V+++++HV C EDAA F+ALAAAVDLS+
Sbjct  364  GDYGHGLWPYCMYRGFVMSASVDGEGKCSKPGVEVSVQHVNCTEDAAAFVALAAAVDLSM  423

Query  139  EACRPF-RRLRR  107
            +AC+ F +RLR+
Sbjct  424  DACKFFSQRLRK  435



>ref|XP_009335470.1| PREDICTED: uncharacterized protein LOC103928190 [Pyrus x bretschneideri]
Length=444

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 159/251 (63%), Gaps = 21/251 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQ-----QVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            N++QP+F+C FS     DR Q     Q D  S+ S      S+ E   RERKGW + +HD
Sbjct  189  NLRQPVFTCTFSFRTPADRTQRSRSVQSDQGSSRSWLSSFGSERERHGRERKGWSITVHD  248

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  249  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DNTWKPWGRLEAWRERGGA  305

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---sprsSG  308
            D +  RF L+ D    G  ++++E  +S  KGG+F +D        A P     SPR SG
Sbjct  306  DGLGYRFELIPD--TSGAGVVLAESTLSLNKGGKFVLDLGSGSSNRAGPNSPGCSPRGSG  363

Query  307  DFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
            DF   L P  +  GFVMS +VQGEG+ SK  V+++++HV C EDAA F+ALAAAVDLS++
Sbjct  364  DFGYGLWPFCMYRGFVMSAKVQGEGRCSKPAVEVSVQHVNCTEDAAAFVALAAAVDLSMD  423

Query  136  ACRPF-RRLRR  107
            ACR F +RLR+
Sbjct  424  ACRLFSQRLRK  434



>ref|XP_008339055.1| PREDICTED: uncharacterized protein LOC103402092 [Malus domestica]
Length=444

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 160/251 (64%), Gaps = 21/251 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssf---vdssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L +   S    + S   E ER  +ERKGW + +HD
Sbjct  189  NIRQPVFTCKFSFRTSADRTQRSRSLQSEQGSSRSWLSSFGSERERPGKERKGWSITVHD  248

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  249  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DNTWKPWGRLEAWRERGGA  305

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---sprsSG  308
            D    RF L+ D    G  ++++E  IS  KGG+F +D          P+    SPR SG
Sbjct  306  DGXGYRFELIPD--TSGAGIVLAESTISLNKGGKFVLDLGSGSSNRLGPISPGCSPRGSG  363

Query  307  DFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
            DF   L P  +  GFVMS +V+GEG+ SK  V+++++HV C EDAA F+ALAAAVDLS++
Sbjct  364  DFGYGLWPYCMXRGFVMSAKVEGEGRCSKPAVEVSVQHVNCTEDAAAFVALAAAVDLSMD  423

Query  136  ACRPF-RRLRR  107
            ACR F +RLR+
Sbjct  424  ACRLFSQRLRK  434



>ref|XP_009357220.1| PREDICTED: uncharacterized protein LOC103947956 [Pyrus x bretschneideri]
Length=444

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 122/251 (49%), Positives = 160/251 (64%), Gaps = 21/251 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssf---vdssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L +   S    + S   E ER  +ERKGW + +HD
Sbjct  189  NIRQPVFTCKFSFRASADRTQRSRSLQSEQGSSRSWLSSFGSERERPGKERKGWSITVHD  248

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RS+PG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  249  LSGSPVAAASMVTPFVASPGSDRVSRSHPGSWLILRPG---DNTWKPWGRLEAWRERGGA  305

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---sprsSG  308
            D +  RF L+ D    G  ++++E  IS  KGG+F +D          P     SPR SG
Sbjct  306  DGLGYRFELIPD--TSGAGIVLAESTISLNKGGKFVLDLGSGSSNRLGPNSPGCSPRGSG  363

Query  307  DFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
            DF   L P  +  GFVMS +V+GEG+ SK  V+++++HV C EDAA F+ALAAAVDLS++
Sbjct  364  DFGYGLWPYSMYRGFVMSAKVEGEGRCSKPAVEVSVQHVNCTEDAAAFVALAAAVDLSMD  423

Query  136  ACRPF-RRLRR  107
            ACR F +RLR+
Sbjct  424  ACRLFSQRLRK  434



>ref|XP_004299850.1| PREDICTED: uncharacterized protein LOC101308766 [Fragaria vesca 
subsp. vesca]
Length=453

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 160/257 (62%), Gaps = 25/257 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQ-----QVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q       D   + S      S+ E   RERKGW + +HD
Sbjct  190  NIRQPVFTCKFSFRNTGDRTQRSRSSHSDQSGSRSWLSSFGSERERPGRERKGWSITVHD  249

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG WLI+RP      +WQPWG+LEAWRERG  
Sbjct  250  LSGSPVAAASMVTPFVASPGSDRVSRSNPGCWLILRPG---DGTWQPWGRLEAWRERGGA  306

Query  478  DSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDT-------DKQvraaaspvp  326
            D +  RF L+ D  G    G ++++E  +S  KGG+F +D        +K      SP  
Sbjct  307  DGLGYRFELIPDTNGGMSAGGIVLAESTLSLNKGGKFVLDLGSNSGSGNKAPVVPNSPAC  366

Query  325  sprsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAA  155
            SP+SSGDF   L P  +  GFVMS RV+GE + SK  V+++++HVTC EDAA ++ALAAA
Sbjct  367  SPKSSGDFGYGLWPYCLYRGFVMSARVEGERRCSKPTVEVSVQHVTCTEDAAAYVALAAA  426

Query  154  VDLSIEACRPF-RRLRR  107
            VDL ++ACR F +RLR+
Sbjct  427  VDLCMDACRLFSQRLRK  443



>emb|CDY57930.1| BnaA06g37990D [Brassica napus]
Length=437

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 114/250 (46%), Positives = 161/250 (64%), Gaps = 19/250 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRV---QQVDPLsnfsssfvdssDIEIER--RERKGWKVKIHD  659
            +I+QP+F+CKFS     DR    + + P ++   S+++S   E ER  +ERKGW + +HD
Sbjct  183  SIRQPVFTCKFSCRNTSDRTMRSRSLPPETSVPRSWLNSFGSERERPGKERKGWSITVHD  242

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRER G 
Sbjct  243  LSGSPVAMASIVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGGA  299

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQ-vraaaspvpsprsSGD  305
             D +  RF L+ DG  G G ++++E  IS+ +GG+F I+        + S       SGD
Sbjct  300  TDGLGYRFELIPDGSSGAG-IVLTESSISSHRGGKFSIELGSSPTAGSVSRTRRRSGSGD  358

Query  304  FSA---LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEA  134
            +     L     GFVMS  V+GEGK SK  V++++ HV+C+EDAA ++AL+AA+DLS++A
Sbjct  359  YGYGLWLGSGYKGFVMSASVEGEGKCSKPCVEVSVHHVSCMEDAAAYVALSAAIDLSMDA  418

Query  133  CRPF-RRLRR  107
            CR F +R+R+
Sbjct  419  CRLFNQRMRK  428



>ref|XP_007018388.1| Formin-like protein 18 [Theobroma cacao]
 gb|EOY15613.1| Formin-like protein 18 [Theobroma cacao]
Length=445

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 164/255 (64%), Gaps = 25/255 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            NI+QP+F+CKFS         + R  Q +P S+        S+ E   +ERKGW + +HD
Sbjct  186  NIRQPVFTCKFSFRSTGDRNQRSRSLQSEPSSSRGWLSSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PW +LEAWRERG  
Sbjct  246  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWARLEAWRERGSS  302

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID-----TDKQvr--aaaspvpsp  320
            D +  RF L+ D       ++++E  +S+ KGG+F ID     T+ +    +A SP  SP
Sbjct  303  DGLGYRFELIPD--MSAAAIVLAESTLSSGKGGKFVIDLGGGGTNGRATPGSATSPACSP  360

Query  319  rsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVD  149
            RSSGDF   L P  V  GFVMS RV+GEGK SK  V+++++HV C EDAA F+ALAAAVD
Sbjct  361  RSSGDFGYGLWPFCVYRGFVMSARVEGEGKCSKPCVEVSVQHVNCTEDAAAFVALAAAVD  420

Query  148  LSIEACRPF-RRLRR  107
            LS++ACR F +RLR+
Sbjct  421  LSMDACRLFSQRLRK  435



>ref|XP_002285542.1| PREDICTED: uncharacterized protein LOC100245533 [Vitis vinifera]
Length=447

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 158/256 (62%), Gaps = 24/256 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            +I+QP+F+CKFS         + R  Q + +S+ +      S+ E   RERKGW + +HD
Sbjct  185  SIRQPVFTCKFSFRNTGGPNQRSRSLQSETISSRTWLSSFGSERERPGRERKGWSITVHD  244

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  245  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGSS  301

Query  478  DSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr----  317
            D +  RF L+ D  G  G   +++SE  + + KGG+F ID        A+P  +      
Sbjct  302  DGLGYRFELIPDTNGGMGAAGIVLSESTLGSNKGGKFVIDLGGGSNGRATPGSATSPACS  361

Query  316  --sSGDFS-ALSPVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAV  152
              SSGDF   L P     GFVMS  V+GEGK SK  V+++++HV C EDAA F+ALAAAV
Sbjct  362  PRSSGDFGYGLWPYCSYRGFVMSATVEGEGKCSKPSVEISVQHVNCTEDAAAFVALAAAV  421

Query  151  DLSIEACRPF-RRLRR  107
            DLS++ACR F  +LR+
Sbjct  422  DLSMDACRLFSHKLRK  437



>ref|XP_010458327.1| PREDICTED: uncharacterized protein LOC104739608 isoform X2 [Camelina 
sativa]
 ref|XP_010475861.1| PREDICTED: uncharacterized protein LOC104755214 [Camelina sativa]
Length=461

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 121/275 (44%), Positives = 163/275 (59%), Gaps = 40/275 (15%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvd---ssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L   +S       S   E ER  +ERKGW + +HD
Sbjct  187  NIRQPVFTCKFSFRHTGDRTQRSRSLPTDTSVSRSWLNSFGSERERPGKERKGWSITVHD  246

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP  C   +W+PWG+LEAWRER G 
Sbjct  247  LSGSPVAMASIVTPFVASPGSDRVSRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGA  303

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---------------------  365
             D +  RF L+ DG  G G ++++E  IS+ KGG+F I+                     
Sbjct  304  TDGLGYRFELIPDGSSGAG-IVLAESTISSHKGGKFSIELGSSSSSSPTGGVNRSRSRRG  362

Query  364  -TDKQvraaaspvpsprsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVT  197
             +      A+        SGD+   L P  V  GFVMS  V+GEGK SK  V+++++HV+
Sbjct  363  GSGGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKPCVEVSVQHVS  422

Query  196  CVEDAAIFMALAAAVDLSIEACRPF-RRLRRGTRH  95
            C+EDAA ++AL+AA+DLS++ACR F +R+R+   H
Sbjct  423  CMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCH  457



>ref|XP_010232287.1| PREDICTED: uncharacterized protein LOC100822437 [Brachypodium 
distachyon]
Length=450

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 102/251 (41%), Positives = 142/251 (57%), Gaps = 30/251 (12%)
 Frame = -3

Query  805  KQPIFSCKFSQ----DRVQQVDPLsnfsssfvdssD-------------IEIERRERKGW  677
            +QP+F+C+FS     DR + +   S+ + S                       R +RKGW
Sbjct  204  RQPVFTCRFSAGRRADRTRSLTSESSMTRSTSRRLRSWLSTLHGGDGGDARARREQRKGW  263

Query  676  KVKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAW  497
             V IHDLSGS VAAA + TPFVPS G   V R+NPGAWLI++P      SW+PW +LEAW
Sbjct  264  MVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPGAWLILQPTGAGPSSWKPWARLEAW  323

Query  496  RERGIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr  317
            RERG  D++  R  L+ D       + ++E  IS ++GG+F ID             +  
Sbjct  324  RERGPIDALGYRLELVFDSGPVECAVPIAESSISTKRGGQFVIDP------------ATF  371

Query  316  sSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
              G   A  P  GGFVM   V+GEGK S+  VQ+ ++H +C+ D A+F+AL+AAVDL ++
Sbjct  372  PEGAAGASWPFAGGFVMGSTVEGEGKASRPTVQVGVQHASCMGDVAVFVALSAAVDLCMD  431

Query  136  ACRPF-RRLRR  107
            AC+ F +RLR+
Sbjct  432  ACKLFSQRLRK  442



>ref|XP_006307457.1| hypothetical protein CARUB_v10009083mg [Capsella rubella]
 gb|EOA40355.1| hypothetical protein CARUB_v10009083mg [Capsella rubella]
Length=460

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 121/275 (44%), Positives = 163/275 (59%), Gaps = 40/275 (15%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvd---ssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L   +S       S   E ER  +ERKGW + +HD
Sbjct  186  NIRQPVFTCKFSFRHTGDRTQRSRSLPTETSVPRSWLNSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP  C   +W+PWG+LEAWRER G 
Sbjct  246  LSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGA  302

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---------------------  365
             D +  RF L+ DG  G G ++++E  IS+ KGG+F I+                     
Sbjct  303  TDGLGYRFELIPDGSSGAG-IVLAESTISSHKGGKFSIELGSSSSSSPTGGVNRSRSRRG  361

Query  364  -TDKQvraaaspvpsprsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVT  197
             +      A+        SGD+   L P  V  GFVMS  V+GEGK SK  V+++++HV+
Sbjct  362  GSGGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKPCVEVSVQHVS  421

Query  196  CVEDAAIFMALAAAVDLSIEACRPF-RRLRRGTRH  95
            C+EDAA ++AL+AA+DLS++ACR F +R+R+   H
Sbjct  422  CMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCH  456



>emb|CAN62368.1| hypothetical protein VITISV_001847 [Vitis vinifera]
Length=457

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 158/256 (62%), Gaps = 24/256 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            +I+QP+F+CKFS         + R  Q + +S+ +      S+ E   RERKGW + +HD
Sbjct  185  SIRQPVFTCKFSFRNTGGPNQRSRSLQSETISSRTWLSSFGSERERPGRERKGWSITVHD  244

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  245  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGSS  301

Query  478  DSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr----  317
            D +  RF L+ D  G  G   +++SE  + + KGG+F ID        A+P  +      
Sbjct  302  DGLGYRFELIPDTNGGMGAAGIVLSESTLGSNKGGKFVIDLGGGSNGRATPGSATSPACS  361

Query  316  --sSGDFS-ALSPVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAV  152
              SSGDF   L P     GFVMS  V+GEGK SK  V+++++HV C EDAA F+ALAAAV
Sbjct  362  PRSSGDFGYGLWPYCSYRGFVMSATVEGEGKCSKPSVEISVQHVNCTEDAAAFVALAAAV  421

Query  151  DLSIEACRPF-RRLRR  107
            DLS++ACR F  +LR+
Sbjct  422  DLSMDACRLFSHKLRK  437



>ref|XP_010245617.1| PREDICTED: uncharacterized protein LOC104589117 [Nelumbo nucifera]
Length=442

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 161/251 (64%), Gaps = 20/251 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvdssDIEIER--RERKGWKVKIHDLSG  650
            NI+QP+F+CKFS     DR  Q+    + S S++ S   E ER  RERKGW V +HDLSG
Sbjct  186  NIRQPVFTCKFSFRNSGDR-NQLSRSPSSSRSWLSSFGSERERPGRERKGWSVTVHDLSG  244

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VA A + TPFV S G D V RSNPGAWLI+RP      +W+PWG+LEAWRERG  D +
Sbjct  245  SPVAVASMVTPFVASPGSDRVSRSNPGAWLILRPG---DGTWKPWGRLEAWRERGSNDGL  301

Query  469  CCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr----sSG  308
              RF ++SD  G      ++++E  +   KGG+F ID     R+  +   SP     SSG
Sbjct  302  GYRFEVMSDTNGGMSADGIVLAESTLGTGKGGKFVIDMSGSGRSTPASSNSPACSPKSSG  361

Query  307  DFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
            DF   L P  +  GFVMS  V+GEGK SK  V+++++HV C EDAA F+ALAAA+DLS++
Sbjct  362  DFGYGLWPYCMYRGFVMSSTVEGEGKCSKPTVEVSVQHVNCTEDAAAFVALAAAMDLSMD  421

Query  136  ACRPF-RRLRR  107
            ACR F +RLR+
Sbjct  422  ACRLFSQRLRK  432



>ref|XP_004136235.1| PREDICTED: uncharacterized protein LOC101220969 [Cucumis sativus]
 ref|XP_004168124.1| PREDICTED: uncharacterized protein LOC101227231 [Cucumis sativus]
 gb|KGN60303.1| hypothetical protein Csa_3G894510 [Cucumis sativus]
Length=444

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 121/253 (48%), Positives = 157/253 (62%), Gaps = 21/253 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFS---QDRVQQVDPLsnfsssf-vdssDIEIER--RERKGWKVKIHDLSG  650
            NI+QP+F+CKFS    DR Q+   L   SS   + S   E ER  +ERKGW + IHDLSG
Sbjct  185  NIRQPVFTCKFSFRTGDRTQRCRSLPTESSRGWLSSFGSERERPGKERKGWSITIHDLSG  244

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFV S G D V RSNPG+WLI+RP     ++W+PWG+LEAWRERG  D +
Sbjct  245  SPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DDTWKPWGRLEAWRERGGSDGL  301

Query  469  CCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr------s  314
              RF L+ D  G      ++++E  ++  KGG+F ID        ++PV          S
Sbjct  302  GYRFELIPDTNGGMSAAGIVLAESALNINKGGKFLIDLGGSSNGRSTPVNPMSPACSPRS  361

Query  313  SGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLS  143
            SGD+   L P  V  GFVM   V+GEGK SK  V++ ++HV C ED A F+ALAAA+DLS
Sbjct  362  SGDYGYGLWPYCVYRGFVMGASVEGEGKCSKPRVEVGVQHVNCTEDVAAFVALAAAIDLS  421

Query  142  IEACRPF-RRLRR  107
            I+ACR F  +LR+
Sbjct  422  IDACRLFSHKLRK  434



>ref|XP_010490593.1| PREDICTED: uncharacterized protein LOC104768341 [Camelina sativa]
Length=461

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 163/276 (59%), Gaps = 41/276 (15%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvd---ssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L   +S       S   E ER  +ERKGW + +HD
Sbjct  186  NIRQPVFTCKFSFRHTGDRTQRSRSLPTDTSVPRSWLNSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP  C   +W+PWG+LEAWRER G 
Sbjct  246  LSGSPVAMASIVTPFVASPGSDRVSRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGA  302

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---------------------  365
             D +  RF L+ DG  G G ++++E  IS+ KGG+F I+                     
Sbjct  303  TDGLGYRFELIPDGSSGAG-IVLAESTISSHKGGKFSIELGSSSSSSSPTGGVYRSRSRR  361

Query  364  --TDKQvraaaspvpsprsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHV  200
              +      A+        SGD+   L P  V  GFVMS  V+GEGK SK  V+++++HV
Sbjct  362  GGSGGSGGGASPANSPKGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKPCVEVSVQHV  421

Query  199  TCVEDAAIFMALAAAVDLSIEACRPF-RRLRRGTRH  95
            +C+EDAA ++AL+AA+DLS++ACR F +R+R+   H
Sbjct  422  SCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCH  457



>ref|XP_006852767.1| hypothetical protein AMTR_s00033p00137950 [Amborella trichopoda]
 gb|ERN14234.1| hypothetical protein AMTR_s00033p00137950 [Amborella trichopoda]
Length=454

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 124/266 (47%), Positives = 156/266 (59%), Gaps = 34/266 (13%)
 Frame = -3

Query  811  NIKQPIFSCKFS----------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIH  662
            NI+QP+F+CKF              VQ     S         SD E   RERKGW + IH
Sbjct  182  NIRQPVFTCKFGCRPVGERNMRSRNVQSETCTSRSWLGSRGGSDCERPVRERKGWAITIH  241

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS VAAA + TPFVPS G D V R+NPGAWLI+RP      +W+PW +LEAWRERG 
Sbjct  242  DLSGSPVAAASMVTPFVPSPGSDRVSRTNPGAWLILRPG---DGTWKPWARLEAWRERGA  298

Query  481  RDSICCRFHLLSD---GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspv------  329
             D++  RFHLLS+          +L++E  +SA KGG+F ID        A         
Sbjct  299  HDALGYRFHLLSESSSTASMNSSILLAESSLSASKGGKFTIDIGIASTGMAQSNGRVTPG  358

Query  328  ------psprsSGDFS-ALSPVVG----GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDA  182
                   SPRSS DF  AL PVV     GFVMS  V+GEG+ SK  V + ++HV C+EDA
Sbjct  359  TVSPVCSSPRSSADFGHALWPVVQHGLRGFVMSSSVEGEGRCSKPFVHIGVQHVACMEDA  418

Query  181  AIFMALAAAVDLSIEACRPF-RRLRR  107
            A ++ALAAA+DLS++ACR F ++LR+
Sbjct  419  AAYVALAAAIDLSMDACRLFSQKLRK  444



>ref|XP_008219142.1| PREDICTED: uncharacterized protein LOC103319390 [Prunus mume]
Length=447

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 158/252 (63%), Gaps = 22/252 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS----------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIH  662
            NI+QP+F+CKFS          + R   +D  ++ S      S+ E   +ERKGW + +H
Sbjct  191  NIRQPVFTCKFSFRSTGDRGTQRSRSLHLDHGNSRSWLGSFGSERERPGKERKGWSITVH  250

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG 
Sbjct  251  DLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DNTWKPWGRLEAWRERGG  307

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---sprsS  311
             D +  RF L+ D    G  ++++E  +S  KGG+F +D          P     SPR S
Sbjct  308  SDGLGYRFELIPD--TSGAGIVLAESTLSLNKGGKFVLDLGSGSGTRPVPNSPGCSPRGS  365

Query  310  GDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSI  140
            GDF   L P  +  GFVMS +V+GEG+ SK  V+++++HV C EDAA ++ALAAAVDLS+
Sbjct  366  GDFGYGLWPYCLYRGFVMSAKVEGEGRCSKPAVEVSVQHVNCTEDAAAYVALAAAVDLSM  425

Query  139  EACRPF-RRLRR  107
            +ACR F +RLR+
Sbjct  426  DACRLFSQRLRK  437



>ref|XP_002306517.2| hypothetical protein POPTR_0005s19380g [Populus trichocarpa]
 gb|EEE93513.2| hypothetical protein POPTR_0005s19380g [Populus trichocarpa]
Length=448

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 158/258 (61%), Gaps = 26/258 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS------QDRVQ-----QVDPLsnfsssfvdssDIEIERRERKGWKVKI  665
            NI+QP+F+CKFS       DR +     Q +P S+ S      S+IE   +ERKGW + +
Sbjct  184  NIRQPVFTCKFSLRTTGGGDRNRRSISLQEEPSSSRSWLSSFGSEIERPLKERKGWSITV  243

Query  664  HDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG  485
            HDLSGS VAAA + TPFVPS G D V RSNPG+WLI+RP      +W+PWG+LE+WRERG
Sbjct  244  HDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGSWLILRPG---AGTWKPWGRLESWRERG  300

Query  484  IRDSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsS  311
              D +  RF L+ D  G      ++++E  +S+ KGG+F ID         +P  S    
Sbjct  301  SSDGLGYRFELIPDTNGTMSAASIVLAESTLSSHKGGKFVIDLGACSNGRTTPANSASPV  360

Query  310  ------GDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAA  158
                  GD    L P  +  GFVMS  V+GEGK SK  V++ ++HV C EDAA F+ALAA
Sbjct  361  CSPRGGGDHGYGLWPNCMHRGFVMSASVEGEGKCSKPGVEVGVQHVNCTEDAAAFVALAA  420

Query  157  AVDLSIEACRPF-RRLRR  107
            AVDLS++AC+ F +RLR+
Sbjct  421  AVDLSMDACKLFSQRLRK  438



>ref|XP_007222135.1| hypothetical protein PRUPE_ppa005719mg [Prunus persica]
 gb|EMJ23334.1| hypothetical protein PRUPE_ppa005719mg [Prunus persica]
Length=447

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 158/252 (63%), Gaps = 22/252 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS----------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIH  662
            NI+QP+F+CKFS          + R   +D  ++ S      S+ E   +ERKGW + +H
Sbjct  191  NIRQPVFTCKFSFRSTGDRGTQRSRSLHLDHGNSRSWLGSFGSERERPGKERKGWSITVH  250

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG 
Sbjct  251  DLSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DNTWKPWGRLEAWRERGG  307

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---sprsS  311
             D +  RF L+ D    G  ++++E  +S  KGG+F +D          P     SPR S
Sbjct  308  SDGLGYRFELIPD--TSGAGIVLAESTLSLNKGGKFVLDLGSGSGTRPVPNSPGCSPRGS  365

Query  310  GDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSI  140
            GDF   L P  +  GFVMS +V+GEG+ SK  V+++++HV C EDAA ++ALAAAVDLS+
Sbjct  366  GDFGYGLWPYCLYRGFVMSAKVEGEGRCSKPAVEVSVQHVNCTEDAAAYVALAAAVDLSM  425

Query  139  EACRPF-RRLRR  107
            +ACR F +RLR+
Sbjct  426  DACRLFSQRLRK  437



>ref|NP_172473.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC34331.1| Unknown protein [Arabidopsis thaliana]
 gb|AAR92283.1| At1g10020 [Arabidopsis thaliana]
 gb|AAS99692.1| At1g10020 [Arabidopsis thaliana]
 gb|AEE28529.1| uncharacterized protein AT1G10020 [Arabidopsis thaliana]
Length=461

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 120/276 (43%), Positives = 163/276 (59%), Gaps = 41/276 (15%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvd---ssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L   +S       S   E ER  +ERKGW + +HD
Sbjct  186  NIRQPVFTCKFSCRHTGDRTQRSRSLPTETSVSRSWLNSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP  C   +W+PWG+LEAWRER G 
Sbjct  246  LSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGA  302

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---------------------  365
             D +  RF L+ DG  G G ++++E  IS+ +GG+F I+                     
Sbjct  303  TDGLGYRFELIPDGSSGAG-IVLAESTISSHRGGKFSIELGSSPSSSSPTSVVNRSRSRR  361

Query  364  --TDKQvraaaspvpsprsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHV  200
              +      A+        SGD+   L P  V  GFVMS  V+GEGK SK  V+++++HV
Sbjct  362  GGSSGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKPCVEVSVQHV  421

Query  199  TCVEDAAIFMALAAAVDLSIEACRPF-RRLRRGTRH  95
            +C+EDAA ++AL+AA+DLS++ACR F +R+R+   H
Sbjct  422  SCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCH  457



>ref|XP_006417503.1| hypothetical protein EUTSA_v10007581mg [Eutrema salsugineum]
 gb|ESQ35856.1| hypothetical protein EUTSA_v10007581mg [Eutrema salsugineum]
Length=461

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 121/275 (44%), Positives = 170/275 (62%), Gaps = 40/275 (15%)
 Frame = -3

Query  811  NIKQPIFSCKFS-------QDRVQQVDPLsnfsssfvdssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS         R + + P ++   S+++S   E ER  +ERKGW + +HD
Sbjct  185  NIRQPVFTCKFSCRHTGDRTMRTRSLPPETSVPRSWLNSFGSERERPGKERKGWSITVHD  244

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP  C   +W+PWG+LEAWRER G+
Sbjct  245  LSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGDC---TWKPWGRLEAWRERGGV  301

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---------------------  365
             D +  RF L+ DG  G G ++++E  IS+ +GG+F I+                     
Sbjct  302  TDGLGYRFELIPDGSSGAG-IVLAESTISSHRGGKFSIELRSSSSSPPGGVNRSRSRSGG  360

Query  364  -TDKQvraaaspvpsprsSGDF-SALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVT  197
                     ASP  SPR SGD+ + + P  V  GFVMS  V+ EGK SK  V+++++HV+
Sbjct  361  SGGGSSGGGASPSNSPRGSGDYGNGVWPWSVYKGFVMSASVEAEGKCSKPCVEVSVQHVS  420

Query  196  CVEDAAIFMALAAAVDLSIEACRPF-RRLRRGTRH  95
            C+EDAA ++AL+AA+DLS++ACR F +R+R+   H
Sbjct  421  CMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCH  455



>ref|XP_002892543.1| hypothetical protein ARALYDRAFT_888260 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68802.1| hypothetical protein ARALYDRAFT_888260 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 165/276 (60%), Gaps = 41/276 (15%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvd---ssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L   +S       S   E ER  +ERKGW + +HD
Sbjct  186  NIRQPVFTCKFSCRHTGDRTQRSRSLPTETSVPRSWLNSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP  C   +W+PWG+LEAWRER G 
Sbjct  246  LSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGA  302

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprs----  314
             D +  RF L+ DG  G G ++++E  IS+ +GG+F I+      +++      RS    
Sbjct  303  TDGLGYRFELIPDGSSGAG-IVLAESTISSHRGGKFSIELGSSSSSSSPTSGVNRSRSHR  361

Query  313  -------------------SGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHV  200
                               SGD+   L P  V  GFVMS  V+GEGK SK  V+++++HV
Sbjct  362  GGSSGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKPCVEVSVQHV  421

Query  199  TCVEDAAIFMALAAAVDLSIEACRPF-RRLRRGTRH  95
            +C+EDAA ++AL+AA+DLS++ACR F +R+R+   H
Sbjct  422  SCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCH  457



>ref|XP_008466095.1| PREDICTED: uncharacterized protein LOC103503621 [Cucumis melo]
 ref|XP_008466096.1| PREDICTED: uncharacterized protein LOC103503621 [Cucumis melo]
Length=444

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 157/254 (62%), Gaps = 23/254 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS---QDRVQQVDPLsnfsssf-vdssDIEIER--RERKGWKVKIHDLSG  650
            NI+QP+F+CKFS    DR Q+   L   SS + + S   E ER  +ERKGW + IHDLSG
Sbjct  185  NIRQPVFTCKFSFRTGDRTQRSRSLPTESSRWWLSSFGSERERPGKERKGWSITIHDLSG  244

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSI  470
            S VAAA + TPFV S G D V RSNPG+WLI+RP     ++W+PWG+LEAWRERG  D +
Sbjct  245  SPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DDTWKPWGRLEAWRERGGSDGL  301

Query  469  CCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr------s  314
              RF L+ D  G      ++++E  ++  KGG+F ID        ++PV          S
Sbjct  302  GYRFELIPDTNGGMSAAGIVLAESALNINKGGKFLIDLGGSSNGRSTPVNPMSPACSPRS  361

Query  313  SGDFSALSP----VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDL  146
            SGD+    P    V  GFVM   V+GEGK SK  V++ ++HV C ED A F+ALAAA+DL
Sbjct  362  SGDY-GYGPWPYCVYRGFVMGASVEGEGKCSKPRVEVGVQHVNCTEDVAAFVALAAAIDL  420

Query  145  SIEACRPF-RRLRR  107
            SI+ACR F  +LR+
Sbjct  421  SIDACRLFSHKLRK  434



>ref|XP_011011605.1| PREDICTED: uncharacterized protein LOC105116107 [Populus euphratica]
Length=448

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 162/258 (63%), Gaps = 26/258 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS------QDRVQ-----QVDPLsnfsssfvdssDIEIERRERKGWKVKI  665
            NI+QP+F+CKFS       DR +     Q +P S+ S      S+ E   +ERKGW + +
Sbjct  184  NIRQPVFTCKFSLRTTGGGDRNRRSISLQEEPSSSRSWVSSFGSERERPLKERKGWSITV  243

Query  664  HDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG  485
            HDLSGS VAAA + TPFVPS G D V RSNPG+WLI+RP      +W+PWG+LE+WRER 
Sbjct  244  HDLSGSPVAAASMVTPFVPSRGSDRVSRSNPGSWLILRPG---AGTWKPWGRLESWRERS  300

Query  484  IRDSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTD------KQvraaaspv  329
              D +  RF L+ D  G      +L++E  +S+ KGG+F ID             +ASPV
Sbjct  301  SSDGLGYRFELIPDTNGTMSAASILLAECTLSSHKGGKFVIDLGACSNGRTTPENSASPV  360

Query  328  psprsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAA  158
             SPR SGD    L P  +  GFVMS  V+GEGK SKL V++ + HV C EDAA F+ALAA
Sbjct  361  CSPRGSGDHGYGLWPNCLHSGFVMSASVEGEGKCSKLGVEVGVPHVNCTEDAAAFVALAA  420

Query  157  AVDLSIEACRPF-RRLRR  107
            AVDLS++AC+ F +RLR+
Sbjct  421  AVDLSMDACKLFSQRLRK  438



>ref|XP_010061596.1| PREDICTED: uncharacterized protein LOC104449221 [Eucalyptus grandis]
 gb|KCW68587.1| hypothetical protein EUGRSUZ_F02199 [Eucalyptus grandis]
Length=464

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 161/262 (61%), Gaps = 25/262 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIER--RERKGWKVKI  665
            NI+QP+F+C+FS           R + +   S+ S +++ S   E E+  RERKGW + +
Sbjct  199  NIRQPVFTCEFSFRSHNGDHHAQRSRSLPSESSCSRNWLSSFGSEREKPGRERKGWSITV  258

Query  664  HDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG  485
            HDLSGS VA A + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG
Sbjct  259  HDLSGSPVATASMVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERG  315

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr----  317
              DS+ CRF ++ D    G  +++SE  +S++ GG F ID         +   S      
Sbjct  316  GSDSLGCRFEIIPDSAGAGAGVVVSESTLSSKSGGRFQIDLGSNGGNGRATPGSAGSPAC  375

Query  316  ---sSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAA  155
               SSGDF   L P  +  GFVM+  V+GEGK SK  V+++++HV C EDAA F+ALAAA
Sbjct  376  SPRSSGDFGHGLWPYCMYRGFVMAAGVEGEGKCSKPTVEVSVQHVGCTEDAAAFVALAAA  435

Query  154  VDLSIEACRPF-RRLRRGTRHS  92
            VDLS++AC  F +RLR+   H+
Sbjct  436  VDLSMDACMLFTQRLRKELCHT  457



>ref|XP_004501082.1| PREDICTED: uncharacterized protein LOC101496773 [Cicer arietinum]
Length=453

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 115/262 (44%), Positives = 151/262 (58%), Gaps = 30/262 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFS----------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIH  662
            NI QP+F+CKFS          + R  Q D   + S      S+ E   +ERKGW + +H
Sbjct  185  NISQPVFTCKFSFRNNGCDRNQRSRSLQSDAGGSRSWLSSFGSERERSGKERKGWSITVH  244

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS VAAA + TPFV S G D V  SNPG+WLI+RP      +W+PWG+LEAWRERG 
Sbjct  245  DLSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLILRPG---DGTWKPWGRLEAWRERGG  301

Query  481  RDSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSG  308
             D +  RF L+ D  G    G ++++E  +S  KGG+F ID   +     S   +   + 
Sbjct  302  SDGLGYRFELMPDTNGGMSAGGMVITESTLSLNKGGKFVIDLSSRCGGGGSNGRATPGNA  361

Query  307  DFSALSP--------------VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFM  170
               A SP              V  GFVMS  V+GEG+ SK  V++++ HV C EDAA F+
Sbjct  362  SSPACSPRGSGDYGYGLWPYCVYRGFVMSASVEGEGRCSKPTVEVSVPHVNCTEDAAAFV  421

Query  169  ALAAAVDLSIEACRPF-RRLRR  107
            ALAAAVDLS++ACR F +RLR+
Sbjct  422  ALAAAVDLSVDACRLFSQRLRK  443



>gb|EYU30689.1| hypothetical protein MIMGU_mgv1a0070432mg, partial [Erythranthe 
guttata]
Length=220

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 133/199 (67%), Gaps = 20/199 (10%)
 Frame = -3

Query  694  RERKGWKVKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPW  515
            RERKGW   ++DLSGSAVAAA + TPFVPS G D V RSNPGAWLI+ P+     SW+PW
Sbjct  28   RERKGWMFIVYDLSGSAVAAASMVTPFVPSPGSDRVSRSNPGAWLILCPNGVSISSWKPW  87

Query  514  GKLEAWRERGIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaas  335
            G+LEAWRERG  D +  +F L++D     G   ++E  +S +KGGEF ID  +       
Sbjct  88   GRLEAWRERGPTDGLRYKFELITDAGLTSG-APIAEGTVSVKKGGEFSIDNSRSD-----  141

Query  334  pvpsprsSGDFSALSPVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALA  161
                       SALS ++   GFVM   V+GEGK SK +VQ+ ++HVTC+ DAA+F+ALA
Sbjct  142  -----------SALSFLLKNRGFVMGSSVEGEGKVSKPVVQVGVQHVTCMADAALFVALA  190

Query  160  AAVDLSIEACRPF-RRLRR  107
            AAVDLS++ACR F R+LR+
Sbjct  191  AAVDLSMDACRLFSRKLRK  209



>ref|XP_006356806.1| PREDICTED: uncharacterized protein LOC102599523 [Solanum tuberosum]
Length=448

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 121/258 (47%), Positives = 158/258 (61%), Gaps = 28/258 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssf---vdssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L    SS    + S   E ER  +ERKGW + +HD
Sbjct  186  NIRQPVFTCKFSFRTPGDRNQRSRSLPLEHSSSRGWLSSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  246  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGSA  302

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprs-----  314
            D +  RF L+ D    G  ++++E  +S  KGG+F ID    V       P   +     
Sbjct  303  DGLGYRFELIPDSAATG--IVLAESTLSCSKGGKFVIDLGTSVSTNGKSTPVNSTSPACS  360

Query  313  ---SGDFS-ALSP--VVGGFVMSCRVQGEG--KYSKLLVQLAMRHVTCVEDAAIFMALAA  158
               SGDF   L P  +  GFVMS  V+GEG  K SK  V+++++HV C EDAA F+AL+A
Sbjct  361  PRGSGDFGYGLWPYCMYRGFVMSANVEGEGGSKCSKPTVEVSVQHVNCTEDAAAFVALSA  420

Query  157  AVDLSIEACRPF-RRLRR  107
            A+DLSI+ACR F ++LR+
Sbjct  421  AIDLSIDACRLFSQKLRK  438



>ref|XP_010458326.1| PREDICTED: uncharacterized protein LOC104739608 isoform X1 [Camelina 
sativa]
Length=462

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/276 (43%), Positives = 163/276 (59%), Gaps = 41/276 (15%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvd---ssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L   +S       S   E ER  +ERKGW + +HD
Sbjct  187  NIRQPVFTCKFSFRHTGDRTQRSRSLPTDTSVPRSWLNSFGSERERPGKERKGWSITVHD  246

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP  C   +W+PWG+LEAWRER G 
Sbjct  247  LSGSPVAMASIVTPFVASPGSDRVRRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGA  303

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---------------------  365
             D +  RF L+ DG  G G ++++E  I++ +GG+F I+                     
Sbjct  304  TDGLGYRFELIPDGSSGAG-IVLAESTINSHRGGKFSIELGSSSSSSSPTGGVNRSRSRR  362

Query  364  --TDKQvraaaspvpsprsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHV  200
              +      A+        SGD+   L P  V  GFVMS  V+GEGK SK  V+++++HV
Sbjct  363  GGSGGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKPCVEVSVQHV  422

Query  199  TCVEDAAIFMALAAAVDLSIEACRPF-RRLRRGTRH  95
            +C+EDAA ++AL+AA+DLS++ACR F +R+R+   H
Sbjct  423  SCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCH  458



>ref|XP_004238051.1| PREDICTED: uncharacterized protein LOC101246921 [Solanum lycopersicum]
Length=448

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 158/258 (61%), Gaps = 28/258 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssf---vdssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L    SS    + S   E ER  +ERKGW + +HD
Sbjct  186  NIRQPVFTCKFSFRTPGDRNQRSRSLPLEHSSSRGWLSSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WL++RP      +W+PWG+LEAWRERG  
Sbjct  246  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLVLRPG---DGTWKPWGRLEAWRERGSA  302

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprs-----  314
            D +  RF L+ D    G  ++++E  +S  KGG+F ID    V       P   +     
Sbjct  303  DGLGYRFELIPDSAAAG--IVLAESTLSCSKGGKFVIDLGTSVSTNGKSTPVNSTSPACS  360

Query  313  ---SGDFS-ALSP--VVGGFVMSCRVQGEG--KYSKLLVQLAMRHVTCVEDAAIFMALAA  158
               SGDF   L P  +  GFVMS  V+GEG  K SK  V+++++HV C EDAA F+AL+A
Sbjct  361  PRGSGDFGYGLWPYCMYRGFVMSANVEGEGGSKCSKPTVEVSVQHVNCTEDAAAFVALSA  420

Query  157  AVDLSIEACRPF-RRLRR  107
            A+DLSI+ACR F ++LR+
Sbjct  421  AIDLSIDACRLFSQKLRK  438



>dbj|BAF00981.1| hypothetical protein [Arabidopsis thaliana]
Length=461

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 119/276 (43%), Positives = 162/276 (59%), Gaps = 41/276 (15%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvd---ssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q+   L   +S       S   E ER  +ERKGW + +HD
Sbjct  186  NIRQPVFTCKFSCRHTGDRTQRSRSLPTETSVSRSWLNSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV   G D V RSNPG+WLI+RP  C   +W+PWG+LEAWRER G 
Sbjct  246  LSGSPVAMASIVTPFVAFPGTDRVSRSNPGSWLILRPGDC---TWRPWGRLEAWRERGGA  302

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---------------------  365
             D +  RF L+ DG  G G ++++E  IS+ +GG+F I+                     
Sbjct  303  TDGLGYRFELIPDGSSGAG-IVLAESTISSHRGGKFSIELGSSPSSSSPTSVVNRSRSRR  361

Query  364  --TDKQvraaaspvpsprsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHV  200
              +      A+        SGD+   L P  V  GFVMS  V+GEGK SK  V+++++HV
Sbjct  362  GGSSGSGGGASPANSPRGGSGDYGYGLWPWNVYKGFVMSASVEGEGKCSKPCVEVSVQHV  421

Query  199  TCVEDAAIFMALAAAVDLSIEACRPF-RRLRRGTRH  95
            +C+EDAA ++AL+AA+DLS++ACR F +R+R+   H
Sbjct  422  SCMEDAAAYVALSAAIDLSMDACRLFNQRMRKELCH  457



>ref|XP_010266771.1| PREDICTED: uncharacterized protein LOC104604209 [Nelumbo nucifera]
Length=448

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 158/255 (62%), Gaps = 23/255 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS-----QDRVQQVDPLsnfsssfvdssDI---EIER--RERKGWKVKIH  662
            NI+QP+F+CKFS      DR Q        SSS          E ER  RERKGW + +H
Sbjct  186  NIRQPVFTCKFSFRNSGGDRNQLSRSSQLESSSSRSWLSSLASERERSGRERKGWSITVH  245

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS VA A + TPFV S G D V RSNPGAWLI+RP      +W+PWG+LEAWRERG 
Sbjct  246  DLSGSPVAVASMVTPFVASPGSDRVSRSNPGAWLILRPG---DGTWKPWGRLEAWRERGG  302

Query  481  RDSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTD----KQvraaaspvpsp  320
             D +  RF L+ D  G      ++++E  +   KGG+F IDT          ++SP  SP
Sbjct  303  SDGLGYRFELMPDTNGSMSAAGIVLAESTLGTSKGGKFVIDTSGFGRSTPANSSSPACSP  362

Query  319  rsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVD  149
            R SGDF   L P  +  GFVMS  V GEGK SK +V+++++HV C EDAA F+ALAAAVD
Sbjct  363  RCSGDFGYGLWPYCMYRGFVMSSTVVGEGKCSKPVVEVSVQHVNCTEDAAAFVALAAAVD  422

Query  148  LSIEACRPF-RRLRR  107
            LS++ACR F +++RR
Sbjct  423  LSMDACRLFSQKVRR  437



>gb|KJB58716.1| hypothetical protein B456_009G224000 [Gossypium raimondii]
Length=447

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 157/256 (61%), Gaps = 26/256 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfv---dssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS     DR Q    L +  SS      S   E ER  +ERKGW + +HD
Sbjct  186  NIRQPVFTCKFSFRNTGDRNQGSGSLRSEPSSSRRWLSSFGSERERLGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G   V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  246  LSGSPVAAASMVTPFVASPGSGRVSRSNPGSWLILRPG---GGTWKPWGRLEAWRERGSS  302

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprs-----  314
            D +  RF L+ D       ++++E  +S+ KGG+F ID   +  +     P   +     
Sbjct  303  DGLGYRFELIPD--MSAAAIVLAESTLSSSKGGKFVIDLGGRSGSNGRVTPRSATSPACS  360

Query  313  ---SGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAV  152
               SGDF   L P  V  GFVMS  V+GEGK SK  V+++++HV C EDAA ++ALAAAV
Sbjct  361  PRSSGDFRYGLWPFAVHQGFVMSAGVEGEGKCSKPRVEVSVQHVNCTEDAAAYVALAAAV  420

Query  151  DLSIEACRPF-RRLRR  107
            DLSI+ACR F +RLR+
Sbjct  421  DLSIDACRLFSQRLRK  436



>gb|KFK43302.1| hypothetical protein AALP_AA1G106600 [Arabis alpina]
Length=462

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 160/269 (59%), Gaps = 38/269 (14%)
 Frame = -3

Query  811  NIKQPIFSCKFS-------QDRVQQVDPLsnfsssfvdssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKFS         R + + P S+   S+++S   E ER  +ERKGW + +HD
Sbjct  186  NIRQPVFTCKFSCRNTGDRTMRSRSLPPESSIPRSWLNSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRER G 
Sbjct  246  LSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGGA  302

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvra--------------  344
             D +  RF L+ DG  G G ++++E  IS+ +GG+F I+      +              
Sbjct  303  TDGLGYRFELIPDGSSGAG-IVLAESTISSHRGGKFSIELGSSPTSGVNRTRSRRGGSSG  361

Query  343  -------aaspvpsprsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTC  194
                   A+        SGD+   L P  V  GFVMS  V+GEGK SK  V+++++HV C
Sbjct  362  SGGSGGGASPANSPRGGSGDYGYGLWPWSVYKGFVMSASVEGEGKCSKPCVEVSVQHVIC  421

Query  193  VEDAAIFMALAAAVDLSIEACRPFRRLRR  107
            +EDAA ++AL+AA+DLS++ACR F +  R
Sbjct  422  MEDAAAYVALSAAIDLSMDACRLFNQKMR  450



>ref|XP_009407691.1| PREDICTED: uncharacterized protein LOC103990325 [Musa acuminata 
subsp. malaccensis]
Length=455

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 117/257 (46%), Positives = 149/257 (58%), Gaps = 25/257 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS----------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIH  662
            N +QP+F+C FS          + R  Q +P S         S+ E   +ERKGW VK+H
Sbjct  195  NRRQPVFTCSFSCRHNFGDWNWRSRSTQSEPSSPRRWRSSFGSERERPGKERKGWSVKVH  254

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG-  485
            DLSGS VA A + TPFV S G D V RSNPGAWLI+RP   +  +WQPWG+LEAWRERG 
Sbjct  255  DLSGSPVALASMVTPFVASPGTDRVSRSNPGAWLILRP---VDGTWQPWGRLEAWRERGG  311

Query  484  -IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTD--------KQvraaasp  332
               D +  RF LL D   G G + ++E  ISA KGG+F ID          +   ++   
Sbjct  312  PAGDGLGYRFELLPDTAVGPG-VSLAESTISASKGGKFAIDLTGAGGNPLARTSSSSGRG  370

Query  331  vpsprsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAV  152
                R      + SP   GFVMS  V GEG+  +  V++ ++HV C EDAA F+ALAAAV
Sbjct  371  GKLGRGLSLSPSPSPAYRGFVMSSTVIGEGRSGRPAVEVGVQHVGCAEDAAAFVALAAAV  430

Query  151  DLSIEACRPF-RRLRRG  104
            DLS++ACR F  +LRRG
Sbjct  431  DLSMDACRLFSHKLRRG  447



>ref|XP_003526511.1| PREDICTED: uncharacterized protein LOC100805268 [Glycine max]
Length=456

 Score =   165 bits (418),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 151/265 (57%), Gaps = 33/265 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            NI QP+F+CKFS         + R  Q +P  + S      S+ E   +ERKGW + +HD
Sbjct  185  NISQPVFTCKFSFRNNGDRNHRSRSLQSEPGGSRSWLSSFGSERERPGKERKGWSITVHD  244

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V  SNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  245  LSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLILRPS---DGTWKPWGRLEAWRERGGS  301

Query  478  DSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGD  305
            D +  RF L+ D  G      ++++E  +S  KGG+F ID   +    +    S   +  
Sbjct  302  DGLGYRFELIPDTNGGMSAAGIVLAESTLSNNKGGKFVIDLSCRNGNVSGNGGSNGRATP  361

Query  304  FSALSPVVG------------------GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAA  179
             SA SP                     GFVMS  V+GEG+ SK  V++++ HV C EDAA
Sbjct  362  GSATSPACSPRSSGDYGYGLWPYCMYRGFVMSASVEGEGRCSKPTVEVSVPHVNCTEDAA  421

Query  178  IFMALAAAVDLSIEACRPF-RRLRR  107
             F+ALAAAVDLS++ACR F +RLR+
Sbjct  422  AFVALAAAVDLSVDACRLFSQRLRK  446



>ref|XP_009148322.1| PREDICTED: uncharacterized protein LOC103871783 [Brassica rapa]
Length=451

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 162/265 (61%), Gaps = 34/265 (13%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRV---QQVDPLsnfsssfvdssDIEIER--RERKGWKVKIHD  659
            +I+QP+F+CKFS     DR    + + P ++   S+++S   E ER  +ERKGW + +HD
Sbjct  183  SIRQPVFTCKFSCRNTSDRTMRSRSLPPETSVPRSWLNSFGSERERPGKERKGWSITVHD  242

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-GI  482
            LSGS VA A I TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRER G 
Sbjct  243  LSGSPVAMASIVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGGA  299

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaas-----------  335
             D +  RF L+ DG  G G ++++E  IS+ +GG+F I+      A +            
Sbjct  300  TDGLGYRFELIPDGSSGAG-IVLTESSISSHRGGKFSIELGSSPTAGSVSRTRRRSGGSS  358

Query  334  -----pvpsprsSGDFSA---LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAA  179
                        SGD+     L     GFVMS  V+GEGK SK  V+++++HV+C+EDAA
Sbjct  359  GGTSPASSPRGGSGDYGYGLWLGSGYKGFVMSASVEGEGKCSKPCVEVSVQHVSCMEDAA  418

Query  178  IFMALAAAVDLSIEACRPF-RRLRR  107
             ++AL+AA+DLS++ACR F +R+R+
Sbjct  419  AYVALSAAIDLSMDACRLFNQRMRK  443



>ref|XP_004969897.1| PREDICTED: uncharacterized protein LOC101784603 [Setaria italica]
Length=448

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 140/252 (56%), Gaps = 31/252 (12%)
 Frame = -3

Query  805  KQPIFSCKFSQ----DRVQQVDPLsnfsssfvdssDI--------------EIERRERKG  680
            +QP+F+C+FS      R + + P S+ + S                        R +RKG
Sbjct  201  RQPVFTCRFSAGRRATRSRSLTPQSSMTRSTSRRLRSWLSGTLHGDGRDGSRASREQRKG  260

Query  679  WKVKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEA  500
            W V IHDLSGS VAAA + TPFVPS G   V R+NPG+WLI++       SW+PW +LEA
Sbjct  261  WTVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPGSWLILQATGAGPSSWKPWARLEA  320

Query  499  WRERGIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsp  320
            WRERG  D++  R  L+ D       + ++E  IS ++GG+F ID             + 
Sbjct  321  WRERGPVDALGYRLELVFDSGPHECAVPIAESSISTKRGGQFVIDP------------AT  368

Query  319  rsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSI  140
                   A  P  GGFVM   V+GEG+ S+  VQ+ ++ VTC+ D A+F+AL+AAVDL +
Sbjct  369  FPEATAGAAWPFAGGFVMGSTVEGEGRASRPTVQVGVQRVTCMGDVAVFVALSAAVDLCM  428

Query  139  EACRPF-RRLRR  107
            +AC+ F +RLR+
Sbjct  429  DACKLFSQRLRK  440



>emb|CDY20666.1| BnaC08g13920D [Brassica napus]
Length=447

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 116/258 (45%), Positives = 160/258 (62%), Gaps = 23/258 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS-----QDRVQQVDPLsnfsssf---vdssDIEIER--RERKGWKVKIH  662
            +I QP+F+CKFS      DR  +   L   +S     ++S   E ER  +ERKGW + +H
Sbjct  188  SIPQPVFTCKFSCRNTTGDRTIRSRSLPTETSVPRSWLNSFGSERERPNKERKGWSITVH  247

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-G  485
            DLSGS VA A I TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRER G
Sbjct  248  DLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGG  304

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---TDKQvraaaspvpsprs  314
              D +  RF L+ DG  G G ++++E  IS+ +GG+F I+   +        +      S
Sbjct  305  ATDGLGYRFELILDGSSGAG-IVLAESSISSHRGGKFSIELGSSPTGSGVGRTRSRGGGS  363

Query  313  SGDFSALSP----VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDL  146
             G   A SP    V  GFVM+  V+GEGK SK  V+++++HV+C+EDAA ++AL+AAVDL
Sbjct  364  GGASPANSPRGGSVQKGFVMAASVEGEGKCSKPCVEVSVQHVSCMEDAAAYVALSAAVDL  423

Query  145  SIEACRPF-RRLRRGTRH  95
            S++ACR F +R+R+   H
Sbjct  424  SMDACRLFNQRMRKELSH  441



>emb|CDY31054.1| BnaA08g26040D [Brassica napus]
Length=447

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 158/254 (62%), Gaps = 23/254 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS-----QDRVQQVDPLsnfsssf---vdssDIEIER--RERKGWKVKIH  662
            +I+QP+F+CKFS      DR  +   L   +S     ++S   E ER  +ERKGW + +H
Sbjct  188  SIRQPVFTCKFSCRNTTGDRTIRSRSLPTETSVPRSWLNSFGSERERPGKERKGWSITVH  247

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-G  485
            DLSGS VA A I TPFV S G D V RSNPG+WLI+RP      +W PWG+LEAWRER G
Sbjct  248  DLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPG---DGTWNPWGRLEAWRERGG  304

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGD  305
              D +  RF L+ DG  G G ++++E  IS+ +GG+F I+       +       R  G 
Sbjct  305  ATDGLGYRFELILDGSSGAG-IVLAESSISSHRGGKFSIELGSSPTGSGVGRTRSRGGGS  363

Query  304  FS---ALSP----VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDL  146
                 A SP    V  GFVM+  V+GEGK SK  V+++++HV+C+EDAA ++AL+AAVDL
Sbjct  364  GGASPANSPRGGSVQKGFVMAASVEGEGKCSKPCVEVSVQHVSCMEDAAAYVALSAAVDL  423

Query  145  SIEACRPF-RRLRR  107
            S++ACR F +R+R+
Sbjct  424  SMDACRLFNQRMRK  437



>ref|XP_009144481.1| PREDICTED: uncharacterized protein LOC103868126 [Brassica rapa]
Length=447

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 160/254 (63%), Gaps = 23/254 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS-----QDRVQQVDPLsnfsssf---vdssDIEIER--RERKGWKVKIH  662
            +I+QP+F+CKFS      DR  +   L   +S     ++S   E ER  +ERKGW + +H
Sbjct  188  SIRQPVFTCKFSCRNTTGDRTIRSRSLPTETSVPRSWLNSFGSERERPGKERKGWSITVH  247

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER-G  485
            DLSGS VA A I TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRER G
Sbjct  248  DLSGSPVAMASIVTPFVASPGTDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGG  304

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---TDKQvraaaspvpsprs  314
              D +  RF L+ DG  G G ++++E  IS+ +GG+F I+   +        +      S
Sbjct  305  ATDGLGYRFELILDGSSGAG-IVLAESSISSHRGGKFSIELGSSPTGGGVGRTRSRGGGS  363

Query  313  SGDFSALSP----VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDL  146
             G   A SP    V  GFVM+  V+GEGK SK  V+++++HV+C+EDAA ++AL+AAVDL
Sbjct  364  GGASPANSPRGGSVQKGFVMAASVEGEGKCSKPCVEVSVQHVSCMEDAAAYVALSAAVDL  423

Query  145  SIEACRPF-RRLRR  107
            S++ACR F +R+R+
Sbjct  424  SMDACRLFNQRMRK  437



>ref|XP_007137270.1| hypothetical protein PHAVU_009G113400g [Phaseolus vulgaris]
 gb|ESW09264.1| hypothetical protein PHAVU_009G113400g [Phaseolus vulgaris]
Length=449

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 123/258 (48%), Positives = 158/258 (61%), Gaps = 26/258 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvdssDIEIER----RERKGWKVKIHDL  656
            NI QP+F+CKFS     DR  +   L +        S    ER    +ERKGW + +HDL
Sbjct  185  NISQPVFTCKFSFRNTGDRNNRSRSLQSEPGGRSWLSSFGSERERPGKERKGWSIMVHDL  244

Query  655  SGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRD  476
            SGS VAAA + TPFV S G D V  SNPG+WLI+RP      +W+PWGKLEAWRERG  D
Sbjct  245  SGSPVAAASMVTPFVASPGSDRVSCSNPGSWLILRPS---DGTWKPWGKLEAWRERGGSD  301

Query  475  SICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQv---------raaaspv  329
             +  RF L+ D  G      ++++E  +S+ KGG+F ID   +           +A SP 
Sbjct  302  GLGYRFELIPDTNGGMSAAGIVLAESTLSSYKGGKFVIDMSCRTGGSNGRVTPGSATSPA  361

Query  328  psprsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAA  158
             SPRSSGD+   L P  +  GFVMS  V+GEGK SK  V++++ HV C EDAA F+ALAA
Sbjct  362  CSPRSSGDYGYGLWPYCMYRGFVMSASVEGEGKCSKPRVEVSVPHVNCTEDAAAFVALAA  421

Query  157  AVDLSIEACRPF-RRLRR  107
            AVDLS++ACR F +RLR+
Sbjct  422  AVDLSVDACRLFSQRLRK  439



>ref|XP_009399078.1| PREDICTED: uncharacterized protein LOC103983571 [Musa acuminata 
subsp. malaccensis]
Length=472

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 117/255 (46%), Positives = 150/255 (59%), Gaps = 24/255 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            N++QP+F+CKFS           R    +P S+ S      S+ E   +ERKGW V +HD
Sbjct  213  NLRQPVFTCKFSCRNAGDRNLNSRSMHSEPGSSRSWISSFGSERERPGKERKGWSVTVHD  272

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER---  488
            LSGS VA A + TPFV S G D V RSNPGAWL++RP      +W+PWG+LEAWRER   
Sbjct  273  LSGSPVALASMVTPFVASHGTDRVSRSNPGAWLVLRPG---DGTWKPWGRLEAWRERGGS  329

Query  487  GIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpspr---  317
            G  D +  RF LL D   G G + ++E  +SA KGG+F ID         S   SP    
Sbjct  330  GASDGLGYRFELLPDAAMGAG-INLAESTLSATKGGKFTIDLTSAAGTPLSRSTSPGCSP  388

Query  316  -sSGDFS-ALSPVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVD  149
              SGDF  AL P     GFVMS  V GEG+  +  V++ ++ V C EDAA F+ALAAA+D
Sbjct  389  RGSGDFGYALWPFPSYRGFVMSSTVAGEGRSGRPTVEVGVQQVGCTEDAAAFVALAAAID  448

Query  148  LSIEACRPF-RRLRR  107
            LS++ACR F  +LR+
Sbjct  449  LSMDACRLFSHKLRK  463



>ref|XP_011088149.1| PREDICTED: uncharacterized protein LOC105169457 [Sesamum indicum]
Length=426

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 115/263 (44%), Positives = 156/263 (59%), Gaps = 30/263 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            N+KQP+F+CKFS         + R    +P ++ S     ++D E   +ERKGW + IHD
Sbjct  166  NVKQPVFTCKFSFRNSGERTLRSRSSLSEPSTSTSCFSSGAADNEQPLKERKGWSITIHD  225

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFVPS G + V RSNPGAWLI+RP      +W+PWG+LEAWRER   
Sbjct  226  LSGSPVAAASMVTPFVPSPGTNRVSRSNPGAWLILRPG---HGTWKPWGRLEAWRERSNG  282

Query  478  DSICCRFHLLSDGPEGGGDLL-MSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDF  302
            D +  RF L+   P+GG D + ++   IS + GG+F ID         SP  S   S   
Sbjct  283  DHLGYRFDLI---PDGGIDTIPLANSSISTKTGGKFSIDITTGPTPMTSPNSSFDLSSGS  339

Query  301  SALSP-------------VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALA  161
             + S              +  GFVMS  V+G+GK SK  V++ ++HV+C EDAA F+ALA
Sbjct  340  GSGSDLGSTSGSGSWAHLLYRGFVMSSTVEGDGKCSKPDVEVGVQHVSCTEDAAAFVALA  399

Query  160  AAVDLSIEACRPF-RRLRRGTRH  95
            AA+DLS++ACR F ++LR+  R 
Sbjct  400  AAMDLSMDACRSFSQKLRKELRQ  422



>ref|XP_003522725.1| PREDICTED: uncharacterized protein LOC100775992 isoform 1 [Glycine 
max]
Length=457

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 114/266 (43%), Positives = 152/266 (57%), Gaps = 34/266 (13%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            NI QP+F+CKFS         + R  Q +P  + S      S+ E   +ERKGW + +HD
Sbjct  185  NISQPVFTCKFSFRNNGDRNHRSRSLQSEPGGSRSWLSSFGSERERPGKERKGWSITVHD  244

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V  SNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  245  LSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLILRPS---DGTWKPWGRLEAWRERGGS  301

Query  478  DSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTD-KQvraaaspvpsprsSG  308
            D +  RF L+ D  G      ++++E  +S+ KGG+F ID   +     +    S   + 
Sbjct  302  DGLGYRFELIPDTNGGMSAAGIVLAESTLSSNKGGKFVIDLSCRNAVNGSGNGGSNGRAT  361

Query  307  DFSALSPVVG------------------GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDA  182
              SA SP                     GFVMS  V+GEG+ SK  V++++ HV C EDA
Sbjct  362  PGSATSPACSPRSSGDYGYGLWPYCMYRGFVMSASVEGEGRCSKPTVEVSVPHVNCTEDA  421

Query  181  AIFMALAAAVDLSIEACRPF-RRLRR  107
            A F+ALAAAVDLS++ACR F +RLR+
Sbjct  422  AAFVALAAAVDLSVDACRLFSQRLRK  447



>ref|XP_008372951.1| PREDICTED: uncharacterized protein LOC103436305 [Malus domestica]
Length=485

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 149/260 (57%), Gaps = 32/260 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFS-----QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGS  647
            N+KQP+F+CKF      Q R     P +  +      +  E   +ERKGW + IHDLSGS
Sbjct  236  NVKQPVFTCKFGFRNDLQSRSMSSQPGTPRNWLPFGGTHKEQXAKERKGWSITIHDLSGS  295

Query  646  AVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSIC  467
             VAAA + TPFV S G   V RSNPGAWLI+RP+     +WQPWG+LEAW ERG  D++ 
Sbjct  296  PVAAASMVTPFVASPGSHRVSRSNPGAWLILRPN---EGTWQPWGRLEAWLERGGSDNVG  352

Query  466  CRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvps------------  323
             RF L +          ++   + A+ GG+F ID    +  A SP  S            
Sbjct  353  YRFELQNS--------TLANSTLGAKNGGKFSIDLTSSLTPANSPHSSFDLGSGSSSRPG  404

Query  322  prsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAV  152
              S  DF   L P  V  GFVMS  V+G GK SK  V++ ++HVTC EDAA ++ALAAA+
Sbjct  405  SGSGSDFGFGLLPSLVQRGFVMSSTVEGVGKCSKPEVEVGVQHVTCTEDAAAYVALAAAM  464

Query  151  DLSIEACRPF-RRLRRGTRH  95
            DLS++ACRPF ++LR+  R 
Sbjct  465  DLSMDACRPFSQKLRKELRQ  484



>ref|XP_010692653.1| PREDICTED: uncharacterized protein LOC104905738 [Beta vulgaris 
subsp. vulgaris]
Length=461

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 155/264 (59%), Gaps = 33/264 (13%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            NI+QP+F+C FS           R +  +  S         S+ E   +ERKGW + +HD
Sbjct  192  NIRQPVFTCNFSFRSNTSSNHHRRSRSSEQGSGRGWLSTFGSERERPGKERKGWSITVHD  251

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  252  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---EGTWKPWGRLEAWRERGAN  308

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID----------------TDKQvr  347
            D +  +F L+SD     G ++++E  ++  KGG+F ID                   +  
Sbjct  309  DGLGYKFELISDMNANVG-VVLAESTLNTSKGGKFSIDLGCAQFNNSNSNSNASGSNRGT  367

Query  346  aaaspvpsprsSGDF-SALSPVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAI  176
             +    P    SGDF ++L P     GFVM+ RV+GEGK SK  V+++++HV+C ED A 
Sbjct  368  RSPGCSPRRGGSGDFGTSLWPYNAYRGFVMAARVEGEGKCSKPTVEVSVQHVSCTEDVAA  427

Query  175  FMALAAAVDLSIEACRPF-RRLRR  107
            ++ALAAAVDLSI+ACR F ++LR+
Sbjct  428  YVALAAAVDLSIDACRLFSQKLRK  451



>ref|XP_009759768.1| PREDICTED: uncharacterized protein LOC104212246 [Nicotiana sylvestris]
Length=444

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 156/256 (61%), Gaps = 28/256 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssf---vdssDIEIER--RERKGWKVKIHD  659
             I+QP+F+CKFS     DR Q+   L    SS    + S   E ER  +ERKGW + +HD
Sbjct  186  TIRQPVFTCKFSFRTTGDRNQRSRSLPLEHSSSRNWLSSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  246  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGSA  302

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprs-----  314
            DS+  RF L+ D    G  ++++E  +S  KGG+F ID    V       P   +     
Sbjct  303  DSLGYRFELIPDSAAAG--IVLAESTLSCRKGGKFVIDLGTSVSTNGKLTPGNSTSPACS  360

Query  313  ---SGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAV  152
               SGDF   L P  +  GFVMS  V+GE   SK  V+++++HV C EDAA ++AL+AA+
Sbjct  361  PRGSGDFGYGLWPYCMYRGFVMSASVEGE--CSKPTVEVSVQHVNCTEDAAAYVALSAAI  418

Query  151  DLSIEACRPF-RRLRR  107
            DLSI+ACR F ++LR+
Sbjct  419  DLSIDACRLFSQKLRK  434



>ref|XP_011074314.1| PREDICTED: uncharacterized protein LOC105159071 [Sesamum indicum]
Length=455

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 162/262 (62%), Gaps = 31/262 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFS---QDRVQQVDPLsnfsssfv----dssDIEIER--RERKGWKVKIHD  659
            +I+QP+F+CKFS    DR Q+   L    SS       S   E ER  +ERKGW + IHD
Sbjct  188  SIRQPVFTCKFSFRTGDRNQRSRSLPPEHSSGARGWLTSFGSERERPGKERKGWSITIHD  247

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG WLI+RP      +W+PWG+LEAWRERG  
Sbjct  248  LSGSPVAAASMVTPFVASPGSDRVSRSNPGCWLILRPG---DGTWKPWGRLEAWRERGAG  304

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---------TDKQvraaaspvp  326
            D +  RF L+ D     G ++++E  +S  KGG+F ID         T     AAASP  
Sbjct  305  DGLGYRFELIPDSAAAAG-IVLAESTLSCSKGGKFVIDLNGNGNGTPTGTPKSAAASPGC  363

Query  325  sprsSGDFS-ALSP--VVGGFVMSCRVQGE-----GKYSKLLVQLAMRHVTCVEDAAIFM  170
            SPRSSGDF   L P  +  GFVMS  V+GE     GK +   V+++++HV+C EDAA F+
Sbjct  364  SPRSSGDFGYGLWPYCMYRGFVMSASVEGEGRSGRGKTAAPQVEVSVQHVSCTEDAAAFV  423

Query  169  ALAAAVDLSIEACRPF-RRLRR  107
            AL+AA+DLSI+ACR F  +LR+
Sbjct  424  ALSAALDLSIDACRLFSHKLRK  445



>gb|EYU37533.1| hypothetical protein MIMGU_mgv1a018154mg [Erythranthe guttata]
Length=439

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 114/261 (44%), Positives = 155/261 (59%), Gaps = 26/261 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDR-----VQQVDPLsnfsssfvdssDIEIER--RERKGWKVKIHDLS  653
            N+KQP+F+CKFS        ++    LS  S+S    + IE E   +ERKGW + IHDLS
Sbjct  181  NVKQPVFTCKFSFRNSGDWNLRSRSGLSEPSTSTNCFNSIENEHAAKERKGWSITIHDLS  240

Query  652  GSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDS  473
            GS VAAA + TPFVPS G + V RSNPGAWLI+RP   ++ +W+PWG+LEAWR+R   D 
Sbjct  241  GSPVAAASMVTPFVPSPGTNRVSRSNPGAWLILRP---VQSTWKPWGRLEAWRDRTRGDR  297

Query  472  ICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSAL  293
            +  RF LLSD   G   + ++   IS + GG+F +D         SP  S        + 
Sbjct  298  LGYRFDLLSDC--GVDAIPLASSDISTKNGGKFNVDITTGPTPLTSPNSSFDLGSGSGSG  355

Query  292  -------------SPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAV  152
                         + +  GFVMS  V+G+G+ SK  V++ ++HV C EDAA F+ALAAA+
Sbjct  356  SDLGSGYGSGSWANLLYRGFVMSSTVEGDGRCSKPKVEVGVQHVACTEDAAAFVALAAAM  415

Query  151  DLSIEACRPF-RRLRRGTRHS  92
            DLS++ACR F R+LR+  R S
Sbjct  416  DLSMDACRSFSRKLRKELRQS  436



>emb|CDX95423.1| BnaC01g33150D [Brassica napus]
Length=442

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 114/242 (47%), Positives = 147/242 (61%), Gaps = 11/242 (5%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            N KQ +F+CKF        D   N   S    S+ E   +ERKGW V +HDLSGS VA A
Sbjct  202  NTKQAVFTCKFGARSSNSGD--RNQLGSSSMRSEKEQPSKERKGWSVTVHDLSGSPVAMA  259

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI-RDSICCRFH  455
             + TPFVPS G + V+RS+PGAWLI+RPD C   +W+PWG+LEAWRE G   D++  RF 
Sbjct  260  SMVTPFVPSPGSNRVNRSSPGAWLILRPDGC---TWKPWGRLEAWRESGYSSDALGYRFE  316

Query  454  LLSDGPEGGGDLLMSEILISAEKGGEFYID-TDKQvraaaspvpsprsSGDFSALSPVVG  278
            L  DG       + +   +  + GG F ID T     AA++P  SP+ S D  + S    
Sbjct  317  LFQDGI---ATAVSTSSSVGLKNGGSFVIDVTGGNTTAASTPTTSPQGSWDLGSGSSAGR  373

Query  277  GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRLRRGT  101
            GFVMS  V+G GK SK  V++ + HVTC EDAA  +ALAAAVDLS++ACR F ++LR+  
Sbjct  374  GFVMSASVEGVGKRSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACRLFSQKLRKEL  433

Query  100  RH  95
            R 
Sbjct  434  RQ  435



>emb|CBI25109.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 153/244 (63%), Gaps = 14/244 (6%)
 Frame = -3

Query  811  NIKQPIFSCKFS-----QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGS  647
            N++QP+F+CKFS        ++    +S  S+S    S  + + +ERKGW + IHDLSG 
Sbjct  179  NLRQPVFTCKFSFRNSGDRSLRSRSSISEASTSRSWFSSKDEDSKERKGWSITIHDLSGC  238

Query  646  AVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSIC  467
             VAAA +T PFVPS G   V RSNPGAWLI+RP+     +W+PWG+LEAWRE    D + 
Sbjct  239  PVAAASMTNPFVPSPGSGRVKRSNPGAWLILRPE---DGTWKPWGRLEAWRE---PDGLG  292

Query  466  CRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSP  287
             RF LL D   GG  +L++   +S +KGG+F ID+  +    A+       SG  S +  
Sbjct  293  HRFELLPDA-TGGPAVLLASSTLSTKKGGKFTIDSSSR-NFPATTPRGACESGTRSWVES  350

Query  286  VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRLR  110
            V  GFVMS  V GEG+ S   V++ ++HVTC EDAA F+ALAAA+DLS++AC+ F ++LR
Sbjct  351  VYRGFVMSSTVGGEGRCSTPEVEVGVKHVTCTEDAAAFVALAAAMDLSMDACKLFSQKLR  410

Query  109  RGTR  98
            +  R
Sbjct  411  KELR  414



>ref|XP_002274843.1| PREDICTED: uncharacterized protein LOC100254836 [Vitis vinifera]
Length=423

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 153/244 (63%), Gaps = 14/244 (6%)
 Frame = -3

Query  811  NIKQPIFSCKFS-----QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGS  647
            N++QP+F+CKFS        ++    +S  S+S    S  + + +ERKGW + IHDLSG 
Sbjct  179  NLRQPVFTCKFSFRNSGDRSLRSRSSISEASTSRSWFSSKDEDSKERKGWSITIHDLSGC  238

Query  646  AVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSIC  467
             VAAA +T PFVPS G   V RSNPGAWLI+RP+     +W+PWG+LEAWRE    D + 
Sbjct  239  PVAAASMTNPFVPSPGSGRVKRSNPGAWLILRPE---DGTWKPWGRLEAWRE---PDGLG  292

Query  466  CRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFSALSP  287
             RF LL D   GG  +L++   +S +KGG+F ID+  +    A+       SG  S +  
Sbjct  293  HRFELLPDA-TGGPAVLLASSTLSTKKGGKFTIDSSSR-NFPATTPRGACESGTRSWVES  350

Query  286  VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRLR  110
            V  GFVMS  V GEG+ S   V++ ++HVTC EDAA F+ALAAA+DLS++AC+ F ++LR
Sbjct  351  VYRGFVMSSTVGGEGRCSTPEVEVGVKHVTCTEDAAAFVALAAAMDLSMDACKLFSQKLR  410

Query  109  RGTR  98
            +  R
Sbjct  411  KELR  414



>ref|XP_003603662.1| hypothetical protein MTR_3g110630 [Medicago truncatula]
 gb|AES73913.1| DUF1005 family protein [Medicago truncatula]
Length=454

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 152/266 (57%), Gaps = 37/266 (14%)
 Frame = -3

Query  811  NIKQPIFSCKFS-----QDRVQQVDPLsnfsssf---vdssDIEIER--RERKGWKVKIH  662
            NI QP+F+CKFS      DR Q+   + +   +    + S   E ER  +ERKGW + +H
Sbjct  185  NISQPVFTCKFSFRNNSGDRNQRSRSMQSEVGASRSWLSSFGSERERTGKERKGWSITVH  244

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS VAAA + TPFV S G D V  SNPG+WLI+RP      +W+PWG+LEAWRERG 
Sbjct  245  DLSGSPVAAASMVTPFVASPGSDRVSCSNPGSWLILRPG---DGTWKPWGRLEAWRERGG  301

Query  481  RDSICCRFHLLSD--GPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSG  308
             D +  RF L+ D  G    G ++++E  +S  +GG+F +D   +               
Sbjct  302  SDGLGYRFELMPDTNGSMSAGGIVIAESTLSLTRGGKFVLDLSSRCGGGGGSNGRATPG-  360

Query  307  DFSALSPVVG------------------GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDA  182
              +A SPV                    GFVMS  V+GEG+ SK  V++++ HV C EDA
Sbjct  361  --NATSPVCSPRGSGDYGYGLWPYCMYRGFVMSASVEGEGRCSKPTVEVSVPHVNCTEDA  418

Query  181  AIFMALAAAVDLSIEACRPF-RRLRR  107
            A F+ALAAAVDLS++ACR F +RLR+
Sbjct  419  AAFVALAAAVDLSVDACRLFSQRLRK  444



>ref|XP_003630690.1| hypothetical protein MTR_8g102270 [Medicago truncatula]
Length=208

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 125/203 (62%), Gaps = 24/203 (12%)
 Frame = -3

Query  700  ERRERKGWKVKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRP---DPCMRE  530
            +  ERKGW + IHDLSGS VAAA + TPFVPS   D V RSN GAW+I+R          
Sbjct  13   QGNERKGWMIVIHDLSGSPVAAASMITPFVPSPSSDRVSRSNAGAWVILRAIGGSTVSSC  72

Query  529  SWQPWGKLEAWRERGIRDSICCRFHLLSD-GPEGGGDLLMSEILISAEKGGEFYIDTDKQ  353
            SW+ WG LEAWRERG  D +  +  L SD GP     + ++E  +S +KGG+F ID+   
Sbjct  73   SWKSWGHLEAWRERGPIDGLGYKVELFSDNGPVNA--IPIAEGTVSVKKGGKFCIDS---  127

Query  352  vraaaspvpsprsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIF  173
                 + + S    G+         GFVM   V GEGK SK +VQ+ +RHVTC+ DAA+F
Sbjct  128  -----AILGSKWLPGE---------GFVMGSTVSGEGKVSKPVVQVGVRHVTCMPDAALF  173

Query  172  MALAAAVDLSIEACRPF-RRLRR  107
            +AL+AA+DLS++AC+ F  +LR+
Sbjct  174  IALSAAIDLSMDACKFFSHKLRK  196



>ref|XP_008801663.1| PREDICTED: uncharacterized protein LOC103715709 [Phoenix dactylifera]
 ref|XP_008801664.1| PREDICTED: uncharacterized protein LOC103715710 [Phoenix dactylifera]
Length=442

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 112/250 (45%), Positives = 148/250 (59%), Gaps = 22/250 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            +++QP+F+CKFS           R   ++P S+ +      S+ E   +ERKGW V +HD
Sbjct  191  SMRQPVFTCKFSCRNPADRNLGSRSVPMEPCSSRNWLSSFGSERERPLKERKGWSVTVHD  250

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER--G  485
            LSGS VA A + TPFV S G D V RSNPGAWL++RP      +W+PWG+LEAWRER  G
Sbjct  251  LSGSPVALASMVTPFVASPGTDRVSRSNPGAWLVLRPG---GGTWKPWGRLEAWRERGGG  307

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGD  305
              D I  RF L+ D   G G + ++E  +S  KGG+F ID      +            D
Sbjct  308  ASDGIGFRFQLVPDTAMGAG-VPLAESTVSTGKGGKFTIDLTGAGWSPRGSPRRSA---D  363

Query  304  FSALS-PVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEA  134
            F A   P  G  GFVMS  V GEGK S+  V++ ++HV C EDAA F+ALAA+VDLS++A
Sbjct  364  FGAGPWPFSGYRGFVMSSTVDGEGKCSRPSVEVGVQHVGCAEDAAAFVALAASVDLSMDA  423

Query  133  CRPF-RRLRR  107
            CR F  +LR+
Sbjct  424  CRLFTHKLRK  433



>ref|XP_009595727.1| PREDICTED: uncharacterized protein LOC104091979 [Nicotiana tomentosiformis]
Length=444

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 118/256 (46%), Positives = 155/256 (61%), Gaps = 28/256 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssf---vdssDIEIER--RERKGWKVKIHD  659
             I+QP+F+CKFS     DR Q+   L    SS    + S   E ER  +ERKGW + +HD
Sbjct  186  TIRQPVFTCKFSFRTTGDRNQRSRSLPLEHSSSRNWLSSFGSERERPGKERKGWSITVHD  245

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  246  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGSA  302

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprs-----  314
            DS+  RF L+ D    G  ++++E  +S  K G+F ID    V       P   +     
Sbjct  303  DSLGYRFELIPDSAATG--IVLAESTLSCSKAGKFVIDLGTSVSTNGKLTPGNSTSPACS  360

Query  313  ---SGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAV  152
               SGDF   L P  +  GFVMS  V+GE   SK  V+++++HV C EDAA ++AL+AAV
Sbjct  361  PRGSGDFGYGLWPYCMYRGFVMSASVEGE--CSKPTVEVSVQHVNCTEDAAAYVALSAAV  418

Query  151  DLSIEACRPF-RRLRR  107
            DLSI+ACR F ++LR+
Sbjct  419  DLSIDACRLFSQKLRK  434



>ref|XP_010943312.1| PREDICTED: uncharacterized protein LOC105061065 [Elaeis guineensis]
Length=442

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 147/249 (59%), Gaps = 20/249 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            +++QP+F+CKFS         + R    +P S+ S      S+ E   +ERKGW V +HD
Sbjct  191  SMRQPVFTCKFSCRNPADRNLRSRSVAAEPCSSRSWLSSFGSERERPMKERKGWSVTVHD  250

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER--G  485
            LSGS VA A + TPFV S G D V RSNPGAWL++RP      +W+PWG+LEAWRER  G
Sbjct  251  LSGSPVALASMVTPFVASPGTDRVSRSNPGAWLVLRPG---GGTWKPWGRLEAWRERGGG  307

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGD  305
            + D I  RF L+ D     G + ++E  +S  KGG+F ID      +           G 
Sbjct  308  VSDGIGYRFQLVPDTAMSAG-VPLAESTVSTSKGGKFTIDLTGAGGSPGGSPRGSGHFG-  365

Query  304  FSALSPVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEAC  131
             +   P  G  GFVMS  V+GEGK S+  V++ + HV C EDAA F+ALAAAVDLS++AC
Sbjct  366  -AGPWPFSGYRGFVMSSTVEGEGKCSRPSVEIGVHHVGCTEDAAAFVALAAAVDLSMDAC  424

Query  130  RPF-RRLRR  107
            R F  +LR+
Sbjct  425  RLFSHKLRK  433



>ref|XP_010941977.1| PREDICTED: uncharacterized protein LOC105060083 [Elaeis guineensis]
Length=442

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/247 (44%), Positives = 146/247 (59%), Gaps = 16/247 (6%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            +++QP+F+CKFS         + R    +P S+ S      S+ E   +ERKGW V +HD
Sbjct  191  SMRQPVFTCKFSCRSLVDWNLRSRSVPAEPCSSRSWLASFGSERERPIKERKGWSVTVHD  250

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER--G  485
            LSGS VA A + TPFV S G D V RSNPGAWL++RP      +W+PW +LEAWRER  G
Sbjct  251  LSGSPVALASMVTPFVASPGTDRVSRSNPGAWLVLRPG---DGTWKPWARLEAWRERGGG  307

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGD  305
              D +  RFHL+ D     G + ++E  +S  +GG+F ID      + A         G 
Sbjct  308  TSDGLGYRFHLVPDTAMSAG-VPLAESTVSTSRGGKFTIDLTGAGGSPAGSPRGSAEFGA  366

Query  304  FSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
                     GFVMS  V+GEGK S+  V++ ++HV C EDAA F+ALAAA+DLS++ACR 
Sbjct  367  GPWPFSWYRGFVMSSTVEGEGKCSRPSVEVGVQHVGCTEDAAAFVALAAAIDLSMDACRL  426

Query  124  F-RRLRR  107
            F R+LR+
Sbjct  427  FSRKLRK  433



>ref|XP_007201076.1| hypothetical protein PRUPE_ppa006838mg [Prunus persica]
 gb|EMJ02275.1| hypothetical protein PRUPE_ppa006838mg [Prunus persica]
Length=393

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/259 (43%), Positives = 149/259 (58%), Gaps = 31/259 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSA  644
             +KQP+F+CKF     Q R    +P +  +      +  E   +ERKGW + IHDLSGS 
Sbjct  145  TVKQPVFTCKFGFRDMQSRSMSSEPGTPRNWLPFGGAHKEQSGKERKGWSITIHDLSGSP  204

Query  643  VAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICC  464
            VAAA + TPFV S G   V RSNPGAWLI+RP+     +WQPWG+LE+W ERG  D++  
Sbjct  205  VAAASMVTPFVASPGSHCVSRSNPGAWLILRPN---EGTWQPWGRLESWLERGGSDTVGY  261

Query  463  RFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvps------------p  320
            RF L         +  ++   + A+ GG+F ID    +  A SP  S             
Sbjct  262  RFELQ--------NTTLANSTLGAKTGGKFSIDLTSSLTPANSPHSSFDFGSGTGSRPGS  313

Query  319  rsSGDFS-ALSP--VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVD  149
             S  DF   L P  +  GFVMS  V+G GK SK  V++ ++HVTC EDAA ++ALAAA+D
Sbjct  314  GSGSDFGFGLFPQLIQRGFVMSSTVEGVGKCSKPEVEVGVQHVTCTEDAAAYVALAAAMD  373

Query  148  LSIEACRPF-RRLRRGTRH  95
            LS++ACRPF ++LR+  R 
Sbjct  374  LSMDACRPFSQKLRKELRQ  392



>gb|EYU34216.1| hypothetical protein MIMGU_mgv1a006107mg [Erythranthe guttata]
Length=457

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 155/259 (60%), Gaps = 27/259 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS---QDRVQQVDPLsnfsssf-------vdssDIEIER--RERKGWKVK  668
            NI+QP+F+CKFS    DR Q+   L    S         + S   E ER  +ERKGW + 
Sbjct  189  NIRQPVFTCKFSFRTADRNQRSRSLPTEHSGGGGVARRWLSSLGSERERVVKERKGWSIT  248

Query  667  IHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER  488
            +HDLSGS VAAA + TPFV S G D V RSNPG WLI+RP      +W+PWG+LEAWRER
Sbjct  249  VHDLSGSPVAAASMVTPFVASPGSDRVSRSNPGCWLILRPG---DSTWKPWGRLEAWRER  305

Query  487  GIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp---spr  317
            G  D+I  +F L+ D       +++++  IS  KGG+F ID        ++      SP 
Sbjct  306  GSADAIGYKFELIPDSASAAAGIVLADSKISCSKGGKFIIDNGNASGGGSNAGSPVCSPH  365

Query  316  sSGDFS-ALSPVVG---GFVMSCRVQGEGKYSKL----LVQLAMRHVTCVEDAAIFMALA  161
             SGDF   L P      GFVM+  V+GEG   K     LV+++++ V C+EDAA F+ALA
Sbjct  366  GSGDFGYGLWPYCSMYRGFVMAASVEGEGYNGKTAAAPLVEVSVQQVKCLEDAAAFVALA  425

Query  160  AAVDLSIEACRPF-RRLRR  107
            AA+DLS++ACR F R+LR+
Sbjct  426  AALDLSVDACRLFSRKLRK  444



>ref|XP_003573437.1| PREDICTED: uncharacterized protein LOC100828811 [Brachypodium 
distachyon]
 ref|XP_010234360.1| PREDICTED: uncharacterized protein LOC100828811 [Brachypodium 
distachyon]
 ref|XP_010234361.1| PREDICTED: uncharacterized protein LOC100828811 [Brachypodium 
distachyon]
Length=454

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 149/242 (62%), Gaps = 20/242 (8%)
 Frame = -3

Query  802  QPIFSCKF--SQDRVQQVDPLsnfsssfvdssDIEIERR--ERKGWKVKIHDLSGSAVAA  635
            QPIFSCKF  +  R  Q D  S+ S       +    +R  ERKGWKV +HDLSG+AVAA
Sbjct  185  QPIFSCKFIRAGRRASQADDWSSCSEEEEKEMETARRKRMRERKGWKVAVHDLSGTAVAA  244

Query  634  AFITTPFVPSTGCDWVDRSNPGAWLIVRPDPC-MRESWQPWGKLEAWRE-------RGIR  479
            AF+ TPFVP+TG D V RSNPGAWLIVR D     +SWQPWG+LEAWRE       +G  
Sbjct  245  AFMATPFVPATGRDTVARSNPGAWLIVRADTTGSSDSWQPWGRLEAWREDPPAPGTKGKD  304

Query  478  DSICCRFHLLSDGPEGGGD--LLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGD  305
             +  C   L     +   D  +L+SE  +S EKGGEF ID D+   +      +      
Sbjct  305  SAAACLLRLRLLPEQQREDACVLVSETPLSCEKGGEFSIDMDRHSSSEEPEEEAAE----  360

Query  304  FSALSPVVGGFVMSCRVQGEGKYS-KLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACR  128
                + + GGFVMSCRV GE      ++V++A RHVTC+EDAA+F+ALAAAVDLS++ACR
Sbjct  361  -YCAAGMGGGFVMSCRVHGEASGGPPVVVRVAARHVTCMEDAAMFLALAAAVDLSVKACR  419

Query  127  PF  122
            PF
Sbjct  420  PF  421



>ref|XP_006355293.1| PREDICTED: uncharacterized protein LOC102593921 [Solanum tuberosum]
Length=427

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 151/264 (57%), Gaps = 35/264 (13%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDI---------EIERRERKGWKVKIHD  659
            N+KQP+F+CKFS       + +S  S S   +S           E  R+ERKGW V IHD
Sbjct  172  NVKQPVFTCKFSFKNSGDWNSISRSSLSEGSTSKSCFNCWTADNETRRKERKGWLVTIHD  231

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS +AAA + TPFVPS G + V RSNPGAWLI+RPD   + +W+PWG+L+AW E  I 
Sbjct  232  LSGSPIAAASMVTPFVPSQGSNKVSRSNPGAWLILRPD---QGTWKPWGRLQAWLE--IS  286

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
              +  RF ++ DG      L+ S   IS + GG+F ID        AS   S     DFS
Sbjct  287  GKLGYRFEIIPDGANDAITLVNST--ISTKNGGKFSIDISNVAIPMASAHSSF----DFS  340

Query  298  ALSP--------------VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALA  161
            ++S               +  GFVMS  V+G+GK SK  V +  +HV+C EDAA F+ LA
Sbjct  341  SVSGSWSDFGSSGSWGQILYRGFVMSSTVKGDGKCSKPEVVVGAQHVSCSEDAAAFVVLA  400

Query  160  AAVDLSIEACRPFRR-LRRGTRHS  92
            AA+DLS++ACR F + LR+  R S
Sbjct  401  AAMDLSMDACRSFSQTLRKELRQS  424



>gb|AFK43684.1| unknown [Medicago truncatula]
Length=417

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 145/252 (58%), Gaps = 32/252 (13%)
 Frame = -3

Query  808  IKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAAF  629
            +KQP+F+CKFS       +P             ++    +RKGW + IHDLSGS VA A 
Sbjct  184  VKQPVFTCKFSFRDKNPSNP-------------VQFPSMDRKGWSITIHDLSGSPVACAS  230

Query  628  ITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHLL  449
            + TPFVPS G   V +SNPGAWLI++PD     +W+PWG+LEAWRE G  +S+  RF +L
Sbjct  231  MVTPFVPSPGSQRVSKSNPGAWLIIKPD--GDGTWKPWGRLEAWREPGYSNSVGYRFDVL  288

Query  448  SDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspv------------psprsSGD  305
               P     + ++   IS++ GG+F ID    V    +P             P   S  D
Sbjct  289  ---PATADPVTLAGCSISSQNGGKFTIDVTSGVTPVNTPNGSWDLGSGSGSRPGSGSGSD  345

Query  304  FSALSPVV-GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACR  128
            FS  +  +  GFVMS R  GE K SK  V++ ++HVTC EDAA F+ALAAA+DLS++AC+
Sbjct  346  FSLENQFLYSGFVMSARFDGEKKCSKPEVEVGVKHVTCTEDAAAFVALAAAMDLSMDACK  405

Query  127  PF-RRLRRGTRH  95
             F ++LR+  R 
Sbjct  406  LFSQKLRKELRQ  417



>ref|XP_003610647.1| hypothetical protein MTR_5g005420 [Medicago truncatula]
 gb|AES93605.1| DUF1005 family protein [Medicago truncatula]
Length=417

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 145/252 (58%), Gaps = 32/252 (13%)
 Frame = -3

Query  808  IKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAAF  629
            +KQP+F+CKFS       +P             ++    +RKGW + IHDLSGS VA A 
Sbjct  184  VKQPVFTCKFSFRDKNPSNP-------------VQFPSMDRKGWSITIHDLSGSPVACAS  230

Query  628  ITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFHLL  449
            + TPFVPS G   V +SNPGAWLI++PD     +W+PWG+LEAWRE G  +S+  RF +L
Sbjct  231  MVTPFVPSPGSQRVSKSNPGAWLIIKPD--GDGTWKPWGRLEAWREPGYSNSVGYRFDVL  288

Query  448  SDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspv------------psprsSGD  305
               P     + ++   IS++ GG+F ID    V    +P             P   S  D
Sbjct  289  ---PATADPVTLAGCSISSQNGGKFTIDVTSGVTPVNTPNGSWDLGSGSGSRPGSGSGSD  345

Query  304  FSALSP-VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACR  128
            FS  +  +  GFVMS R  GE K SK  V++ ++HVTC EDAA F+ALAAA+DLS++AC+
Sbjct  346  FSLENQFLYSGFVMSARFDGEKKCSKPEVEVGVKHVTCTEDAAAFVALAAAMDLSMDACK  405

Query  127  PF-RRLRRGTRH  95
             F ++LR+  R 
Sbjct  406  LFSQKLRKELRQ  417



>ref|XP_004230673.1| PREDICTED: uncharacterized protein LOC101258701 [Solanum lycopersicum]
Length=436

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 112/262 (43%), Positives = 151/262 (58%), Gaps = 30/262 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            N+KQP+F+CKFS         + R    +P ++ S     +SD EI  +ERKGW + +HD
Sbjct  178  NVKQPVFTCKFSFRNSGDRNLRSRSSLSEPSTSTSCFGSCTSDREISVKERKGWSITVHD  237

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFVPS G D V +SNPG+WLI+RP      +W+PWG+LEAWRER   
Sbjct  238  LSGSPVAAASMVTPFVPSQGSDRVSKSNPGSWLILRPG---DNTWKPWGRLEAWRER--N  292

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID-------------TDKQvraaa  338
              +  RF ++ DG      L+ S   IS +KGG+  ID             +      + 
Sbjct  293  GELGYRFEIIPDGATDAITLVNS--TISTKKGGKIGIDIINGATPLTSPNSSFDLSSGSG  350

Query  337  spvpsprsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAA  158
            S        G  S    +  GFVMS  V GEGK +K  V++ ++HV+C EDAA F+ALAA
Sbjct  351  SGSDFGSQPGSGSWAQLLYRGFVMSGTVGGEGKCTKPEVEVGVQHVSCAEDAAAFVALAA  410

Query  157  AVDLSIEACRPF-RRLRRGTRH  95
            A+DLSI+ACR F ++LR+  R 
Sbjct  411  AMDLSIDACRSFSQKLRKELRQ  432



>ref|XP_011078480.1| PREDICTED: uncharacterized protein LOC105162206 [Sesamum indicum]
Length=451

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 164/258 (64%), Gaps = 27/258 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS---QDRVQQVDPLsnfsssfv----dssDIEIER--RERKGWKVKIHD  659
            NI+QP+F+CKF+    DR Q+   LS+   S       S   E ER  +ERKGW + IHD
Sbjct  188  NIRQPVFTCKFNFRAADRNQRSRSLSSEQISPARGWLSSFGSERERPGKERKGWSITIHD  247

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VA A + TPFV   G D V RSN G WLI+RP      +W+PWG+LEAWR+RG  
Sbjct  248  LSGSPVAVASMVTPFVAGPGSDRVTRSNSGCWLILRPG---DGTWKPWGRLEAWRDRGSA  304

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTD-------KQvraaaspvpsp  320
            D +  RF L+ +     G ++++E  +S  KGG+F ID +       K   AAA+PV SP
Sbjct  305  DGLGYRFELVHNSAASSG-IVLAESTLSCSKGGKFIIDLNGNGATAMKPGSAAATPVCSP  363

Query  319  rsSGDFS-ALSP--VVGGFVMSCRVQGE---GKYSKLLVQLAMRHVTCVEDAAIFMALAA  158
            RSSGDF  AL P  +  GFVMS +V+GE   GK + L+V++ ++ V C+EDAA F+AL+A
Sbjct  364  RSSGDFGYALWPYSLYKGFVMSAKVEGEGHSGKTAPLMVEVGVQQVNCMEDAAAFVALSA  423

Query  157  AVDLSIEACRPF-RRLRR  107
            A+DLS++ACR F  +LR+
Sbjct  424  ALDLSMDACRLFSHKLRK  441



>gb|EYU36412.1| hypothetical protein MIMGU_mgv1a006276mg [Erythranthe guttata]
Length=450

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 113/258 (44%), Positives = 157/258 (61%), Gaps = 27/258 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS---QDRVQQVDPLsnfsssfv----dssDIEIER--RERKGWKVKIHD  659
            +++QP+F+CKFS    DR Q+   L +  S+       S   E ER  +ERKGW + IHD
Sbjct  188  DVRQPVFTCKFSFRAPDRNQRSMSLPSEHSNGARAWLSSFGSERERPGKERKGWSITIHD  247

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VA A + TPFVP  G D V RSNPG WLI+RP      +W+PWG+LEAWRERG  
Sbjct  248  LSGSPVAVASMVTPFVPLPGSDKVSRSNPGCWLILRPG---DGTWKPWGRLEAWRERGAS  304

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprs-----  314
            D +  RF L+ D     G ++++E  +S  KGG+F ID +      +    S  +     
Sbjct  305  DGLGYRFELILDSAAAAG-IVLAESALSCSKGGKFVIDLNGGGGTPSGTPRSGGASPGCS  363

Query  313  ---SGDF-SALSPVVG--GFVMSCRVQGEGKYSKL--LVQLAMRHVTCVEDAAIFMALAA  158
               SGDF + L P     GFVMS  V+G G+   +  +V+++++HVTC EDAA F+AL+A
Sbjct  364  PRGSGDFGNGLWPYSAYRGFVMSACVEGNGRGKTVGPVVEVSVQHVTCTEDAAAFVALSA  423

Query  157  AVDLSIEACRPF-RRLRR  107
            A+DLS++ACR F ++LR+
Sbjct  424  ALDLSMDACRLFSQKLRK  441



>emb|CDO97321.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 153/261 (59%), Gaps = 28/261 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIER--RERKGWKVKI  665
            N+KQP+FSCKF          + R    +P +  +  F  S   E ER  +ERKGW + I
Sbjct  189  NVKQPVFSCKFGFRSCGERNLRSRSSMSEP-NTRTGCFSASFPAEKERPLKERKGWSITI  247

Query  664  HDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG  485
            HDLSGS VAAA + TPFV S G D V RSNPGAWLI+RP      +W+PWG+LEAWRER 
Sbjct  248  HDLSGSPVAAASMVTPFVASPGSDRVSRSNPGAWLILRPG---HGTWKPWGRLEAWRERN  304

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDT----------DKQvraaas  335
              D +  RF L+ DG      + ++    S +KGG+F ID           +     +++
Sbjct  305  GGDHLGYRFELIPDGSI--DTITLANSSFSTKKGGKFSIDIASGSTPLTSPNSSFDFSSA  362

Query  334  pvpsprsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAA  155
               S   SG  S    +  GFVMS  V+G+GK SK  V++ ++HVTC EDAA F+ALAAA
Sbjct  363  SSGSGSGSGSGSWGQLLYRGFVMSSTVEGDGKCSKPEVEIGVQHVTCTEDAAAFVALAAA  422

Query  154  VDLSIEACRPF-RRLRRGTRH  95
            VDLS++ACR F +++RR  R 
Sbjct  423  VDLSMDACRSFSQKIRRELRQ  443



>emb|CDP00983.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 154/269 (57%), Gaps = 38/269 (14%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvd---ssDIEIER--RERKGWKVKIHD  659
            +I+QP+F+CKFS     DR Q+   L +  S       S   E ER  +ERKGW + +HD
Sbjct  192  SIRQPVFTCKFSFRSAPDRNQRSWSLPSELSCSRSWLSSFGSERERPGKERKGWSITVHD  251

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G D V RSNPG+WLI+RP      +W+PWG+LEAWRERG  
Sbjct  252  LSGSPVAAASMVTPFVASPGSDRVSRSNPGSWLILRPG---DGTWKPWGRLEAWRERGSA  308

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D +  RF L+ D     G ++++E  +S+ KGG+F ID      A  +   +   +   S
Sbjct  309  DGLGYRFELIPDSAAAAG-IVLAESTLSSSKGGKFVIDLGSGSPAGGAGGTANGRATPGS  367

Query  298  ALSP------------------VVGGFVMSCRVQGEGKYSKL------LVQLAMRHVTCV  191
              SP                  V  GFVMS RV GEG   K        V+++++HV C 
Sbjct  368  VASPACSPRSSGDFGYGLWPYCVYRGFVMSARVAGEGDGRKSKCNRPPTVEVSVQHVNCT  427

Query  190  EDAAIFMALAAAVDLSIEACRPF-RRLRR  107
            EDAA ++AL+AAVDLS++ACR F ++LR+
Sbjct  428  EDAAAYVALSAAVDLSMDACRLFSQKLRK  456



>ref|XP_002456333.1| hypothetical protein SORBIDRAFT_03g034120 [Sorghum bicolor]
 gb|EES01453.1| hypothetical protein SORBIDRAFT_03g034120 [Sorghum bicolor]
Length=450

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 100/252 (40%), Positives = 141/252 (56%), Gaps = 31/252 (12%)
 Frame = -3

Query  805  KQPIFSCKFSQDR----VQQVDPLsnfsssfvdssD--------------IEIERRERKG  680
            +QP+F+C+FS  R     + + P S+ + S                        R +RKG
Sbjct  203  RQPVFTCRFSAGRRAARSRSLTPQSSMTRSTSRRLRSWLSSTLHGEGRDGAHSRREQRKG  262

Query  679  WKVKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEA  500
            W V IHDLSGS VAAA + TPFVPS G   V R+NPG+WLI++       SW+PW +LEA
Sbjct  263  WTVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPGSWLILQATGAGPSSWKPWARLEA  322

Query  499  WRERGIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsp  320
            WRERG  D++  R  L+ D       + ++E  IS ++GG+F ID             + 
Sbjct  323  WRERGPVDALGYRLELVFDSGPHECAVPIAESSISTKRGGQFVIDP------------AT  370

Query  319  rsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSI  140
                   A  P  GGFVM   V+GEG+ S+  VQ+ ++HVTC+ D A+F+AL+AAVDL +
Sbjct  371  FPEAAAGAAWPFAGGFVMGSTVEGEGRASRPTVQVGVQHVTCMGDVAVFVALSAAVDLCM  430

Query  139  EACRPF-RRLRR  107
            +AC+ F +RLR+
Sbjct  431  DACKLFSQRLRK  442



>ref|XP_009801206.1| PREDICTED: uncharacterized protein LOC104246980 [Nicotiana sylvestris]
Length=435

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 113/264 (43%), Positives = 151/264 (57%), Gaps = 31/264 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIE-RRERKGWKVKIH  662
            N+KQP+F+CKFS         + R     P ++ S     +SD E    +ERKGW + IH
Sbjct  176  NVKQPVFTCKFSFRNNGDRNLRSRSSLSKPSTSTSCFNSCTSDKESSPLKERKGWSITIH  235

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS +AAA + TPFVPS G   V RSNPGAWLI+RP      +W+PWG+LEAW+ERG 
Sbjct  236  DLSGSPIAAASMVTPFVPSQGSSNVSRSNPGAWLILRPG---NGTWKPWGRLEAWQERG-  291

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvps-------  323
               +  RF ++ DG      + +S   IS + GG+F +D         SP  S       
Sbjct  292  -GDLGYRFEIIPDGATDA--ITLSNSTISTKNGGKFGVDITNGATPLTSPNSSFDLCSGS  348

Query  322  ------prsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALA  161
                    + G  S    +  GFVMS  V+GEGK SK  V + ++HV CVEDAA F+ALA
Sbjct  349  GSGSDFGSAPGSGSWAQLLYRGFVMSSTVEGEGKCSKPEVVVGVQHVNCVEDAAAFVALA  408

Query  160  AAVDLSIEACRPF-RRLRRGTRHS  92
            AA+DLS++AC+ F ++LR+  R S
Sbjct  409  AAMDLSMDACQSFTKKLRKELRQS  432



>emb|CDY24620.1| BnaC05g33040D [Brassica napus]
Length=450

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 117/251 (47%), Positives = 149/251 (59%), Gaps = 18/251 (7%)
 Frame = -3

Query  811  NIKQPIFSCKF------SQDR--VQQVDPLsnfsssfvdssDIEIER--RERKGWKVKIH  662
            N KQ +F+CKF      S DR  +     +S   SS + S   E E+  +ERKGW V +H
Sbjct  199  NTKQAVFTCKFGARNSGSGDRNLLHSSSMMSETRSSCISSMKSEKEQPSKERKGWSVTVH  258

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS VA A + TPFVPS G + V RS+PGAWLI+RPD C   +W+PWG+LEAWRE G 
Sbjct  259  DLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLILRPDGC---TWKPWGRLEAWREAGY  315

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsp-rsSGD  305
             DS+  RF L  DG       + +   IS + GG F ID       A S   +  + S D
Sbjct  316  SDSLGYRFELFQDGI---ATEVSASSSISLKNGGSFVIDVTGGTTTAGSTPTTSPQGSLD  372

Query  304  FSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
              + S    GFVMS  V+G GK SK  V++ + HVTC EDAA  +ALAAAVDLS++ACR 
Sbjct  373  LGSGSSSGRGFVMSASVEGVGKQSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACRL  432

Query  124  F-RRLRRGTRH  95
            F ++LR+  R 
Sbjct  433  FSQKLRKELRQ  443



>ref|XP_008776853.1| PREDICTED: uncharacterized protein LOC103696910 [Phoenix dactylifera]
Length=442

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 147/250 (59%), Gaps = 22/250 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            +++QP+F+CKFS         + R    +P ++ S      S+ E   +ERKGW V +HD
Sbjct  191  SMRQPVFTCKFSCRNPADRNLRSRSVPAEPCNSRSWLSSFGSERERPIKERKGWSVTVHD  250

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER--G  485
            LSGS VA A + TPFV S G D V RSNPGAWL++RP      +W+PW +LEAWRER  G
Sbjct  251  LSGSPVALASMVTPFVASPGTDRVSRSNPGAWLVLRPG---DGTWKPWARLEAWRERGGG  307

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGD  305
              D +  RF L+ D     G  L +E  +S  KGG+F ID      + A          D
Sbjct  308  TSDGLGYRFQLVPDTAVSAGAPL-AECTVSTSKGGKFTIDLTGAGGSPAGSPRGSI---D  363

Query  304  FSALS-PVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEA  134
            F A   P  G  GFVMS  V+GEGK S+  V++ ++HV C EDAA F+ALAAAVDLS++A
Sbjct  364  FGAGPWPFSGYRGFVMSSTVEGEGKCSRPSVEVGVQHVGCTEDAAAFVALAAAVDLSMDA  423

Query  133  CRPF-RRLRR  107
            CR F  +LRR
Sbjct  424  CRLFSHKLRR  433



>emb|CDY51694.1| BnaA05g36810D [Brassica napus]
Length=449

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 148/251 (59%), Gaps = 18/251 (7%)
 Frame = -3

Query  811  NIKQPIFSCKF------SQDR--VQQVDPLsnfsssfvdssDIEIER--RERKGWKVKIH  662
            N KQ +F+CKF      S DR  +     +S   SS + S   E E+  +ERKGW V +H
Sbjct  198  NTKQAVFTCKFGARNSGSGDRNLLHSSSMMSETRSSCISSMKSEKEQPSKERKGWSVTVH  257

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS VA A + TPFVPS G + V RS+PGAWLI+RPD C   +W+PWG+LEAWRE G 
Sbjct  258  DLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLILRPDGC---TWKPWGRLEAWREAGY  314

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsp-rsSGD  305
             DS+  RF L  DG       + +   IS + GG F ID         S   +  + S D
Sbjct  315  SDSLGYRFELFQDGI---ATEVSASSSISLKNGGSFVIDVTGGTTTVGSTPTTSPQGSLD  371

Query  304  FSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRP  125
              + S    GFVMS  V+G GK SK  V++ + HVTC EDAA  +ALAAAVDLS++ACR 
Sbjct  372  LGSGSSSGRGFVMSASVEGVGKQSKPEVEVGVTHVTCTEDAAAHVALAAAVDLSLDACRL  431

Query  124  F-RRLRRGTRH  95
            F ++LR+  R 
Sbjct  432  FSQKLRKELRQ  442



>ref|XP_004292055.1| PREDICTED: uncharacterized protein LOC101308741 [Fragaria vesca 
subsp. vesca]
Length=438

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 109/265 (41%), Positives = 149/265 (56%), Gaps = 38/265 (14%)
 Frame = -3

Query  811  NIKQPIFSCKF---------SQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            N+KQP+F+CKF         S+   +Q  P +        +   E   +ERKGW + IHD
Sbjct  186  NVKQPVFTCKFGFRNASDMQSRSMSEQGTPRNWLVPFMGSNQK-EQSAKERKGWSLTIHD  244

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFV S G   V RSNPGAWLI+RP+     +W+PWG+LEAW ERG  
Sbjct  245  LSGSPVAAASMVTPFVASPGSQRVSRSNPGAWLILRPE---DGTWKPWGRLEAWLERGGS  301

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGD--  305
            D++  +F LLS         +++   +SA  GG+F ID    +    SP  S        
Sbjct  302  DTVGYKFELLST--------ILANSTVSASNGGKFTIDLTSSLTPVNSPHSSFDFGSGSG  353

Query  304  -------------FSALSPVVG-GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMA  167
                         F  +  ++  GFVMS  V+G GK SK  V++ ++HVTC EDAA ++A
Sbjct  354  SSRPGSGSGSDFGFGLIPQLLQRGFVMSSTVEGIGKCSKPEVEVGVQHVTCTEDAAAYVA  413

Query  166  LAAAVDLSIEACRPF-RRLRRGTRH  95
            LAAA+DLS++ACRPF ++LR+  R 
Sbjct  414  LAAAMDLSMDACRPFSQKLRKELRQ  438



>gb|EAZ28736.1| hypothetical protein OsJ_12756 [Oryza sativa Japonica Group]
Length=444

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 149/255 (58%), Gaps = 31/255 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIER-------RERKGWKVKIHDLS  653
            ++KQP+F+CKF       +             S ++ ER       +ERKGW V +HDLS
Sbjct  198  SMKQPMFTCKFGCRSNSDL-----------RRSVVQTERDAAAAAGKERKGWSVTVHDLS  246

Query  652  GSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER---GI  482
            GS VA A + TPFV S G D V RSNPGAWLI+R  P    SW+PWG+LE WRER   G 
Sbjct  247  GSPVALASMVTPFVASPGTDRVSRSNPGAWLILR--PAGDGSWEPWGRLECWRERGGAGA  304

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp--sprsSG  308
             DS+  RF LL  G +    + ++E  I+A KGG+F ID       +    P  SPR SG
Sbjct  305  SDSLGYRFDLLLPGVDHA--VPLAESSIAASKGGKFAIDLTSMQPQSRGGTPGCSPRGSG  362

Query  307  DFSA---LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
            DFS     S    GFVMS  VQGEG+ SK  V++ + HV C EDAA F+ALAAAVDLS++
Sbjct  363  DFSQWPLASYSYRGFVMSSSVQGEGRCSKPTVEVGVPHVGCAEDAAAFVALAAAVDLSMD  422

Query  136  ACRPF-RRLRRGTRH  95
            ACR F  +LR+   H
Sbjct  423  ACRLFSHKLRKELSH  437



>gb|AAP68894.1| unknown protein [Oryza sativa Japonica Group]
Length=404

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 149/255 (58%), Gaps = 31/255 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIER-------RERKGWKVKIHDLS  653
            ++KQP+F+CKF       +             S ++ ER       +ERKGW V +HDLS
Sbjct  158  SMKQPMFTCKFGCRSNSDL-----------RRSVVQTERDAAAAAGKERKGWSVTVHDLS  206

Query  652  GSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER---GI  482
            GS VA A + TPFV S G D V RSNPGAWLI+R  P    SW+PWG+LE WRER   G 
Sbjct  207  GSPVALASMVTPFVASPGTDRVSRSNPGAWLILR--PAGDGSWEPWGRLECWRERGGAGA  264

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp--sprsSG  308
             +S+  RF LL  G +    + ++E  I+A KGG+F ID       +    P  SPR SG
Sbjct  265  SNSLGYRFDLLLPGVDHA--VPLAESSIAASKGGKFAIDLTSMQPQSRGGTPGCSPRGSG  322

Query  307  DFSA---LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
            DFS     S    GFVMS  VQGEG+ SK  V++ + HV C EDAA F+ALAAAVDLS++
Sbjct  323  DFSQWPLASYSYRGFVMSSSVQGEGRCSKPTVEVGVPHVGCAEDAAAFVALAAAVDLSMD  382

Query  136  ACRPF-RRLRRGTRH  95
            ACR F  +LR+   H
Sbjct  383  ACRLFSHKLRKELSH  397



>ref|XP_003557619.1| PREDICTED: uncharacterized protein LOC100825031 [Brachypodium 
distachyon]
Length=463

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 151/258 (59%), Gaps = 28/258 (11%)
 Frame = -3

Query  808  IKQPIFSCKFS-------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSG  650
            +KQP+F+CKFS       + R    DP    +      SD E   +ERKGW V +HDLSG
Sbjct  199  MKQPMFTCKFSCRTNSDLRSRSMHSDP-GTRNWLTSFGSDRERLGKERKGWSVTVHDLSG  257

Query  649  SAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR---  479
            S VA A + TPFV   G D V RSNPGAWL++RP      +W+PWG+LE WRERG     
Sbjct  258  SPVALASMVTPFVAIPGSDRVSRSNPGAWLVLRPG---DGTWKPWGRLECWRERGASAAG  314

Query  478  -DSICCRFH-LLSDGPEG-GGDLLMSEILISAEKGGEFYID--TDKQvraaaspvpsprs  314
             DS+  RF  LL D P G G  + ++E  I + +GG F ID    +    + SP  SPR 
Sbjct  315  GDSLGYRFELLLPDHPTGMGTGVSVAESAIPSSRGGRFAIDLTAAQPFGRSGSPACSPRG  374

Query  313  SGDFSALSPVV--------GGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAA  158
            SGD +  +           GGFVMS  VQGEG+ S+  V++ + HV C EDAA F+ALAA
Sbjct  375  SGDLTGYAAAALGSCCHGRGGFVMSAAVQGEGRCSRPTVEVGVAHVGCAEDAAAFVALAA  434

Query  157  AVDLSIEACRPF-RRLRR  107
            AVDLS++ACR F  RLRR
Sbjct  435  AVDLSMDACRLFSHRLRR  452



>gb|EAY92004.1| hypothetical protein OsI_13693 [Oryza sativa Indica Group]
Length=444

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 149/255 (58%), Gaps = 31/255 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIER-------RERKGWKVKIHDLS  653
            ++KQP+F+CKF       +             S ++ ER       +ERKGW V +HDLS
Sbjct  198  SMKQPMFTCKFGCRSNSDL-----------RRSVVQTERDAAAAAGKERKGWSVTVHDLS  246

Query  652  GSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER---GI  482
            GS VA A + TPFV S G D V RSNPGAWLI+R  P    SW+PWG+LE WRER   G 
Sbjct  247  GSPVALASMVTPFVASPGTDRVSRSNPGAWLILR--PAGDGSWEPWGRLECWRERGGAGA  304

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp--sprsSG  308
             DS+  RF LL  G +    + ++E  I+A KGG+F ID       +    P  SPR SG
Sbjct  305  SDSLGYRFDLLLPGVDHA--VPLAESSIAASKGGKFAIDLTSMQPQSRGGTPGCSPRGSG  362

Query  307  DFSA---LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
            DFS     S    GFVMS  VQGEG+ SK  V++ + HV C EDAA F+ALAAAVDLS++
Sbjct  363  DFSQWPLSSYSYRGFVMSSSVQGEGRCSKPTVEVGVPHVGCAEDAAAFVALAAAVDLSMD  422

Query  136  ACRPF-RRLRRGTRH  95
            ACR F  +LR+   H
Sbjct  423  ACRLFSHKLRKELSH  437



>ref|XP_004150270.1| PREDICTED: uncharacterized protein LOC101221491 [Cucumis sativus]
Length=454

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 151/260 (58%), Gaps = 27/260 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssD-----IEIER----RERKGWKVKIHD  659
            +++QP+F+CKF     +  D   +  +    +S      I  ER    +ERKGW + IHD
Sbjct  201  SVQQPVFTCKFGFRNERDWDRSRSSITEQSSTSKSWLPKIRSERDQSAKERKGWSITIHD  260

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFVPS G   V RSNPGAWLI+RP   +  SW+PWG+LEAWRE G  
Sbjct  261  LSGSPVAAASMVTPFVPSPGSHRVSRSNPGAWLILRP---VDGSWRPWGRLEAWRESGGS  317

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---------TDKQvraaaspvp  326
            DSI  RF LL   P       ++   IS+  GG+F ID         +        S   
Sbjct  318  DSIGYRFELL---PATSAAATLANSTISSGSGGKFTIDMTGSASPAISPNGSFDLGSGTG  374

Query  325  sprsSGDFSALSPV-VGGFVMSCRVQGEGKYSKLL-VQLAMRHVTCVEDAAIFMALAAAV  152
            S   SGDF  L+     GFVMS  V+G  K S+   V++A++HVTC EDAA+F+ALAAAV
Sbjct  375  SRPGSGDFGYLTGYQYKGFVMSTMVEGMKKKSRRPEVEVAVQHVTCTEDAAVFVALAAAV  434

Query  151  DLSIEACRPF-RRLRRGTRH  95
            DLS++ACR F ++LR+  R 
Sbjct  435  DLSMDACRLFSQKLRKELRQ  454



>gb|KGN52731.1| hypothetical protein Csa_4G000030 [Cucumis sativus]
Length=458

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 151/260 (58%), Gaps = 27/260 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssD-----IEIER----RERKGWKVKIHD  659
            +++QP+F+CKF     +  D   +  +    +S      I  ER    +ERKGW + IHD
Sbjct  205  SVQQPVFTCKFGFRNERDWDRSRSSITEQSSTSKSWLPKIRSERDQSAKERKGWSITIHD  264

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFVPS G   V RSNPGAWLI+RP   +  SW+PWG+LEAWRE G  
Sbjct  265  LSGSPVAAASMVTPFVPSPGSHRVSRSNPGAWLILRP---VDGSWRPWGRLEAWRESGGS  321

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---------TDKQvraaaspvp  326
            DSI  RF LL   P       ++   IS+  GG+F ID         +        S   
Sbjct  322  DSIGYRFELL---PATSAAATLANSTISSGSGGKFTIDMTGSASPAISPNGSFDLGSGTG  378

Query  325  sprsSGDFSALSPV-VGGFVMSCRVQGEGKYSKLL-VQLAMRHVTCVEDAAIFMALAAAV  152
            S   SGDF  L+     GFVMS  V+G  K S+   V++A++HVTC EDAA+F+ALAAAV
Sbjct  379  SRPGSGDFGYLTGYQYKGFVMSTMVEGMKKKSRRPEVEVAVQHVTCTEDAAVFVALAAAV  438

Query  151  DLSIEACRPF-RRLRRGTRH  95
            DLS++ACR F ++LR+  R 
Sbjct  439  DLSMDACRLFSQKLRKELRQ  458



>ref|XP_004156872.1| PREDICTED: uncharacterized LOC101221491 [Cucumis sativus]
Length=458

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 151/260 (58%), Gaps = 27/260 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssD-----IEIER----RERKGWKVKIHD  659
            +++QP+F+CKF     +  D   +  +    +S      I  ER    +ERKGW + IHD
Sbjct  205  SVQQPVFTCKFGFRNERDWDRSRSSITEQSSTSKSWLPKIRSERDQSAKERKGWSITIHD  264

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VAAA + TPFVPS G   V RSNPGAWLI+RP   +  SW+PWG+LEAWRE G  
Sbjct  265  LSGSPVAAASMVTPFVPSPGSHRVSRSNPGAWLILRP---VDGSWRPWGRLEAWRESGGS  321

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYID---------TDKQvraaaspvp  326
            DSI  RF LL   P       ++   IS+  GG+F ID         +        S   
Sbjct  322  DSIGYRFELL---PATSAAATLANSTISSGSGGKFTIDMTGSASPAISPNGSFDLGSGTG  378

Query  325  sprsSGDFSALSPV-VGGFVMSCRVQGEGKYSKLL-VQLAMRHVTCVEDAAIFMALAAAV  152
            S   SGDF  L+     GFVMS  V+G  K S+   V++A++HVTC EDAA+F+ALAAAV
Sbjct  379  SRPGSGDFGYLTGYQYKGFVMSTMVEGMKKKSRRPEVEVAVQHVTCTEDAAVFVALAAAV  438

Query  151  DLSIEACRPF-RRLRRGTRH  95
            DLS++ACR F ++LR+  R 
Sbjct  439  DLSMDACRLFSQKLRKELRQ  458



>gb|KCW56839.1| hypothetical protein EUGRSUZ_I02507, partial [Eucalyptus grandis]
Length=408

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 146/265 (55%), Gaps = 30/265 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFS-QDRVQQVDPLsnfsssfvdssDIEI----------ERRERKGWKVKI  665
            ++KQP+F+C FS ++ V      S  S S   +S   I            +ERKGW V I
Sbjct  141  SVKQPVFTCNFSFRNNVGDRSLRSRSSLSETSTSRSWIPSLVGSDKDSHSKERKGWSVTI  200

Query  664  HDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG  485
            HDLSGS VAAA + TPFVPS G D V RSNPGAWLI+RP+     +W+PWG+LEAW E G
Sbjct  201  HDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLIIRPE---HGTWRPWGRLEAWLEHG  257

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvra----------aas  335
              D +  RF LL +         ++   IS + GG+F ID    V               
Sbjct  258  SSDMLSHRFELLPNT-TTATTGTVANSSISIKNGGKFTIDLTNSVSPMSSPSSSMDLGGG  316

Query  334  pvpsprsSGDFSAL----SPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMA  167
                  S  DF  L    + V GGFVMS  +QG  K SK  V++ ++HVTC EDAA F+A
Sbjct  317  SWSGSGSGSDFVGLGLWPNSVPGGFVMSSTMQGVNKASKPQVEVGVQHVTCTEDAAAFVA  376

Query  166  LAAAVDLSIEACRPF-RRLRRGTRH  95
            LAAA+DLS++AC+ F R+LR   R 
Sbjct  377  LAAAIDLSMDACKLFSRKLRTELRQ  401



>dbj|BAJ89116.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 152/247 (62%), Gaps = 20/247 (8%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            ++KQP+F+CKF       +          V  ++ E   +ERKGW V +HDLSGS VA A
Sbjct  87   SMKQPMFTCKFGCRTNSDL-------RRSVAQTEREAAGKERKGWSVTVHDLSGSPVALA  139

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER---GIRDSICCR  461
             + TPFV S G D V RSNPGAWLI+R  P    +W+PWG+LE WRER   G  DS+  R
Sbjct  140  SMVTPFVASPGTDRVSRSNPGAWLILR--PAGDGAWEPWGRLECWRERGGAGSSDSLGYR  197

Query  460  FHLLSDGPEGGGDLLMSEILISAEKGGEFYID--TDKQvraaaspvpsprsSGDFSALSP  287
            F LL  G +    + +++  I+A KGG+F +D    + +   ++P  SPR SGDFS   P
Sbjct  198  FDLLVPGVDHA--VPIADSTIAASKGGKFALDLTAAQPLSRGSTPGCSPRGSGDFSQW-P  254

Query  286  VVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RR  116
            +    GFVMS  V+GEG+ SK  V++ + HV C EDAA F+ALAAAVDLS++ACR F  +
Sbjct  255  LGNYRGFVMSAAVEGEGRCSKPTVEVGVAHVGCAEDAAAFVALAAAVDLSMDACRLFSHK  314

Query  115  LRRGTRH  95
            LR+   H
Sbjct  315  LRKKLSH  321



>ref|NP_001058837.1| Os07g0133500 [Oryza sativa Japonica Group]
 dbj|BAC78571.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAC82946.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30606.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20751.1| Os07g0133500 [Oryza sativa Japonica Group]
 gb|EAZ38604.1| hypothetical protein OsJ_22992 [Oryza sativa Japonica Group]
 dbj|BAG97653.1| unnamed protein product [Oryza sativa Japonica Group]
Length=462

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 118/253 (47%), Positives = 152/253 (60%), Gaps = 22/253 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvdssDIEIER----RERKGWKVKIHDL  656
            ++KQP+F+CKFS     D   +  P    S      +    +R    +ERKGW V +HDL
Sbjct  203  SMKQPMFTCKFSCRSNSDLRSRSMPADMGSGGRNWLTAFGSDRERAGKERKGWSVTVHDL  262

Query  655  SGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG---  485
            SGS VA A + TPFV S G D V +SNPGAWL++RP      +W+PWG+LE WRERG   
Sbjct  263  SGSPVALASMVTPFVASPGTDRVSKSNPGAWLVLRPG---DGTWKPWGRLECWRERGAGA  319

Query  484  -IRDSICCRFHLLSDGPEGGG-DLLMSEILISAEKGGEFYID--TDKQvraaaspvpspr  317
               DS+  RF L+   P G G  + ++E  I A KGG F ID    +Q   + SP  SP 
Sbjct  320  AAGDSLGYRFELVLPDPTGMGVGVSVAESTIPASKGGRFAIDLTATQQFGRSGSPACSPC  379

Query  316  sSGDFSALSPVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLS  143
             SGD+  + P     GFVMS  VQGEGK S+  V++ +++V C EDAA F+ALAAAVDLS
Sbjct  380  GSGDY-GMWPFGSCRGFVMSAAVQGEGKCSRPAVEVGVQNVGCAEDAAAFVALAAAVDLS  438

Query  142  IEACRPF-RRLRR  107
            ++ACR F  RLRR
Sbjct  439  MDACRLFSHRLRR  451



>ref|XP_009111603.1| PREDICTED: uncharacterized protein LOC103837023 [Brassica rapa]
Length=469

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 113/268 (42%), Positives = 144/268 (54%), Gaps = 37/268 (14%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAAA  632
            N KQ +F+CKF        D   N   S    S+ E   +ERKGW V +HDLSGS VA A
Sbjct  203  NTKQAVFTCKFGARSSNSGD--RNQLGSSSMRSEKEQPSKERKGWSVTVHDLSGSPVAMA  260

Query  631  FITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI-RDSICCRFH  455
             + TPFVPS G + V+RS+PGAWLI+RPD C   +W+PWG+LEAWRE G   D++  RF 
Sbjct  261  SMVTPFVPSPGSNRVNRSSPGAWLILRPDGC---TWKPWGRLEAWRESGYSSDALGYRFE  317

Query  454  LLSDGPEGGGDLLMSEILISAEKGGEFYID-----------------------TDKQvra  344
            L  DG       + +   IS + GG F ID                       +     +
Sbjct  318  LFQDGI---ATAVSASSSISLKNGGSFVIDVTGGNTTAASTPTTSPQGSWDLGSGSSAGS  374

Query  343  aaspvpsprsSGDFSALSP----VVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAI  176
              +  P   S  DF  L P       GFVMS  V+G GK SK  V++ + HVTC EDAA 
Sbjct  375  RPASRPGSGSGSDFGYLLPQHPAQSRGFVMSASVEGVGKRSKPEVEVGVTHVTCTEDAAA  434

Query  175  FMALAAAVDLSIEACRPF-RRLRRGTRH  95
             +ALAAAVDLS++ACR F ++LR+  R 
Sbjct  435  HVALAAAVDLSLDACRLFSQKLRKELRQ  462



>ref|NP_001051414.1| Os03g0773000 [Oryza sativa Japonica Group]
 gb|AAP68895.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99103.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13328.1| Os03g0773000 [Oryza sativa Japonica Group]
Length=444

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 149/255 (58%), Gaps = 31/255 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvdssDIEIER-------RERKGWKVKIHDLS  653
            ++KQP+F+CKF       +             S ++ ER       +ERKGW V +HDLS
Sbjct  198  SMKQPMFTCKFGCRSNSDL-----------RRSVVQTERDAAAAAGKERKGWSVTVHDLS  246

Query  652  GSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER---GI  482
            GS VA A + TPFV S G D V RSNPGAWLI+R  P    SW+PWG+LE WRER   G 
Sbjct  247  GSPVALASMVTPFVASPGTDRVSRSNPGAWLILR--PAGDGSWEPWGRLECWRERGGAGA  304

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvp--sprsSG  308
             +S+  RF LL  G +    + ++E  I+A KGG+F ID       +    P  SPR SG
Sbjct  305  SNSLGYRFDLLLPGVDHA--VPLAESSIAASKGGKFAIDLTSMQPQSRGGTPGCSPRGSG  362

Query  307  DFSA---LSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIE  137
            DFS     S    GFVMS  VQGEG+ SK  V++ + HV C EDAA F+ALAAAVDLS++
Sbjct  363  DFSQWPLASYSYRGFVMSSSVQGEGRCSKPTVEVGVPHVGCAEDAAAFVALAAAVDLSMD  422

Query  136  ACRPF-RRLRRGTRH  95
            ACR F  +LR+   H
Sbjct  423  ACRLFSHKLRKELSH  437



>ref|XP_007157186.1| hypothetical protein PHAVU_002G049700g [Phaseolus vulgaris]
 gb|ESW29180.1| hypothetical protein PHAVU_002G049700g [Phaseolus vulgaris]
Length=416

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 145/249 (58%), Gaps = 25/249 (10%)
 Frame = -3

Query  811  NIKQPIFSCKFS-QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHDLSGSAVAA  635
            ++KQP+F+CKFS +D+     P  N ++S            ERKGW + +HDLSGS VAA
Sbjct  183  DVKQPVFTCKFSFRDKNPAHFPSPNNANSSA----------ERKGWSITVHDLSGSPVAA  232

Query  634  AFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIRDSICCRFH  455
            A + TPFVPS G   V RSNPGAWLI+RPD     +W+PWG+LEAWRE    +++  RF 
Sbjct  233  ASMATPFVPSPGSQRVSRSNPGAWLIIRPD--GDGTWKPWGRLEAWREPNNSNAVGYRFQ  290

Query  454  LLSDGPEGGGDLLMSEILISAEKGGEFYID--------TDKQvraaaspvpsprsSGDFS  299
            +L   P     + ++   IS++ GG+F ID        +  +                  
Sbjct  291  IL---PATADPVTLAASTISSQHGGKFTIDATSGVTPLSTPRGSWDLGSGSGSSLDSGLE  347

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-  122
            A+     GFVMS  V GEGK SK  V++ ++HVTC EDAA F+ALAAA+DLS++AC+ F 
Sbjct  348  AIPFFSKGFVMSATVDGEGKCSKPEVEVGVQHVTCTEDAAAFVALAAALDLSMDACKLFS  407

Query  121  RRLRRGTRH  95
            ++LR+  R 
Sbjct  408  QKLRKELRQ  416



>ref|XP_010327488.1| PREDICTED: uncharacterized protein LOC101263856 [Solanum lycopersicum]
Length=298

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 151/264 (57%), Gaps = 34/264 (13%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDPLsnfsssfvds---------sDIEIERRERKGWKVKIHD  659
            N+KQP+F+C FS       + +S  S S   +         +   I R+ERKGW V IHD
Sbjct  42   NVKQPVFTCNFSFKNPGDWNSISRSSLSEGSTSIGCFNCWTTGNAIRRKERKGWLVTIHD  101

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS +AAA + TPFVPS G + V+ SNPG+WLI+RPD   + +W+PWG+L+AW E    
Sbjct  102  LSGSPIAAASMVTPFVPSQGSNRVNGSNPGSWLILRPD---QGTWKPWGRLQAWLENSGE  158

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
               C  F ++ DG      L+ S   I+ + GG+F ID         +   +     DFS
Sbjct  159  LGYC--FEIIPDGANDTIKLVNST--INTKNGGKFNIDITNVSIPTMASANNSF---DFS  211

Query  298  AL---------SPVVG-----GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALA  161
            ++         S  +G     GFVMS  V+G+GK SK  V +  +HV+C EDAA+F+ALA
Sbjct  212  SVSGSWSDFGSSGYLGQILHRGFVMSSTVKGDGKCSKPEVIVGAQHVSCSEDAAVFVALA  271

Query  160  AAVDLSIEACRPFRR-LRRGTRHS  92
            AA+DLS++ACRPF + LR+  R S
Sbjct  272  AALDLSMDACRPFSQTLRKELRQS  295



>ref|XP_009408582.1| PREDICTED: uncharacterized protein LOC103990981 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 149/249 (60%), Gaps = 23/249 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIERRERKGWKVKIHD  659
            N++QP+F+CKFS           R    +P ++ S      S+ E   +ERKGW V +HD
Sbjct  206  NMRQPVFTCKFSCRIAGDGKSSTRSVLSEPGNSRSWLTSFGSERERPVKERKGWSVTVHD  265

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VA A + TPFVPS+G D V RSNPGAWL++RP      +W+PWG+LEAWRERG  
Sbjct  266  LSGSPVALASMVTPFVPSSGTDRVSRSNPGAWLVLRPG---EGTWKPWGRLEAWRERGGA  322

Query  478  DSICC---RFHLLSDGPEGGGDLLMSEILISAEKGGEFYID----TDKQvraaaspvpsp  320
             S      RF LL +   G G + ++E  +SA KGG+F ID    +   V  + SP  SP
Sbjct  323  GSGDGLGYRFELLPEAAMGAG-VTLAESTLSAAKGGQFTIDLIEVSGTPVSRSVSPGCSP  381

Query  319  rsSGDFS-ALSPVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVD  149
            R  GD   AL P     GFVMS  V GE +  +  V++ ++HV C EDAA F+AL AAVD
Sbjct  382  RVGGDLGYALWPCSSYRGFVMSSTVSGERRSGRPTVEVGVQHVGCSEDAAAFVALGAAVD  441

Query  148  LSIEACRPF  122
            LS++ACR F
Sbjct  442  LSMDACRLF  450



>ref|NP_001143291.1| hypothetical protein [Zea mays]
 gb|ACG30371.1| hypothetical protein [Zea mays]
 tpg|DAA57717.1| TPA: hypothetical protein ZEAMMB73_937139 [Zea mays]
Length=447

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 139/252 (55%), Gaps = 31/252 (12%)
 Frame = -3

Query  805  KQPIFSCKFSQDR----VQQVDPLs--------------nfsssfvdssDIEIERRERKG  680
            +QP+F+C+FS  R     + + P S              + +            R +RKG
Sbjct  200  RQPVFTCRFSAGRRAARSRSLTPQSSMSRSTSRRLRSWLSSTLHGEGRDGAHSRREQRKG  259

Query  679  WKVKIHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEA  500
            W V IHDLSGS VAAA + TPFVPS G   V R+NPGAWLI++       SW+PW +LEA
Sbjct  260  WTVTIHDLSGSPVAAASMVTPFVPSPGSGRVSRANPGAWLILQATGAGPSSWKPWARLEA  319

Query  499  WRERGIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsp  320
            WRERG  D++  R  L+ D       + ++E  IS ++GG+F ID             + 
Sbjct  320  WRERGPVDALGYRLELVFDSGAHECAVPIAESSISTKRGGQFVIDP------------AT  367

Query  319  rsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSI  140
                   A  P+ GGFVM   V+GE + S+  VQ+ ++HV C+ D A+F+AL+AAVDL +
Sbjct  368  FPEAAAGAAWPLAGGFVMGSTVEGERRASRPTVQVGVQHVACMGDVAVFVALSAAVDLCM  427

Query  139  EACRPF-RRLRR  107
            +ACR F +RLR+
Sbjct  428  DACRLFSQRLRK  439



>gb|EAZ02678.1| hypothetical protein OsI_24791 [Oryza sativa Indica Group]
Length=462

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 118/253 (47%), Positives = 152/253 (60%), Gaps = 22/253 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS----QDRVQQVDPLsnfsssfvdssDIEIER----RERKGWKVKIHDL  656
            ++KQP+F+CKFS     D   +  P    S      +    +R    +ERKGW V +HDL
Sbjct  203  SMKQPMFTCKFSCRSNSDLRSRSMPADMGSGGRNWLTAFGSDRERAGKERKGWSVTVHDL  262

Query  655  SGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG---  485
            SGS VA A + TPFV S G D V +SNPGAWL++RP      +W+PWG+LE WRERG   
Sbjct  263  SGSPVALASMVTPFVASPGTDRVSKSNPGAWLVLRPG---DGTWKPWGRLECWRERGAGA  319

Query  484  -IRDSICCRFHLLSDGPEGGG-DLLMSEILISAEKGGEFYID--TDKQvraaaspvpspr  317
               DS+  RF L+   P G G  + ++E  I A KGG F ID    +Q   + SP  SP 
Sbjct  320  AAGDSLGYRFELVLPDPTGMGVGVSVAESTIPASKGGRFAIDLTATQQFGRSGSPACSPC  379

Query  316  sSGDFSALSPVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLS  143
             SGD+  + P     GFVMS  VQGEGK S+  V++ +++V C EDAA F+ALAAAVDLS
Sbjct  380  GSGDY-GMWPFGSCRGFVMSPAVQGEGKCSRPAVEVGVQNVGCAEDAAAFVALAAAVDLS  438

Query  142  IEACRPF-RRLRR  107
            ++ACR F  RLRR
Sbjct  439  MDACRLFSHRLRR  451



>dbj|BAJ89011.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 122/255 (48%), Positives = 151/255 (59%), Gaps = 23/255 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFS-------QDRVQQVDPLsnfss-sfvdssDIEIERRERKGWKVKIHDL  656
             + QP+F+CKFS       + R    DP S   +      SD E   +ERKGW V +HDL
Sbjct  195  GMMQPMFTCKFSCRSNSDLRSRSMHSDPGSGGRNWLMSFGSDRERAGKERKGWSVTVHDL  254

Query  655  SGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG---  485
            SGS VA A + TPFV S G D V RSNPGAWL++RP      +W+PWG+LE WRERG   
Sbjct  255  SGSPVALASMVTPFVASPGSDRVSRSNPGAWLVLRPG---DGTWKPWGRLECWRERGAGA  311

Query  484  IRDSICCRFHLLSDGPEGGG-DLLMSEILISAEKGGEFYID--TDKQvraaaspvpsprs  314
              DS+  RF LL   P G G  + ++E  +   +GG F ID    +    + SP  SPR 
Sbjct  312  AGDSLGYRFELLIPDPTGMGVGVSVAESNVPTSRGGRFVIDLTAAQPFGRSGSPGCSPRG  371

Query  313  SGDFS---ALSPVVG--GFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVD  149
            SGDFS    L P     GFVMS  VQGEG+ S+  V++ + HV C EDAA F+ALAAAVD
Sbjct  372  SGDFSGGYGLWPFGSYRGFVMSAAVQGEGRCSRPTVEVGVPHVGCAEDAAAFVALAAAVD  431

Query  148  LSIEACRPF-RRLRR  107
            LS++ACR F  RLRR
Sbjct  432  LSMDACRLFSHRLRR  446



>ref|XP_010030891.1| PREDICTED: uncharacterized protein LOC104420809, partial [Eucalyptus 
grandis]
Length=480

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 146/265 (55%), Gaps = 30/265 (11%)
 Frame = -3

Query  811  NIKQPIFSCKFS-QDRVQQVDPLsnfsssfvdssDIEI----------ERRERKGWKVKI  665
            ++KQP+F+C FS ++ V      S  S S   +S   I            +ERKGW V I
Sbjct  213  SVKQPVFTCNFSFRNNVGDRSLRSRSSLSETSTSRSWIPSLVGSDKDSHSKERKGWSVTI  272

Query  664  HDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERG  485
            HDLSGS VAAA + TPFVPS G D V RSNPGAWLI+RP+     +W+PWG+LEAW E G
Sbjct  273  HDLSGSPVAAASMVTPFVPSPGSDRVSRSNPGAWLIIRPE---HGTWRPWGRLEAWLEHG  329

Query  484  IRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvra----------aas  335
              D +  RF LL +         ++   IS + GG+F ID    V               
Sbjct  330  SSDMLSHRFELLPNT-TTATTGTVANSSISIKNGGKFTIDLTNSVSPMSSPSSSMDLGGG  388

Query  334  pvpsprsSGDFSAL----SPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMA  167
                  S  DF  L    + V GGFVMS  +QG  K SK  V++ ++HVTC EDAA F+A
Sbjct  389  SWSGSGSGSDFVGLGLWPNSVPGGFVMSSTMQGVNKASKPQVEVGVQHVTCTEDAAAFVA  448

Query  166  LAAAVDLSIEACRPF-RRLRRGTRH  95
            LAAA+DLS++AC+ F R+LR   R 
Sbjct  449  LAAAIDLSMDACKLFSRKLRTELRQ  473



>ref|XP_009610822.1| PREDICTED: uncharacterized protein LOC104104441 [Nicotiana tomentosiformis]
Length=437

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 150/264 (57%), Gaps = 31/264 (12%)
 Frame = -3

Query  811  NIKQPIFSCKFS---------QDRVQQVDPLsnfsssfvdssDIEIER-RERKGWKVKIH  662
            N+KQP+F+CKFS         + R    +P ++ S     ++D E+    ERKGW + IH
Sbjct  178  NVKQPVFTCKFSFRNNGDRNLRSRSSLSEPSTSTSCFNSCTADKELSSLTERKGWSITIH  237

Query  661  DLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGI  482
            DLSGS +AAA + TPFVPS G + V RSNPGAWLI+RP      +W+PWG+LEAWRE G 
Sbjct  238  DLSGSPIAAASMVTPFVPSQGSNNVSRSNPGAWLILRPG---NGTWKPWGRLEAWREHG-  293

Query  481  RDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvps-------  323
               +  RF ++ DG      + +S   IS + GG+F +D         SP  S       
Sbjct  294  -GDLGYRFEIIPDGATDA--ITLSNSTISTKNGGKFSVDITNGATPLTSPNSSFDLCSGS  350

Query  322  ------prsSGDFSALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALA  161
                    + G  S    +  GFVMS  V+G+GK SK  V + ++HV C EDAA F+ALA
Sbjct  351  GSGSDFGSAPGSGSWAQLLYRGFVMSSTVEGDGKCSKPEVVVGVQHVNCAEDAAAFVALA  410

Query  160  AAVDLSIEACRPF-RRLRRGTRHS  92
            AA+DLS++A + F ++LR+  R S
Sbjct  411  AAMDLSMDASQSFTKKLRKELRQS  434



>ref|XP_008671026.1| PREDICTED: uncharacterized protein LOC103648311 [Zea mays]
 tpg|DAA42726.1| TPA: hypothetical protein ZEAMMB73_556847 [Zea mays]
Length=455

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 146/245 (60%), Gaps = 23/245 (9%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQ-------QVDPLsnfsssfvdssDIEIER--RERKGWKVKIHD  659
            ++KQP+F+C+FS            Q DP    + +++     E ER  +ERKGW V +HD
Sbjct  212  SMKQPMFTCRFSCRSSSDLRSRSVQSDP---GARNWLAKLGSERERAGKERKGWSVTVHD  268

Query  658  LSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRERGIR  479
            LSGS VA A + TPFV S G D V RS+PGAWLI+RP      +W PWG+LE WR RG  
Sbjct  269  LSGSPVALASMVTPFVASPGTDHVSRSSPGAWLILRP---ADGTWAPWGRLECWRGRG--  323

Query  478  DSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaaspvpsprsSGDFS  299
            D++  RF L+     GG  + ++E  + A +GG F ID       AA+      SSGD  
Sbjct  324  DTLGYRFELVPGHATGGAGVCVAEASVPASRGGRFAID-----LTAAAQPFWCSSSGDMG  378

Query  298  ALSPVVGGFVMSCRVQGEGKYSKLLVQLAMRHVTCVEDAAIFMALAAAVDLSIEACRPFR  119
                  GGFVMS  VQGEG+ S+  V++ + HV C EDAA F+ALAAAVDLS++ACR F 
Sbjct  379  HGIWPFGGFVMSAAVQGEGRCSRPTVEVGVAHVGCAEDAAAFVALAAAVDLSMDACRLFS  438

Query  118  -RLRR  107
             +LRR
Sbjct  439  CKLRR  443



>ref|XP_006406471.1| hypothetical protein EUTSA_v10020590mg [Eutrema salsugineum]
 gb|ESQ47924.1| hypothetical protein EUTSA_v10020590mg [Eutrema salsugineum]
Length=494

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 116/283 (41%), Positives = 144/283 (51%), Gaps = 50/283 (18%)
 Frame = -3

Query  811  NIKQPIFSCKFSQDRVQQVDP------------LsnfsssfvdssDIEIERRERKGWKVK  668
            N KQ +F+CKF       VD             +S  S      S+ E   +ERKGW + 
Sbjct  211  NTKQAVFTCKFGSRNSSSVDRNLIHSSSMMSELISTRSCISSMKSEKEQPSKERKGWSIT  270

Query  667  IHDLSGSAVAAAFITTPFVPSTGCDWVDRSNPGAWLIVRPDPCMRESWQPWGKLEAWRER  488
            +HDLSGS VA A + TPFVPS G + V RS+PGAWLI+RPD C   +W+PWG+LEAWRE 
Sbjct  271  VHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLILRPDGC---TWKPWGRLEAWRET  327

Query  487  GIRDSICCRFHLLSDGPEGGGDLLMSEILISAEKGGEFYIDTDKQvraaa----------  338
            G  DS+  RF L  DG       + +   IS + GG F ID       AA          
Sbjct  328  GYSDSLGYRFELFQDGI---ATAVSASSSISLKNGGSFAIDVTGGTTTAASTPTTSPQGS  384

Query  337  -------------spvpsprsSGDFSALSP--------VVGGFVMSCRVQGEGKYSKLLV  221
                         +  P   S  DF  L P           GFVMS  V+G GK SK  V
Sbjct  385  WDLGSGSSSGSRPASRPGSGSGSDFGYLLPQHPSAAAAQNRGFVMSATVEGVGKRSKPEV  444

Query  220  QLAMRHVTCVEDAAIFMALAAAVDLSIEACRPF-RRLRRGTRH  95
            ++ + HVTC EDAA  +ALAAAVDLS++ACR F  +LR+  R 
Sbjct  445  EVGVTHVTCTEDAAAHVALAAAVDLSLDACRLFSHKLRKELRQ  487



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1646677518220