BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF039M18

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773920.1|  PREDICTED: CAAX prenyl protease 1 homolog          110   2e-25   Nicotiana sylvestris
ref|XP_009615410.1|  PREDICTED: CAAX prenyl protease 1 homolog          108   9e-25   Nicotiana tomentosiformis
gb|EYU35101.1|  hypothetical protein MIMGU_mgv1a006971mg                107   2e-24   Erythranthe guttata [common monkey flower]
ref|XP_004229884.1|  PREDICTED: CAAX prenyl protease 1 homolog          106   5e-24   Solanum lycopersicum
emb|CDP08773.1|  unnamed protein product                                105   9e-24   Coffea canephora [robusta coffee]
gb|KDO86286.1|  hypothetical protein CISIN_1g014430mg                   104   1e-23   Citrus sinensis [apfelsine]
ref|XP_006491174.1|  PREDICTED: CAAX prenyl protease 1 homolog          104   2e-23   Citrus sinensis [apfelsine]
ref|XP_011093122.1|  PREDICTED: CAAX prenyl protease 1 homolog          104   2e-23   Sesamum indicum [beniseed]
ref|XP_006444969.1|  hypothetical protein CICLE_v10020054mg             104   2e-23   
ref|XP_006339615.1|  PREDICTED: CAAX prenyl protease 1 homolog          103   3e-23   Solanum tuberosum [potatoes]
ref|XP_002277525.1|  PREDICTED: CAAX prenyl protease 1 homolog          103   3e-23   Vitis vinifera
ref|XP_002511907.1|  caax prenyl protease ste24, putative               103   5e-23   Ricinus communis
ref|XP_003552415.1|  PREDICTED: CAAX prenyl protease 1 homolog          102   9e-23   Glycine max [soybeans]
ref|XP_009628878.1|  PREDICTED: CAAX prenyl protease 1 homolog          102   9e-23   Nicotiana tomentosiformis
gb|AAM76469.1|  putative CAAX prenyl protease                         95.9    1e-22   Gossypium herbaceum [Arabian cotton]
ref|XP_009762715.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    102   1e-22   Nicotiana sylvestris
ref|XP_009762714.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    102   1e-22   Nicotiana sylvestris
ref|XP_009349805.1|  PREDICTED: CAAX prenyl protease 1 homolog          102   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_007139795.1|  hypothetical protein PHAVU_008G059300g             101   2e-22   Phaseolus vulgaris [French bean]
ref|XP_003534542.1|  PREDICTED: CAAX prenyl protease 1 homolog          101   3e-22   Glycine max [soybeans]
ref|XP_008805562.1|  PREDICTED: CAAX prenyl protease 1 homolog          101   3e-22   Phoenix dactylifera
gb|KHM99334.1|  CAAX prenyl protease 1 like                             100   4e-22   Glycine soja [wild soybean]
gb|KHN29321.1|  CAAX prenyl protease 1 like                             100   4e-22   Glycine soja [wild soybean]
ref|XP_010919128.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   4e-22   Elaeis guineensis
ref|XP_007218053.1|  hypothetical protein PRUPE_ppa006168mg             100   4e-22   Prunus persica
ref|XP_009400731.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   6e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW78104.1|  hypothetical protein EUGRSUZ_D02317                     100   6e-22   Eucalyptus grandis [rose gum]
ref|XP_004492786.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   7e-22   
ref|XP_010053753.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   8e-22   Eucalyptus grandis [rose gum]
ref|XP_008232992.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   9e-22   Prunus mume [ume]
ref|XP_010112964.1|  CAAX prenyl protease 1-like protein              99.8    1e-21   
ref|XP_002302601.1|  CAAX protease family protein                     99.8    1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_011036976.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.4    1e-21   Populus euphratica
ref|XP_002320821.1|  CAAX protease family protein                     99.4    1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_004306744.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.4    2e-21   Fragaria vesca subsp. vesca
ref|XP_008346138.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.4    2e-21   
gb|AAM76472.1|  putative CAAX prenyl protease                         92.8    2e-21   Gossypium hirsutum [American cotton]
ref|XP_004155836.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    2e-21   
ref|XP_004133850.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    2e-21   Cucumis sativus [cucumbers]
ref|XP_008438005.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    2e-21   Cucumis melo [Oriental melon]
gb|EPS68077.1|  hypothetical protein M569_06696                       95.5    3e-21   Genlisea aurea
ref|XP_010261328.1|  PREDICTED: CAAX prenyl protease 1 homolog        98.6    3e-21   Nelumbo nucifera [Indian lotus]
gb|ADE76166.1|  unknown                                               96.3    4e-21   Picea sitchensis
gb|KJB41392.1|  hypothetical protein B456_007G102500                  98.2    4e-21   Gossypium raimondii
gb|KHG15702.1|  CAAX prenyl protease 1 -like protein                  98.2    4e-21   Gossypium arboreum [tree cotton]
ref|XP_006828772.1|  hypothetical protein AMTR_s00001p00094700        98.2    4e-21   Amborella trichopoda
ref|XP_002961362.1|  hypothetical protein SELMODRAFT_266600           98.2    4e-21   Selaginella moellendorffii
ref|XP_003624056.1|  CAAX prenyl protease-like protein                97.4    7e-21   Medicago truncatula
gb|AFK35300.1|  unknown                                               95.5    7e-21   Lotus japonicus
ref|XP_010933964.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.4    8e-21   Elaeis guineensis
ref|XP_010669929.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.1    1e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006853576.1|  hypothetical protein AMTR_s00032p00244440        90.9    1e-20   
ref|XP_009393943.1|  PREDICTED: CAAX prenyl protease 1 homolog        96.3    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004306743.1|  PREDICTED: CAAX prenyl protease 1 homolog        96.3    2e-20   Fragaria vesca subsp. vesca
ref|XP_008810111.1|  PREDICTED: CAAX prenyl protease 1 homolog        96.3    2e-20   Phoenix dactylifera
ref|XP_007051723.1|  Peptidase family M48 family protein              94.7    8e-20   
ref|XP_001783632.1|  predicted protein                                93.2    3e-19   
ref|XP_010544403.1|  PREDICTED: CAAX prenyl protease 1 homolog        92.8    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_006647687.1|  PREDICTED: CAAX prenyl protease 1 homolog        91.7    1e-18   Oryza brachyantha
ref|XP_001780822.1|  predicted protein                                90.5    3e-18   
gb|KDP28583.1|  hypothetical protein JCGZ_14354                       90.1    3e-18   Jatropha curcas
ref|XP_010556569.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  90.1    4e-18   Tarenaya hassleriana [spider flower]
ref|XP_003570103.1|  PREDICTED: CAAX prenyl protease 1 homolog        89.7    5e-18   Brachypodium distachyon [annual false brome]
ref|NP_001047739.1|  Os02g0680400                                     89.0    8e-18   
gb|EEC73787.1|  hypothetical protein OsI_08473                        89.0    8e-18   Oryza sativa Indica Group [Indian rice]
gb|EMT24778.1|  CAAX prenyl protease 1-like protein                   88.2    9e-18   
gb|AFW63375.1|  CAAX prenyl protease 1                                90.1    1e-17   
emb|CDY07191.1|  BnaCnng02060D                                        88.6    1e-17   
ref|XP_009111448.1|  PREDICTED: CAAX prenyl protease 1 homolog        88.6    1e-17   Brassica rapa
emb|CDY48517.1|  BnaA09g00060D                                        88.6    1e-17   Brassica napus [oilseed rape]
ref|NP_567212.1|  CAAX prenyl protease 1 homolog                      88.6    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874990.1|  ATSTE24                                          88.6    1e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_010422802.1|  PREDICTED: CAAX prenyl protease 1 homolog        88.6    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010427521.1|  PREDICTED: CAAX prenyl protease 1 homolog        88.2    1e-17   Camelina sativa [gold-of-pleasure]
gb|AAL07084.1|  putative CAAX prenyl protease                         88.2    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001131195.1|  uncharacterized protein LOC100192503             88.2    2e-17   Zea mays [maize]
ref|XP_002454476.1|  hypothetical protein SORBIDRAFT_04g031850        88.2    2e-17   Sorghum bicolor [broomcorn]
emb|CAL26913.1|  CAAX peptidase                                       88.2    2e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004953446.1|  PREDICTED: CAAX prenyl protease 1 homolog        88.2    2e-17   Setaria italica
ref|XP_006396278.1|  hypothetical protein EUTSA_v10028603mg           88.6    2e-17   
gb|KFK30712.1|  hypothetical protein AALP_AA6G017800                  87.8    2e-17   Arabis alpina [alpine rockcress]
ref|XP_010456236.1|  PREDICTED: CAAX prenyl protease 1 homolog        87.0    5e-17   Camelina sativa [gold-of-pleasure]
emb|CDX91888.1|  BnaC03g31900D                                        86.7    6e-17   
emb|CDX74353.1|  BnaA03g26940D                                        86.7    6e-17   
ref|XP_009134527.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  86.7    7e-17   Brassica rapa
ref|XP_006286757.1|  hypothetical protein CARUB_v10003198mg           86.7    7e-17   Capsella rubella
gb|AAK39514.1|AF353722_1  CaaX processing zinc-metallo endoprotease   86.3    8e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008643874.1|  PREDICTED: CAAX prenyl protease 1 isoform X2     86.3    9e-17   
ref|XP_008643873.1|  PREDICTED: CAAX prenyl protease 1 isoform X1     86.3    1e-16   Zea mays [maize]
ref|NP_001152504.1|  CAAX prenyl protease 1                           86.3    1e-16   Zea mays [maize]
ref|XP_004308344.1|  PREDICTED: CAAX prenyl protease 1 homolog        84.7    3e-16   Fragaria vesca subsp. vesca
gb|AAB61028.1|  A_IG002N01.21 gene product                            80.5    3e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CAN83040.1|  hypothetical protein VITISV_034339                   79.3    8e-15   Vitis vinifera
gb|ESA09906.1|  hypothetical protein GLOINDRAFT_80760                 75.5    5e-13   
emb|CAB80941.1|  putative CAAX prenyl protease                        75.1    9e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134526.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  74.7    1e-12   Brassica rapa
emb|CBJ27157.1|  CaaX prenyl protease Ste24                           72.4    7e-12   Ectocarpus siliculosus
gb|AIC32889.1|  STE24                                                 72.0    9e-12   Puccinellia tenuiflora
ref|XP_002292916.1|  predicted protein                                69.3    9e-11   Thalassiosira pseudonana CCMP1335
emb|CCA18761.1|  CAAX prenyl protease 1 putative                      68.9    1e-10   Albugo laibachii Nc14
ref|XP_002945691.1|  hypothetical protein VOLCADRAFT_78672            68.6    2e-10   Volvox carteri f. nagariensis
emb|CCI48758.1|  unnamed protein product                              68.2    2e-10   Albugo candida
ref|XP_002181639.1|  predicted protein                                67.8    3e-10   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009042161.1|  hypothetical protein AURANDRAFT_34438            65.9    3e-10   Aureococcus anophagefferens
ref|XP_002900396.1|  CAAX prenyl protease 1                           66.6    7e-10   Phytophthora infestans T30-4
ref|XP_003677696.1|  hypothetical protein NCAS_0H00350                66.6    8e-10   Naumovozyma castellii CBS 4309
gb|EWM26686.1|  caax prenyl protease 1                                65.9    1e-09   Nannochloropsis gaditana
emb|CDH09260.1|  probable CAAX prenyl protease 1                      65.5    2e-09   Zygosaccharomyces bailii ISA1307
emb|CDF87226.1|  BN860_01640g1_1                                      65.5    2e-09   Zygosaccharomyces bailii CLIB 213
emb|CDH15706.1|  probable CAAX prenyl protease 1                      65.5    2e-09   Zygosaccharomyces bailii ISA1307
ref|XP_008902128.1|  hypothetical protein PPTG_09033                  64.3    4e-09   Phytophthora parasitica INRA-310
gb|ETK91894.1|  hypothetical protein L915_04651                       64.3    4e-09   Phytophthora parasitica
gb|ETO80780.1|  hypothetical protein F444_04815                       64.3    4e-09   Phytophthora parasitica P1976
gb|ETL98448.1|  hypothetical protein L917_04490                       64.3    4e-09   Phytophthora parasitica
ref|XP_009532258.1|  hypothetical protein PHYSODRAFT_250864           64.3    4e-09   Phytophthora sojae
ref|XP_008611054.1|  hypothetical protein SDRG_07015                  63.9    6e-09   Saprolegnia diclina VS20
dbj|BAO41720.1|  CAAX prenyl protease 1                               63.9    6e-09   Kluyveromyces marxianus DMKU3-1042
dbj|BAP73165.1|  CAAX prenyl protease 1                               63.9    6e-09   Kluyveromyces marxianus
pdb|4IL3|A  Chain A, Crystal Structure Of S. Mikatae Ste24p           63.5    7e-09   Saccharomyces mikatae
gb|EDN63433.1|  zinc metalloprotease                                  63.5    8e-09   Saccharomyces cerevisiae YJM789
ref|XP_004348317.1|  CAAX prenyl protease 1                           63.5    8e-09   Capsaspora owczarzaki ATCC 30864
gb|AJR62890.1|  Ste24p                                                63.5    8e-09   Saccharomyces cerevisiae YJM450
gb|AJR63219.1|  Ste24p                                                63.5    9e-09   Saccharomyces cerevisiae YJM451
gb|AJR59949.1|  Ste24p                                                63.5    9e-09   Saccharomyces cerevisiae YJM193
gb|EWG95205.1|  Ste24p                                                63.5    9e-09   Saccharomyces cerevisiae R103
ref|XP_011104176.1|  ste24p                                           63.5    9e-09   
gb|AJR68004.1|  Ste24p                                                63.5    9e-09   Saccharomyces cerevisiae YJM1250
gb|AJR60934.1|  Ste24p                                                63.5    9e-09   Saccharomyces cerevisiae YJM248
gb|AJR67380.1|  Ste24p                                                63.5    9e-09   Saccharomyces cerevisiae YJM1244
gb|AJR63874.1|  Ste24p                                                63.5    9e-09   Saccharomyces cerevisiae YJM456
emb|CAY80831.1|  Ste24p                                               63.5    9e-09   Saccharomyces cerevisiae EC1118
gb|EDZ71132.1|  YJR117Wp-like protein                                 63.2    9e-09   Saccharomyces cerevisiae AWRI1631
gb|AJR60606.1|  Ste24p                                                63.2    9e-09   Saccharomyces cerevisiae YJM244
gb|EDV12854.1|  CAAX prenyl protease 1                                63.2    9e-09   Saccharomyces cerevisiae RM11-1a
gb|EHN06284.1|  Ste24p                                                63.2    9e-09   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|AJR61585.1|  Ste24p                                                63.2    9e-09   Saccharomyces cerevisiae YJM271
gb|AJR71904.1|  Ste24p                                                63.2    9e-09   Saccharomyces cerevisiae YJM1450
ref|NP_012651.1|  Ste24p                                              63.2    9e-09   Saccharomyces cerevisiae S288C
gb|EJT41596.1|  STE24-like protein                                    63.2    9e-09   Saccharomyces kudriavzevii IFO 1802
gb|EHN01607.1|  Ste24p                                                63.2    9e-09   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
ref|XP_003880033.1|  putative peptidase family M48 domain-contain...  63.2    1e-08   Neospora caninum Liverpool
ref|XP_453545.1|  hypothetical protein                                63.2    1e-08   Kluyveromyces lactis
gb|ETL45293.1|  hypothetical protein L916_04606                       62.8    1e-08   Phytophthora parasitica
gb|ETI52023.1|  hypothetical protein F443_04763                       62.8    1e-08   Phytophthora parasitica P1569
ref|XP_447605.1|  hypothetical protein                                62.8    1e-08   [Candida] glabrata
gb|EME39248.1|  hypothetical protein DOTSEDRAFT_75093                 62.8    1e-08   Dothistroma septosporum NZE10
gb|KDO33073.1|  hypothetical protein SPRG_01888                       62.4    2e-08   Saprolegnia parasitica CBS 223.65
emb|CCK69867.1|  hypothetical protein KNAG_0D01150                    62.4    2e-08   Kazachstania naganishii CBS 8797
ref|XP_003622455.1|  CAAX prenyl protease-like protein                58.5    2e-08   
ref|XP_002553545.1|  KLTH0E01298p                                     62.0    3e-08   Lachancea thermotolerans CBS 6340
gb|KFG61038.1|  CAAX metallo endopeptidase                            59.7    3e-08   Toxoplasma gondii RUB
gb|ESS30154.1|  CAAX metallo endopeptidase                            59.7    3e-08   Toxoplasma gondii VEG
emb|CDO93753.1|  unnamed protein product                              61.6    3e-08   Kluyveromyces dobzhanskii CBS 2104
ref|XP_008861314.1|  hypothetical protein H310_00342                  61.6    3e-08   Aphanomyces invadans
ref|XP_003685564.1|  hypothetical protein TPHA_0E00340                61.6    4e-08   Tetrapisispora phaffii CBS 4417
ref|XP_009822213.1|  hypothetical protein H257_00958                  61.2    5e-08   Aphanomyces astaci
ref|XP_002174544.2|  CAA Xprenyl protease                             60.8    5e-08   Schizosaccharomyces japonicus yFS275
gb|AJR64199.1|  Ste24p                                                60.8    5e-08   Saccharomyces cerevisiae YJM470
gb|EPB83925.1|  hypothetical protein HMPREF1544_09315                 60.8    6e-08   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN04268.1|  metallopeptidase                                     60.8    6e-08   Mucor ambiguus
emb|CEG66514.1|  hypothetical protein RMATCC62417_03079               60.8    6e-08   Rhizopus microsporus
emb|CEP19164.1|  hypothetical protein                                 60.8    6e-08   Parasitella parasitica
emb|CEJ00851.1|  hypothetical protein RMCBS344292_14897               60.8    6e-08   Rhizopus microsporus
ref|XP_005100140.1|  PREDICTED: CAAX prenyl protease 1 homolog        60.5    8e-08   Aplysia californica
ref|XP_002496515.1|  ZYRO0D01892p                                     60.5    8e-08   Zygosaccharomyces rouxii
dbj|GAA95272.1|  hypothetical protein E5Q_01928                       60.5    8e-08   Mixia osmundae IAM 14324
emb|CDS07769.1|  hypothetical protein LRAMOSA01718                    60.1    1e-07   Lichtheimia ramosa
ref|XP_008886307.1|  CAAX metallo endopeptidase                       59.7    1e-07   
ref|XP_002369947.1|  peptidase family M48 domain-containing protein   59.7    1e-07   Toxoplasma gondii ME49
gb|EPZ36837.1|  Peptidase M48 domain-containing protein               58.5    2e-07   Rozella allomycis CSF55
emb|CDH48818.1|  prenyl protease                                      58.9    2e-07   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDJ60176.1|  peptidase family M48 domain-containing protein, ...  58.9    3e-07   Eimeria maxima
gb|KGO76072.1|  Peptidase M48                                         58.9    3e-07   Penicillium italicum
gb|KGO40189.1|  Peptidase M48                                         58.5    3e-07   Penicillium expansum
gb|KEH18809.1|  CAAX prenyl protease-like protein                     58.5    3e-07   Medicago truncatula
gb|EKV19760.1|  CaaX prenyl protease Ste24                            58.2    5e-07   Penicillium digitatum PHI26
ref|XP_009497192.1|  hypothetical protein H696_05044                  58.2    5e-07   Fonticula alba
gb|KIW01377.1|  hypothetical protein PV09_07145                       58.2    5e-07   Verruconis gallopava
ref|XP_005651455.1|  hypothetical protein COCSUDRAFT_27312            57.8    6e-07   Coccomyxa subellipsoidea C-169
ref|XP_003850777.1|  CAAX prenyl protease 1                           57.8    6e-07   Zymoseptoria tritici IPO323
gb|EJK43644.1|  hypothetical protein THAOC_37888                      57.8    7e-07   Thalassiosira oceanica
gb|EMF09871.1|  CaaX prenyl protease                                  57.8    7e-07   Sphaerulina musiva SO2202
ref|XP_009152612.1|  STE24 endopeptidase                              57.8    7e-07   Exophiala dermatitidis NIH/UT8656
gb|KFH71808.1|  hypothetical protein MVEG_02102                       57.0    1e-06   Mortierella verticillata NRRL 6337
ref|XP_007780353.1|  STE24 endopeptidase                              57.0    1e-06   Coniosporium apollinis CBS 100218
emb|CDI76342.1|  peptidase family M48 domain-containing protein, ...  57.0    1e-06   Eimeria acervulina
ref|XP_001639206.1|  predicted protein                                57.4    1e-06   Nematostella vectensis
ref|XP_003669587.1|  hypothetical protein NDAI_0D00300                57.0    1e-06   Naumovozyma dairenensis CBS 421
gb|ETO31171.1|  hypothetical protein RFI_05949                        54.7    1e-06   Reticulomyxa filosa
emb|CDM27808.1|  CAAX prenyl protease 1                               57.0    1e-06   Penicillium roqueforti FM164
ref|XP_002565802.1|  Pc22g18990                                       56.6    1e-06   Penicillium rubens Wisconsin 54-1255
emb|CDJ68920.1|  peptidase family M48 domain-containing protein, ...  57.0    1e-06   Eimeria necatrix
emb|CCG83629.1|  CaaX prenyl protease Ste24                           56.6    1e-06   Taphrina deformans PYCC 5710
emb|CDJ42877.1|  peptidase family M48 domain-containing protein, ...  56.6    2e-06   Eimeria tenella
gb|EZF29046.1|  hypothetical protein H101_07272                       53.9    2e-06   Trichophyton interdigitale H6
gb|KHJ35024.1|  putative peptidase family m48                         56.2    2e-06   Erysiphe necator
emb|CDJ47135.1|  peptidase family M48 domain-containing protein, ...  56.2    2e-06   Eimeria brunetti
dbj|GAM83450.1|  hypothetical protein ANO11243_014380                 56.2    2e-06   fungal sp. No.11243
gb|KEQ83545.1|  CAAX prenyl protease 1                                56.2    2e-06   Aureobasidium pullulans EXF-150
gb|KEQ71244.1|  hypothetical protein M436DRAFT_83534                  56.2    2e-06   Aureobasidium namibiae CBS 147.97
gb|KEQ63120.1|  hypothetical protein M437DRAFT_47585                  55.8    2e-06   Aureobasidium melanogenum CBS 110374
gb|KEQ90314.1|  hypothetical protein AUEXF2481DRAFT_9558              55.8    2e-06   Aureobasidium subglaciale EXF-2481
ref|XP_007584901.1|  putative prenyl protease protein                 55.8    2e-06   
ref|XP_002427421.1|  caax prenyl protease ste24, putative             55.8    2e-06   Pediculus humanus corporis [human body lice]
ref|XP_003954896.1|  hypothetical protein KAFR_0A03260                55.8    2e-06   Kazachstania africana CBS 2517
ref|XP_009028164.1|  hypothetical protein HELRODRAFT_193946           56.6    2e-06   Helobdella robusta
gb|EIE81350.1|  hypothetical protein RO3G_06055                       55.5    4e-06   Rhizopus delemar RA 99-880
ref|XP_001939034.1|  CaaX prenyl protease                             55.5    4e-06   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_008031232.1|  hypothetical protein SETTUDRAFT_35606            55.5    4e-06   Exserohilum turcica Et28A
emb|CDK25391.1|  unnamed protein product                              55.1    4e-06   Kuraishia capsulata CBS 1993
ref|XP_003300873.1|  hypothetical protein PTT_12236                   55.5    4e-06   
gb|KIW82886.1|  hypothetical protein Z517_02129                       55.1    4e-06   Fonsecaea pedrosoi CBS 271.37
gb|EFZ21267.1|  hypothetical protein SINV_07351                       55.1    5e-06   
ref|XP_001623710.1|  predicted protein                                55.1    5e-06   Nematostella vectensis
gb|EGU13174.1|  putative CAAX prenyl protease                         55.1    5e-06   Rhodotorula toruloides ATCC 204091
ref|XP_007688928.1|  hypothetical protein COCMIDRAFT_27157            55.1    5e-06   Bipolaris oryzae ATCC 44560
ref|XP_007712871.1|  hypothetical protein COCCADRAFT_37287            55.1    5e-06   Bipolaris zeicola 26-R-13
gb|EMD85103.1|  hypothetical protein COCHEDRAFT_1035767               55.1    6e-06   Bipolaris maydis C5
ref|XP_007681419.1|  hypothetical protein BAUCODRAFT_39566            55.1    6e-06   Baudoinia panamericana UAMH 10762
ref|XP_007702220.1|  hypothetical protein COCSADRAFT_146923           55.1    6e-06   Bipolaris sorokiniana ND90Pr
ref|XP_011175799.1|  PREDICTED: CAAX prenyl protease 1 homolog        54.7    6e-06   Solenopsis invicta [imported red fire ant]
gb|EPX72601.1|  CAA Xprenyl protease                                  54.7    6e-06   Schizosaccharomyces octosporus yFS286
ref|XP_007720431.1|  STE24 endopeptidase                              54.7    7e-06   Capronia coronata CBS 617.96
ref|XP_003647857.1|  hypothetical protein Ecym_7192                   54.7    7e-06   Eremothecium cymbalariae DBVPG#7215
gb|KIX97886.1|  hypothetical protein Z520_06664                       54.7    7e-06   Fonsecaea multimorphosa CBS 102226
ref|XP_003023010.1|  hypothetical protein TRV_02831                   54.7    8e-06   Trichophyton verrucosum HKI 0517
gb|KIX06592.1|  hypothetical protein Z518_04568                       54.3    8e-06   Rhinocladiella mackenziei CBS 650.93
ref|XP_008080326.1|  hypothetical protein GLAREA_07447                54.3    9e-06   Glarea lozoyensis ATCC 20868
ref|XP_008553204.1|  PREDICTED: CAAX prenyl protease 1 homolog        54.3    9e-06   Microplitis demolitor
ref|XP_007754023.1|  STE24 endopeptidase                              54.3    9e-06   Cladophialophora yegresii CBS 114405
ref|XP_008724234.1|  hypothetical protein G647_10020                  54.3    9e-06   Cladophialophora carrionii CBS 160.54
ref|XP_003661486.1|  hypothetical protein MYCTH_2300946               54.3    9e-06   Thermothelomyces thermophila ATCC 42464
emb|CEP63868.1|  LALA0S09e04302g1_1                                   54.3    9e-06   Lachancea lanzarotensis
ref|XP_001949388.2|  PREDICTED: CAAX prenyl protease 1 homolog        53.9    1e-05   Acyrthosiphon pisum
gb|ELU11443.1|  hypothetical protein CAPTEDRAFT_171238                53.9    1e-05   Capitella teleta
emb|CEJ80463.1|  hypothetical protein VHEMI00644                      53.9    1e-05   Torrubiella hemipterigena
gb|EGD96703.1|  CaaX prenyl protease                                  53.9    1e-05   Trichophyton tonsurans CBS 112818
gb|EMS19341.1|  STE24 endopeptidase                                   53.9    1e-05   Rhodotorula toruloides NP11
emb|CDR49210.1|  RHTO0S24e00782g1_1                                   53.9    1e-05   Rhodotorula toruloides
ref|XP_003172087.1|  CAAX prenyl protease 1                           53.9    1e-05   Nannizzia gypsea CBS 118893
ref|XP_007787411.1|  hypothetical protein EPUS_00192                  53.9    1e-05   Endocarpon pusillum Z07020
gb|EGE06070.1|  CAAX prenyl protease                                  53.9    1e-05   Trichophyton equinum CBS 127.97
ref|XP_003236858.1|  CaaX prenyl protease                             53.5    1e-05   Trichophyton rubrum CBS 118892
ref|XP_011299959.1|  PREDICTED: CAAX prenyl protease 1 homolog        53.5    1e-05   Fopius arisanus
gb|KFH61944.1|  hypothetical protein MVEG_12278                       53.5    1e-05   Mortierella verticillata NRRL 6337
ref|XP_007917686.1|  putative caax prenyl protease 1 protein          53.5    1e-05   Phaeoacremonium minimum UCRPA7
ref|XP_001643526.1|  hypothetical protein Kpol_1008p4                 53.5    1e-05   Vanderwaltozyma polyspora DSM 70294
gb|KIW94481.1|  hypothetical protein Z519_04457                       53.5    2e-05   Cladophialophora bantiana CBS 173.52
ref|XP_004181343.1|  hypothetical protein TBLA_0F02850                53.5    2e-05   Tetrapisispora blattae CBS 6284
gb|KIW26412.1|  hypothetical protein PV07_09509                       53.5    2e-05   Cladophialophora immunda
gb|KFZ20107.1|  hypothetical protein V502_03363                       53.5    2e-05   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|XP_007751798.1|  STE24 endopeptidase                              53.5    2e-05   Cladophialophora psammophila CBS 110553
gb|KFY59517.1|  hypothetical protein V496_05652                       53.5    2e-05   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_460632.1|  DEHA2F06248p                                        53.5    2e-05   Debaryomyces hansenii CBS767
ref|XP_002627156.1|  CaaX prenyl protease                             53.5    2e-05   Blastomyces gilchristii SLH14081
ref|XP_007788183.1|  putative caax prenyl protease 1 protein          53.1    2e-05   
ref|XP_002112567.1|  hypothetical protein TRIADDRAFT_25296            53.1    2e-05   Trichoplax adhaerens
ref|XP_006696845.1|  ribosomal protein L34-like protein               53.5    2e-05   Chaetomium thermophilum var. thermophilum DSM 1495
gb|KFY38041.1|  hypothetical protein V494_04536                       53.1    2e-05   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|EAR85063.2|  M48 family peptidase                                  53.5    2e-05   Tetrahymena thermophila SB210
ref|XP_007737162.1|  STE24 endopeptidase                              53.1    2e-05   Capronia epimyces CBS 606.96
ref|XP_003649011.1|  hypothetical protein THITE_2107126               53.1    2e-05   Thielavia terrestris NRRL 8126
gb|EKG14613.1|  Peptidase M48                                         53.1    2e-05   Macrophomina phaseolina MS6
gb|ENH82556.1|  prenyl protease ste24                                 53.1    2e-05   
ref|XP_006681887.1|  hypothetical protein BATDEDRAFT_17759            53.1    2e-05   Batrachochytrium dendrobatidis JAM81
gb|KIV77520.1|  hypothetical protein PV11_09310                       53.1    2e-05   Exophiala sideris
gb|KIN03786.1|  hypothetical protein OIDMADRAFT_158613                52.8    2e-05   Oidiodendron maius Zn
gb|KIW71892.1|  hypothetical protein PV04_00120                       53.1    2e-05   Phialophora americana
ref|XP_003683140.1|  hypothetical protein TDEL_0H00700                52.8    3e-05   Torulaspora delbrueckii
ref|XP_002842311.1|  hypothetical protein                             52.8    3e-05   Tuber melanosporum Mel28
gb|KFY19341.1|  hypothetical protein V493_08005                       52.8    3e-05   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_002843395.1|  CAAX prenyl protease 1                           52.8    3e-05   Microsporum canis CBS 113480
ref|XP_011398178.1|  CAAX prenyl protease 1-like protein              52.8    3e-05   Auxenochlorella protothecoides
gb|KIW50693.1|  hypothetical protein PV05_09481                       52.8    3e-05   Exophiala xenobiotica
ref|XP_007283748.1|  prenyl protease                                  52.8    3e-05   
gb|KFY76197.1|  hypothetical protein V499_04041                       53.1    3e-05   Pseudogymnoascus sp. VKM F-103
gb|KFX89268.1|  hypothetical protein V490_07139                       52.8    3e-05   Pseudogymnoascus sp. VKM F-3557
gb|KFZ02509.1|  hypothetical protein V501_09542                       52.8    3e-05   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KEY76113.1|  CaaX prenyl protease Ste24                            52.8    3e-05   Aspergillus fumigatus var. RP-2014
ref|XP_752066.2|  CaaX prenyl protease Ste24                          52.8    3e-05   
ref|XP_007295712.1|  peptidase family M48                             52.8    3e-05   
ref|XP_827211.1|  CAAX prenyl protease 1                              52.4    3e-05   
gb|KFY87676.1|  hypothetical protein V500_06835                       52.8    3e-05   
emb|CBH14419.1|  CAAX prenyl protease 1, putative                     52.4    3e-05   
ref|XP_006673104.1|  CaaX prenyl protease                             52.4    3e-05   
ref|XP_001032726.1|  Peptidase family M48 containing protein          52.8    3e-05   
gb|EDP50136.1|  CaaX prenyl protease Ste24                            52.4    3e-05   
gb|EFX04750.1|  prenyl protease ste24                                 52.8    4e-05   
ref|XP_002377095.1|  CaaX prenyl protease Ste24                       52.0    4e-05   
gb|EFQ29725.1|  peptidase family M48                                  52.4    4e-05   
gb|KHC34914.1|  STE24 endopeptidase                                   52.4    4e-05   
ref|XP_713382.1|  potential a-factor pheromone maturation protease    52.4    4e-05   
gb|KGQ86300.1|  STE24 endopeptidase                                   52.4    4e-05   
ref|WP_011985824.1|  peptidase M48                                    52.0    4e-05   
ref|XP_002419706.1|  CAAX prenyl protease, putative; zinc metallo...  52.0    4e-05   
gb|KDN65807.1|  putative peptidase family M48                         52.0    4e-05   
ref|XP_001524327.1|  CAAX prenyl protease 1                           52.0    5e-05   
gb|KFY09356.1|  hypothetical protein V492_05514                       52.4    5e-05   
gb|KFY04966.1|  hypothetical protein V491_09229                       52.0    5e-05   
ref|NP_593547.1|  CAAX prenyl protease (predicted)                    52.0    5e-05   
ref|XP_001821320.1|  CAAX prenyl protease 1                           52.0    5e-05   
gb|KIV94338.1|  hypothetical protein PV10_02112                       52.0    5e-05   
ref|XP_007595308.1|  peptidase family M48                             52.0    5e-05   
emb|CCF47842.1|  peptidase family M48                                 52.0    5e-05   
gb|KIW42251.1|  hypothetical protein PV06_05815                       52.0    6e-05   
gb|KIW12304.1|  hypothetical protein PV08_09581                       52.0    6e-05   
ref|XP_002584079.1|  hypothetical protein UREG_04768                  52.0    6e-05   
ref|XP_002796885.1|  CAAX prenyl protease                             52.0    6e-05   
ref|XP_001540370.1|  CaaX prenyl protease                             51.6    6e-05   
gb|EGC45621.1|  CaaX prenyl protease                                  51.6    6e-05   
gb|EEH10632.1|  CaaX prenyl protease                                  51.6    6e-05   
ref|XP_003067440.1|  CAAX prenyl protease, putative                   51.6    6e-05   
gb|EER44696.1|  CaaX prenyl protease                                  51.6    6e-05   
ref|XP_005705678.1|  STE24 endopeptidase                              51.6    6e-05   
ref|XP_001267265.1|  CaaX prenyl protease Ste24                       51.6    6e-05   
dbj|GAA32070.1|  STE24 endopeptidase                                  51.6    6e-05   
ref|XP_011115562.1|  hypothetical protein H072_10056                  51.6    6e-05   
ref|XP_001271650.1|  CaaX prenyl protease Ste24                       51.6    6e-05   
gb|AAX78522.1|  CaaX prenyl protease                                  51.6    6e-05   
ref|XP_010759714.1|  hypothetical protein PADG_04087                  51.6    6e-05   
gb|EKG03313.1|  CAAX prenyl protease 1, putative,metallo-peptidas...  51.6    6e-05   
gb|AAK48428.1|AF252543_1  putative CAAX prenyl protease 1             51.6    6e-05   
gb|KFA62896.1|  hypothetical protein S40285_02256                     51.6    6e-05   
gb|KEY67837.1|  hypothetical protein S7711_04975                      51.6    6e-05   
ref|XP_805036.1|  CAAX prenyl protease 1                              51.6    6e-05   
gb|KFH43653.1|  CAAX prenyl protease-like protein                     51.6    6e-05   
ref|XP_001239931.1|  hypothetical protein CIMG_09552                  51.6    6e-05   
gb|EMG47484.1|  CAAX prenyl protease 1                                51.6    7e-05   
gb|AAL86599.1|AC114397_1  Tcc1i14-2.1                                 51.2    7e-05   
gb|KEF63154.1|  STE24 endopeptidase                                   51.6    7e-05   
gb|EAR82576.3|  CAAX prenyl protease                                  51.6    7e-05   
gb|EPS28736.1|  hypothetical protein PDE_03682                        51.6    7e-05   
ref|XP_003395300.1|  PREDICTED: CAAX prenyl protease 1 homolog        51.6    7e-05   
gb|ELR10214.1|  STE24 endopeptidase                                   51.6    7e-05   
ref|XP_001030239.2|  Peptidase family M48 containing protein          51.6    7e-05   
ref|XP_009848380.1|  hypothetical protein NEUTE1DRAFT_120293          51.6    7e-05   
ref|XP_961364.3|  CaaX prenyl protease Ste24                          51.6    7e-05   
gb|AAK48427.1|AF252542_1  putative CAAX prenyl protease 1             51.2    8e-05   
ref|XP_009654014.1|  CAAX prenyl protease                             51.2    8e-05   
emb|CCX14243.1|  Similar to CAAX prenyl protease 1; acc. no. P47154   51.2    8e-05   
gb|EJW81448.1|  hypothetical protein WUBG_07644                       49.3    8e-05   
ref|XP_002545231.1|  CAAX prenyl protease 1                           51.2    8e-05   
ref|XP_009168050.1|  hypothetical protein T265_13631                  51.2    8e-05   
ref|XP_001214622.1|  hypothetical protein ATEG_05444                  51.2    1e-04   
gb|EQL00306.1|  Peptidase M48                                         51.2    1e-04   
ref|XP_011121081.1|  hypothetical protein AOL_s00076g226              51.2    1e-04   
ref|WP_012525562.1|  peptidase M48                                    50.8    1e-04   
ref|XP_819225.1|  CAAX prenyl protease 1                              50.8    1e-04   
gb|AAK48429.1|AF252544_1  putative CAAX prenyl protease 1             50.8    1e-04   
ref|WP_012632881.1|  peptidase M48                                    50.8    1e-04   
ref|WP_031432442.1|  peptidase M48                                    50.8    1e-04   
ref|XP_003833774.1|  similar to CaaX prenyl protease                  50.8    1e-04   
gb|EWG42807.1|  STE24 endopeptidase                                   50.8    1e-04   
gb|KEZ39101.1|  CAAX prenyl protease 1                                50.8    1e-04   
ref|XP_003349500.1|  hypothetical protein SMAC_03088                  50.8    1e-04   
ref|XP_009222333.1|  CAAX prenyl protease 1                           50.8    1e-04   
ref|WP_020483479.1|  peptidase M48                                    50.8    1e-04   
ref|WP_026603220.1|  peptidase M48                                    50.8    1e-04   
ref|XP_003374747.1|  CAAX prenyl protease 1-like protein              50.8    1e-04   
gb|ABG89280.1|  type I CAAX protease                                  50.8    1e-04   
gb|KID79414.1|  Peptidase M48                                         50.8    1e-04   
dbj|GAD96409.1|  conserved hypothetical protein                       51.2    1e-04   
ref|XP_003050604.1|  predicted protein                                50.8    1e-04   
emb|CCC09083.1|  unnamed protein product                              50.8    1e-04   
ref|XP_001911737.1|  hypothetical protein                             50.8    1e-04   
ref|XP_007834407.1|  hypothetical protein PFICI_07635                 50.8    1e-04   
ref|XP_003869947.1|  Ste24 prenyl-dependent protease                  50.4    1e-04   
ref|XP_001565767.2|  putative CAAX prenyl protease 1                  50.4    1e-04   
gb|KIL91310.1|  hypothetical protein FAVG1_04924                      50.4    1e-04   
emb|CCE28602.1|  probable zinc metallo-protease                       50.4    1e-04   
ref|XP_010700091.1|  CAAX prenyl protease 1, putative                 50.4    1e-04   
ref|WP_013817355.1|  peptidase M48                                    50.4    2e-04   
ref|XP_003709694.1|  CAAX prenyl protease 1                           50.4    2e-04   
tpg|DAA01789.1|  TPA: CaaX prenyl protease                            50.4    2e-04   
gb|KDB15160.1|  putative zinc metallo-protease                        50.4    2e-04   
gb|EYE94778.1|  CaaX prenyl protease Ste24                            50.4    2e-04   
gb|AAX27871.2|  SJCHGC08945 protein                                   47.8    2e-04   
ref|XP_007812372.1|  putative zinc metallo-protease                   50.1    2e-04   
ref|XP_001485714.1|  hypothetical protein PGUG_01385                  50.1    2e-04   
gb|KHN95623.1|  Peptidase M48                                         50.1    2e-04   
ref|XP_007822354.1|  metallopeptidase                                 50.1    2e-04   
ref|XP_007878405.1|  hypothetical protein PFL1_02700                  50.1    2e-04   
gb|EPY52822.1|  CAA Xprenyl protease                                  50.1    2e-04   
gb|KID91898.1|  Peptidase M48                                         50.1    2e-04   
gb|EIF49165.1|  caax prenyl protease 1                                49.7    2e-04   
gb|KID96212.1|  Peptidase M48                                         50.1    2e-04   
ref|XP_001593172.1|  hypothetical protein SS1G_06094                  50.1    2e-04   
gb|ELQ35873.1|  CAAX prenyl protease 1                                50.1    2e-04   
ref|XP_001559859.1|  hypothetical protein BC1G_01418                  50.1    2e-04   
gb|ESZ94952.1|  putative CAAX prenyl protease 1                       50.1    2e-04   
dbj|GAA82676.1|  CaaX prenyl protease Ste24                           50.1    2e-04   
ref|XP_002492040.1|  Highly conserved zinc metalloprotease            49.7    2e-04   
emb|CCU75602.1|  CAAX prenyl protease 1                               49.7    2e-04   
emb|CCE44422.1|  hypothetical protein CPAR2_402230                    49.7    2e-04   
gb|EKF31835.1|  CAAX prenyl protease 1, putative,metallo-peptidas...  49.7    3e-04   
gb|EMT68098.1|  CAAX prenyl protease 1                                49.7    3e-04   
ref|XP_001401563.1|  CAAX prenyl protease 1                           49.7    3e-04   
ref|WP_040096600.1|  peptidase M48                                    49.7    3e-04   
ref|WP_033157806.1|  peptidase M48                                    49.7    3e-04   
gb|ENH68811.1|  CAAX prenyl protease 1                                49.7    3e-04   
gb|EXL53967.1|  STE24 endopeptidase                                   49.7    3e-04   
gb|EWZ02551.1|  STE24 endopeptidase                                   49.7    3e-04   
gb|EPQ63344.1|  hypothetical protein BGT96224_A20765                  49.7    3e-04   
gb|EXM07215.1|  STE24 endopeptidase                                   49.7    3e-04   
gb|EGU84979.1|  hypothetical protein FOXB_04560                       49.7    3e-04   
gb|EPE10297.1|  caax prenyl protease 1                                49.7    3e-04   
ref|XP_007376706.1|  hypothetical protein SPAPADRAFT_62544            49.7    3e-04   
ref|XP_007874215.1|  hypothetical protein PNEG_02231                  49.3    3e-04   
ref|XP_008473923.1|  PREDICTED: CAAX prenyl protease 1 homolog        49.7    3e-04   
ref|WP_020561975.1|  peptidase M48                                    49.3    3e-04   
gb|EIE75327.1|  hypothetical protein RO3G_00031                       49.3    4e-04   
emb|CDQ04133.1|  Protein BM-FCE-1, isoform a                          49.3    4e-04   
ref|XP_001895892.1|  Peptidase family M48 containing protein          49.3    4e-04   
ref|XP_008719516.1|  hypothetical protein HMPREF1541_06969            49.3    4e-04   
ref|XP_003488753.1|  PREDICTED: CAAX prenyl protease 1 homolog        49.3    4e-04   
emb|CDQ04132.1|  Protein BM-FCE-1, isoform b                          49.3    4e-04   
ref|XP_011263701.1|  PREDICTED: CAAX prenyl protease 1 homolog        49.3    4e-04   
emb|CCT67513.1|  probable zinc metallo-protease                       49.3    4e-04   
ref|XP_004034755.1|  hypothetical protein IMG5_114790                 48.9    5e-04   
ref|XP_010624213.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  48.9    5e-04   
ref|XP_002485210.1|  CaaX prenyl protease Ste24                       48.9    5e-04   
dbj|GAM22211.1|  hypothetical protein SAMD00019534_053860             48.9    5e-04   
ref|XP_010624212.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  48.9    5e-04   
ref|WP_020019791.1|  hypothetical protein                             48.9    5e-04   
ref|XP_002148969.1|  CaaX prenyl protease Ste24                       48.9    5e-04   
emb|CCW69666.1|  unnamed protein product                              48.9    5e-04   
dbj|GAM40464.1|  zinc metalloprotease                                 48.9    5e-04   
ref|XP_008710233.1|  PREDICTED: CAAX prenyl protease 1 homolog        48.9    5e-04   
ref|XP_002617470.1|  hypothetical protein CLUG_02914                  47.8    5e-04   
emb|CCC50545.1|  putative CAAX prenyl protease 1                      48.5    6e-04   
ref|XP_011324509.1|  hypothetical protein FGSG_12839                  48.5    6e-04   
dbj|GAC98932.1|  CaaX prenyl protease Ste24                           48.5    6e-04   
gb|ABC82127.1|  Ste24 endopeptidase                                   48.5    6e-04   
ref|XP_009254473.1|  hypothetical protein FPSE_03079                  48.5    6e-04   
ref|WP_041453515.1|  peptidase M48                                    48.5    7e-04   
gb|KDR22915.1|  CAAX prenyl protease 1-like protein                   48.5    7e-04   
ref|XP_007929109.1|  hypothetical protein MYCFIDRAFT_86743            48.5    7e-04   
gb|ESW97721.1|  zinc metalloprotease                                  48.5    7e-04   
gb|ETE70091.1|  CAAX prenyl protease 1-like protein                   48.5    7e-04   
ref|XP_007430031.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  48.5    8e-04   
ref|XP_007430032.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  48.1    8e-04   
gb|KGQ04223.1|  CAAX prenyl protease 1                                48.1    8e-04   
gb|AFI71084.1|  putative CAAX prenyl protease                         46.6    8e-04   
gb|EST05670.1|  metalloprotease                                       48.1    8e-04   
ref|XP_006503082.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  48.1    8e-04   
ref|XP_008601147.1|  peptidase family M48                             48.1    8e-04   
gb|EFA74575.1|  CAAX prenyl protease                                  48.1    9e-04   
ref|XP_010958108.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  48.1    9e-04   
gb|EHK42306.1|  metallopeptidase M48                                  48.1    0.001   
ref|XP_784397.3|  PREDICTED: CAAX prenyl protease 1 homolog           48.1    0.001   
emb|CCA73227.1|  probable zinc metallo-protease                       48.1    0.001   
gb|ERE83119.1|  putative CAAX prenyl protease 1 like protein          48.1    0.001   
ref|XP_003501864.1|  PREDICTED: CAAX prenyl protease 1 homolog        48.1    0.001   



>ref|XP_009773920.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana sylvestris]
Length=424

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/54 (94%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KKLGYA PLR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT
Sbjct  370  KKLGYAAPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  423



>ref|XP_009615410.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KKLGYA PLR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP+KKT
Sbjct  370  KKLGYAAPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPEKKT  423



>gb|EYU35101.1| hypothetical protein MIMGU_mgv1a006971mg [Erythranthe guttata]
Length=424

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KKLGYA PLR G +KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE DKKT
Sbjct  370  KKLGYATPLRAGLIKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEADKKT  423



>ref|XP_004229884.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum lycopersicum]
Length=424

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KKLGYA PLR G VKLQEENLS+MNTDPWYSAYHYSHPPLVERLAAIDE DKKT
Sbjct  370  KKLGYAAPLRAGLVKLQEENLSSMNTDPWYSAYHYSHPPLVERLAAIDESDKKT  423



>emb|CDP08773.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY+L LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDKK
Sbjct  370  KKLGYSLALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDKK  422



>gb|KDO86286.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=309

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK
Sbjct  255  KKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  307



>ref|XP_006491174.1| PREDICTED: CAAX prenyl protease 1 homolog [Citrus sinensis]
 gb|KDO86285.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=424

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK
Sbjct  370  KKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  422



>ref|XP_011093122.1| PREDICTED: CAAX prenyl protease 1 homolog [Sesamum indicum]
Length=424

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KKLGY  PLR G +KLQEENLSAMNTD WYSAYHYSHPPLVERLAAIDEPDKKT
Sbjct  370  KKLGYGAPLRAGLIKLQEENLSAMNTDHWYSAYHYSHPPLVERLAAIDEPDKKT  423



>ref|XP_006444969.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
 gb|ESR58209.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
Length=463

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK
Sbjct  409  KKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  461



>ref|XP_006339615.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum tuberosum]
Length=424

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/54 (91%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KKLGYA PLR G VKLQEENLSAMNTD WYSAYHYSHPPLVERLAAIDE DKKT
Sbjct  370  KKLGYAAPLRAGLVKLQEENLSAMNTDHWYSAYHYSHPPLVERLAAIDESDKKT  423



>ref|XP_002277525.1| PREDICTED: CAAX prenyl protease 1 homolog [Vitis vinifera]
 emb|CBI40422.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDKK
Sbjct  370  KKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDKK  422



>ref|XP_002511907.1| caax prenyl protease ste24, putative [Ricinus communis]
 gb|EEF50576.1| caax prenyl protease ste24, putative [Ricinus communis]
Length=424

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDKK
Sbjct  370  KKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDKK  422



>ref|XP_003552415.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDKK
Sbjct  370  KKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDKK  422



>ref|XP_009628878.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERL AIDE DKKT
Sbjct  370  KKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLTAIDEIDKKT  423



>gb|AAM76469.1| putative CAAX prenyl protease [Gossypium herbaceum]
 gb|AAM76470.1| putative CAAX prenyl protease [Gossypium raimondii]
 gb|AAM76471.1| putative CAAX prenyl protease [Gossypium hirsutum]
 gb|AAM76473.1| putative CAAX prenyl protease [Gossypioides kirkii]
Length=55

 Score = 95.9 bits (237),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  DKK
Sbjct  1    KKLGYGSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDAADKK  53



>ref|XP_009762715.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Nicotiana 
sylvestris]
Length=403

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERL AIDE DKKT
Sbjct  349  KKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLTAIDEHDKKT  402



>ref|XP_009762714.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Nicotiana 
sylvestris]
Length=424

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERL AIDE DKKT
Sbjct  370  KKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLTAIDEHDKKT  423



>ref|XP_009349805.1| PREDICTED: CAAX prenyl protease 1 homolog [Pyrus x bretschneideri]
Length=424

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY+  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID+PDKK
Sbjct  370  KKLGYSSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDKPDKK  422



>ref|XP_007139795.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
 gb|ESW11789.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
Length=424

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLA +DEPDKK
Sbjct  370  KKLGYASELRSGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAVLDEPDKK  422



>ref|XP_003534542.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLA +DEPDKK
Sbjct  370  KKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAVLDEPDKK  422



>ref|XP_008805562.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805563.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805564.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA++EPD+K
Sbjct  370  KKLGYATALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALEEPDRK  422



>gb|KHM99334.1| CAAX prenyl protease 1 like [Glycine soja]
Length=424

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D+PDKK
Sbjct  370  KKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDKPDKK  422



>gb|KHN29321.1| CAAX prenyl protease 1 like [Glycine soja]
Length=375

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLA +DEPDKK
Sbjct  321  KKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAVLDEPDKK  373



>ref|XP_010919128.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA++EPD+K
Sbjct  370  KKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALEEPDRK  422



>ref|XP_007218053.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19252.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=424

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERL AID+PDKK
Sbjct  370  KKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLDAIDKPDKK  422



>ref|XP_009400731.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G +KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI+EPD K
Sbjct  370  KKLGYAKALRAGLIKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIEEPDSK  422



>gb|KCW78104.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=411

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID+ DKK
Sbjct  357  KKLGYASELRSGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDKSDKK  409



>ref|XP_004492786.1| PREDICTED: CAAX prenyl protease 1 homolog [Cicer arietinum]
Length=432

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  325
            KKLGY+  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDK
Sbjct  376  KKLGYSSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDK  427



>ref|XP_010053753.1| PREDICTED: CAAX prenyl protease 1 homolog [Eucalyptus grandis]
 gb|KCW78103.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=423

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID+ DKK
Sbjct  369  KKLGYASELRSGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDKSDKK  421



>ref|XP_008232992.1| PREDICTED: CAAX prenyl protease 1 homolog [Prunus mume]
Length=424

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K+LGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERL AID+PDKK
Sbjct  370  KRLGYASALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLDAIDKPDKK  422



>ref|XP_010112964.1| CAAX prenyl protease 1-like protein [Morus notabilis]
 gb|EXC35123.1| CAAX prenyl protease 1-like protein [Morus notabilis]
Length=436

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DEPDKK
Sbjct  382  KKLGYTSSLRVALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDEPDKK  434



>ref|XP_002302601.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE81874.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   LR G VKLQEENLS+MNTDPWYSAYHYSHPPLVERLAAIDE DKK
Sbjct  370  KKLGYGSALRAGLVKLQEENLSSMNTDPWYSAYHYSHPPLVERLAAIDEADKK  422



>ref|XP_011036976.1| PREDICTED: CAAX prenyl protease 1 homolog [Populus euphratica]
Length=424

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   LR G VKLQEENLS+MNTDPWYSAYHYSHPPLVERLAAIDE DKK
Sbjct  370  KKLGYGSALRGGLVKLQEENLSSMNTDPWYSAYHYSHPPLVERLAAIDESDKK  422



>ref|XP_002320821.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE99136.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   LR G VKLQEENLS+MNTDPWYSAYHYSHPPLVERLAAIDE DKK
Sbjct  370  KKLGYGSALRGGLVKLQEENLSSMNTDPWYSAYHYSHPPLVERLAAIDESDKK  422



>ref|XP_004306744.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=426

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            K LGYA  LR G V+LQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  KKT
Sbjct  372  KALGYAASLRAGLVRLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEETKKT  425



>ref|XP_008346138.1| PREDICTED: CAAX prenyl protease 1 homolog [Malus domestica]
Length=424

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY+  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID+P KK
Sbjct  370  KKLGYSSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDKPXKK  422



>gb|AAM76472.1| putative CAAX prenyl protease [Gossypium hirsutum]
Length=55

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   LR G VKLQE+NLSAMNTDPWYS YHYSHPPLVERLAAID  DKK
Sbjct  1    KKLGYGSALRAGLVKLQEKNLSAMNTDPWYSTYHYSHPPLVERLAAIDAADKK  53



>ref|XP_004155836.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
Length=424

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            +KLGY+ PLR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D  DKK
Sbjct  370  QKLGYSAPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDLADKK  422



>ref|XP_004133850.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
 gb|KGN56492.1| hypothetical protein Csa_3G121680 [Cucumis sativus]
Length=424

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            +KLGY+ PLR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D  DKK
Sbjct  370  QKLGYSAPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDLADKK  422



>ref|XP_008438005.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis melo]
Length=424

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            +KLGY+ PLR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D  DKK
Sbjct  370  QKLGYSAPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDLADKK  422



>gb|EPS68077.1| hypothetical protein M569_06696, partial [Genlisea aurea]
Length=177

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 2/55 (4%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP--DKK  322
            KKLGY  PLR G +KLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID+   DKK
Sbjct  121  KKLGYGGPLRAGLIKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDDDAHDKK  175



>ref|XP_010261328.1| PREDICTED: CAAX prenyl protease 1 homolog [Nelumbo nucifera]
Length=424

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLG A PLR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DE +KK
Sbjct  370  KKLGLAKPLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDESNKK  422



>gb|ADE76166.1| unknown [Picea sitchensis]
Length=228

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGY  PLR G +KLQEENLS MNTDPWYSAYHYSHPPLVERLAA+D  DKK
Sbjct  174  KNLGYGAPLRAGLIKLQEENLSTMNTDPWYSAYHYSHPPLVERLAALDRSDKK  226



>gb|KJB41392.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=424

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  DKK
Sbjct  370  KKLGYGSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDAADKK  422



>gb|KHG15702.1| CAAX prenyl protease 1 -like protein [Gossypium arboreum]
Length=424

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  DKK
Sbjct  370  KKLGYGSALRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDAADKK  422



>ref|XP_006828772.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
 gb|ERM96188.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
Length=424

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY+ PLR   +KLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D  DKK
Sbjct  370  KKLGYSTPLRAALIKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDTADKK  422



>ref|XP_002961362.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
 gb|EFJ36622.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
Length=424

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            +LGYALPLR G +KLQEENLSAMNTDPWYS YHYSHPPLVERLAA+D+  KKT
Sbjct  371  ELGYALPLRGGLIKLQEENLSAMNTDPWYSTYHYSHPPLVERLAALDKFQKKT  423



>ref|XP_003624056.1| CAAX prenyl protease-like protein [Medicago truncatula]
 gb|AES80274.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=426

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/52 (87%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  325
            KKLGY+  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D PDK
Sbjct  370  KKLGYSSSLRAGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDIPDK  421



>gb|AFK35300.1| unknown [Lotus japonicus]
Length=229

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR G V+LQEENLSAMNTDPWYSAYHYSHPPLVERL AID+ DKK
Sbjct  175  KNLGYAAELRLGLVRLQEENLSAMNTDPWYSAYHYSHPPLVERLEAIDKSDKK  227



>ref|XP_010933964.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA++EP  K
Sbjct  370  KKLGYAAALRSGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALEEPGSK  422



>ref|XP_010669929.1| PREDICTED: CAAX prenyl protease 1 homolog [Beta vulgaris subsp. 
vulgaris]
Length=425

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  L+ G VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+DE DKK
Sbjct  371  KNLGYASELKCGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDETDKK  423



>ref|XP_006853576.1| hypothetical protein AMTR_s00032p00244440, partial [Amborella 
trichopoda]
 gb|ERN15043.1| hypothetical protein AMTR_s00032p00244440, partial [Amborella 
trichopoda]
Length=60

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKL  + PLR   +KLQEENLSAMNTDPWYSAYHYSHPPLVERLAA+D  DKK
Sbjct  6    KKLACSTPLRAALIKLQEENLSAMNTDPWYSAYHYSHPPLVERLAALDITDKK  58



>ref|XP_009393943.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G +KLQEENLSAMNTDPWYSAYHYSHPPLVERL+AI+E D K
Sbjct  370  KKLGYAKALRAGLIKLQEENLSAMNTDPWYSAYHYSHPPLVERLSAIEEADSK  422



>ref|XP_004306743.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=424

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR   V+LQEENLSAMNTDPWYSAYHYSHPPLVERLAAI E DKK
Sbjct  370  KKLGYASSLRASLVRLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIGETDKK  422



>ref|XP_008810111.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  LR G VKLQEENLSAMNTDPWYSAYHYSHPPLVERL A++EP  K
Sbjct  370  KKLGYAAALRSGLVKLQEENLSAMNTDPWYSAYHYSHPPLVERLTALEEPGSK  422



>ref|XP_007051723.1| Peptidase family M48 family protein [Theobroma cacao]
 gb|EOX95880.1| Peptidase family M48 family protein [Theobroma cacao]
Length=435

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 48/64 (75%), Gaps = 11/64 (17%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQ-----------EENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  334
            KKLGY   LR G VKLQ           EENLSAMNTDPWYSAYHYSHPPLVERLAAIDE
Sbjct  370  KKLGYGSALRAGLVKLQVTELEFSPLFQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  429

Query  333  PDKK  322
            PDKK
Sbjct  430  PDKK  433



>ref|XP_001783632.1| predicted protein [Physcomitrella patens]
 gb|EDQ51527.1| predicted protein [Physcomitrella patens]
Length=428

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            + LGY  PLR G +KLQEENLSAMNTDPWYSAYH+SHPPLVERL A+DE  KKT
Sbjct  374  RSLGYREPLRAGLIKLQEENLSAMNTDPWYSAYHHSHPPLVERLQALDETSKKT  427



>ref|XP_010544403.1| PREDICTED: CAAX prenyl protease 1 homolog [Tarenaya hassleriana]
Length=424

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGY+  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYSQDLRNALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLEAIDGEDKKT  423



>ref|XP_006647687.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryza brachyantha]
Length=425

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERL+A+++PD K
Sbjct  370  KNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSALEDPDSK  422



>ref|XP_001780822.1| predicted protein [Physcomitrella patens]
 gb|EDQ54379.1| predicted protein [Physcomitrella patens]
Length=428

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            + LGY   LR G +KLQEENLSAMNTDPWYSAYHYSHPPLVERL A+DE  KK
Sbjct  374  RSLGYKDSLRAGLIKLQEENLSAMNTDPWYSAYHYSHPPLVERLQALDEASKK  426



>gb|KDP28583.1| hypothetical protein JCGZ_14354 [Jatropha curcas]
Length=423

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY  PLR G VKLQ ENL AMNTDPW+SAYH+SHP LVERLA ++EPDKK
Sbjct  369  KKLGYCSPLRSGLVKLQVENLEAMNTDPWFSAYHHSHPCLVERLAELNEPDKK  421



>ref|XP_010556569.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556570.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Tarenaya 
hassleriana]
Length=424

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KL YA  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  D KT
Sbjct  371  KLDYAKDLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDGLDPKT  423



>ref|XP_003570103.1| PREDICTED: CAAX prenyl protease 1 homolog [Brachypodium distachyon]
Length=425

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERL+AI++ D K
Sbjct  370  KNLGYAPELRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSAIEDLDSK  422



>ref|NP_001047739.1| Os02g0680400 [Oryza sativa Japonica Group]
 sp|Q6EPN8.1|FACE1_ORYSJ RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=FACE-1; AltName: 
Full=Prenyl protein-specific endoprotease 1; AltName: Full=Zinc 
metalloproteinase Ste24 homolog [Oryza sativa Japonica 
Group]
 dbj|BAD29382.1| putative Ste24p [Oryza sativa Japonica Group]
 dbj|BAF09653.1| Os02g0680400 [Oryza sativa Japonica Group]
 gb|EEE57578.1| hypothetical protein OsJ_07930 [Oryza sativa Japonica Group]
Length=425

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERL+A+++ D K
Sbjct  370  KNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSALEDADSK  422



>gb|EEC73787.1| hypothetical protein OsI_08473 [Oryza sativa Indica Group]
Length=425

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERL+A+++ D K
Sbjct  370  KNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSALEDADSK  422



>gb|EMT24778.1| CAAX prenyl protease 1-like protein [Aegilops tauschii]
Length=355

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERL+A+++ D K
Sbjct  300  KNLGYAPELRGALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSALEDLDSK  352



>gb|AFW63375.1| CAAX prenyl protease 1 [Zea mays]
Length=628

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K
Sbjct  573  KNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDSK  625



>emb|CDY07191.1| BnaCnng02060D [Brassica napus]
Length=424

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKT  423



>ref|XP_009111448.1| PREDICTED: CAAX prenyl protease 1 homolog [Brassica rapa]
Length=424

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKT  423



>emb|CDY48517.1| BnaA09g00060D [Brassica napus]
Length=424

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKT  423



>ref|NP_567212.1| CAAX prenyl protease 1 homolog [Arabidopsis thaliana]
 sp|Q8RX88.1|FACE1_ARATH RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=AtFACE-1; Short=FACE-1; 
AltName: Full=Prenyl protein-specific endoprotease 
1; AltName: Full=Zinc metalloproteinase Ste24 homolog; Short=AtSTE24 
[Arabidopsis thaliana]
 gb|AAL90896.1| AT4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AAP21163.1| At4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AEE82008.1| peptidase family M48 family protein [Arabidopsis thaliana]
Length=424

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKT  423



>ref|XP_002874990.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51249.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKT  423



>ref|XP_010422802.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKT  423



>ref|XP_010427521.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKT  423



>gb|AAL07084.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=424

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKT  423



>ref|NP_001131195.1| uncharacterized protein LOC100192503 [Zea mays]
 gb|ACF79503.1| unknown [Zea mays]
 gb|ACG28474.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K
Sbjct  370  KNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDSK  422



>ref|XP_002454476.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
 gb|EES07452.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
Length=425

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K
Sbjct  370  KNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDSK  422



>emb|CAL26913.1| CAAX peptidase [Hordeum vulgare subsp. vulgare]
Length=425

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERL+A+++ D K
Sbjct  370  KNLGYAPELRGALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLSALEDLDSK  422



>ref|XP_004953446.1| PREDICTED: CAAX prenyl protease 1 homolog [Setaria italica]
Length=425

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKLQEENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K
Sbjct  370  KNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDSK  422



>ref|XP_006396278.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
 gb|ESQ37731.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
Length=494

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  442  LGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKT  493



>gb|KFK30712.1| hypothetical protein AALP_AA6G017800 [Arabis alpina]
Length=424

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGLDKKT  423



>ref|XP_010456236.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP YS YHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLYSTYHYSHPPLVERLRAIDGEDKKT  423



>emb|CDX91888.1| BnaC03g31900D [Brassica napus]
Length=424

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  372  LGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKT  423



>emb|CDX74353.1| BnaA03g26940D [Brassica napus]
Length=424

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  372  LGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGQDKKT  423



>ref|XP_009134527.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Brassica 
rapa]
Length=424

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  372  LGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKT  423



>ref|XP_006286757.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
 gb|EOA19655.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
Length=424

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP YSAYHYSHPPLVERL AID  +KKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGDEKKT  423



>gb|AAK39514.1|AF353722_1 CaaX processing zinc-metallo endoprotease [Arabidopsis thaliana]
Length=424

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGYA  LR   VKLQEENLSAMNTDP +SAYHYSHPPLVERL AID  DKKT
Sbjct  371  KLGYAKDLRPALVKLQEENLSAMNTDPLHSAYHYSHPPLVERLRAIDGEDKKT  423



>ref|XP_008643874.1| PREDICTED: CAAX prenyl protease 1 isoform X2 [Zea mays]
Length=425

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKL EENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K
Sbjct  370  KNLGYAPQLRAALVKLHEENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDAK  422



>ref|XP_008643873.1| PREDICTED: CAAX prenyl protease 1 isoform X1 [Zea mays]
 gb|ACN31462.1| unknown [Zea mays]
 gb|AFW72802.1| CAAX prenyl protease 1 [Zea mays]
Length=437

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKL EENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K
Sbjct  382  KNLGYAPQLRAALVKLHEENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDAK  434



>ref|NP_001152504.1| CAAX prenyl protease 1 [Zea mays]
 gb|ACG47950.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKL EENLSAMNTDPWYSAYHYSHPPLVERL A+++ D K
Sbjct  370  KNLGYAPQLRAALVKLHEENLSAMNTDPWYSAYHYSHPPLVERLQALEDSDAK  422



>ref|XP_004308344.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
 ref|XP_011468984.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=425

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  +R   V+LQEENL+AMN DPWYSAYHY+HP LVERLAAI + DK+
Sbjct  370  KKLGYASSIRASLVRLQEENLAAMNIDPWYSAYHYTHPTLVERLAAIGKMDKE  422



>gb|AAB61028.1| A_IG002N01.21 gene product [Arabidopsis thaliana]
Length=316

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 44/63 (70%), Gaps = 10/63 (16%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQ----------EENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  328
            KLGYA  LR   VKLQ          EENLSAMNTDP YSAYHYSHPPLVERL AID  D
Sbjct  253  KLGYAKDLRPALVKLQVREDNNRTQTEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGED  312

Query  327  KKT  319
            KKT
Sbjct  313  KKT  315



>emb|CAN83040.1| hypothetical protein VITISV_034339 [Vitis vinifera]
Length=310

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  465  ALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            A  L+   VKLQEENLSAMNTDPWY AYHYS PPLVERLAA+ EPDKK
Sbjct  261  AAALQVRLVKLQEENLSAMNTDPWYLAYHYSQPPLVERLAALGEPDKK  308



>gb|ESA09906.1| hypothetical protein GLOINDRAFT_80760 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX73371.1| Ste24p [Rhizophagus irregularis DAOM 197198w]
Length=430

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  328
            KKLGY + LR G +K+Q +NL  +N DPWYSAYH+SHPPL ERL+AI++ D
Sbjct  380  KKLGYGVQLRSGLIKIQIKNLGNLNNDPWYSAYHFSHPPLPERLSAIEKID  430



>emb|CAB80941.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=459

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  435  LQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  420  LQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKT  458



>ref|XP_009134526.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Brassica 
rapa]
Length=455

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  435  LQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKT
Sbjct  416  LQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKT  454



>emb|CBJ27157.1| CaaX prenyl protease Ste24 [Ectocarpus siliculosus]
Length=474

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGY+  L+ G VKLQ ENL  MN DPWYSA+HYSHPPLVERL A+
Sbjct  420  KLGYSKGLQSGLVKLQLENLGNMNPDPWYSAFHYSHPPLVERLQAM  465



>gb|AIC32889.1| STE24 [Puccinellia tenuiflora]
Length=424

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  LR   VKLQEEN  AMNTDP YSAYH+SHPPLVE   A+++ D K
Sbjct  369  KNLGYAPELRGALVKLQEENSFAMNTDPGYSAYHFSHPPLVEGFFALEDLDTK  421



>ref|XP_002292916.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90112.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=425

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLG +  L+ G  K+  ENL AM  DPWYS YHYSHPPLVERL+A+ + DKK+
Sbjct  372  KLGMSQGLQSGLCKIHLENLGAMLPDPWYSTYHYSHPPLVERLSAMMKMDKKS  424



>emb|CCA18761.1| CAAX prenyl protease 1 putative [Albugo laibachii Nc14]
 emb|CCA25203.1| CAAX prenyl protease 1 putative [Albugo laibachii Nc14]
Length=493

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            LG+A  L+ G  K+  ENLS MN D WYSAYHY HPPL+ERL+AI + + K
Sbjct  441  LGHAKALQTGLTKISTENLSNMNPDKWYSAYHYDHPPLLERLSAIKQRESK  491



>ref|XP_002945691.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
 gb|EFJ52686.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
Length=460

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  471  GYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            G+   LR   +K++EEN  AM+ DPWYS+YHYSHPPLV+RL AID   KK
Sbjct  409  GHGTELRSALLKMEEENKGAMHVDPWYSSYHYSHPPLVDRLKAIDSAVKK  458



>emb|CCI48758.1| unnamed protein product [Albugo candida]
Length=493

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            LG+A  L+ G  K+  ENLS MN D WYSAYHY HPPL+ERL+AI + ++K
Sbjct  441  LGHAKALQTGLTKISIENLSNMNPDKWYSAYHYDHPPLLERLSAIKQRERK  491



>ref|XP_002181639.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46853.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=464

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LG +  L+ G  K+  ENL AM  DPWYS YHYSHPPLVERL A+   D+KT
Sbjct  412  LGMSQKLQSGLCKIHLENLGAMCPDPWYSTYHYSHPPLVERLGAMMALDRKT  463



>ref|XP_009042161.1| hypothetical protein AURANDRAFT_34438, partial [Aureococcus anophagefferens]
 gb|EGB03141.1| hypothetical protein AURANDRAFT_34438 [Aureococcus anophagefferens]
Length=262

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
              LGYA PL+ G VK+  ENL  ++ DP +S YH+SHPPLV+RL AI+E  KK
Sbjct  208  TNLGYAAPLQRGLVKITFENLGVLDPDPLFSTYHHSHPPLVQRLRAIEEGAKK  260



>ref|XP_002900396.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
 gb|EEY60189.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
Length=485

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LG+A+ L+ G  KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  433  LGHAVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  484



>ref|XP_003677696.1| hypothetical protein NCAS_0H00350 [Naumovozyma castellii CBS 
4309]
 emb|CCC71345.1| hypothetical protein NCAS_0H00350 [Naumovozyma castellii CBS 
4309]
Length=487

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGY   L    + LQ +NLS MN DPWYSAYHYSHP L ERL A++  ++K
Sbjct  432  KGLGYTEKLCRALIVLQIKNLSTMNVDPWYSAYHYSHPTLAERLTALEYVNEK  484



>gb|EWM26686.1| caax prenyl protease 1 [Nannochloropsis gaditana]
Length=530

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            LGY+  L+ G VKLQ ENLS  + DPWYS YHYSHPPL ERLAAI
Sbjct  474  LGYSEDLQRGLVKLQIENLSNPSPDPWYSFYHYSHPPLTERLAAI  518



>emb|CDH09260.1| probable CAAX prenyl protease 1 [Zygosaccharomyces bailii ISA1307]
Length=459

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGY   L    + LQ +NLS MN DPWYSAYHYSHP L ERL A+    +K
Sbjct  404  KALGYTQHLAQALINLQIKNLSTMNVDPWYSAYHYSHPTLAERLNALGYVSRK  456



>emb|CDF87226.1| BN860_01640g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=459

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGY   L    + LQ +NLS MN DPWYSAYHYSHP L ERL A+    +K
Sbjct  404  KALGYTQHLARALINLQIKNLSTMNVDPWYSAYHYSHPTLAERLNALGYVSRK  456



>emb|CDH15706.1| probable CAAX prenyl protease 1 [Zygosaccharomyces bailii ISA1307]
Length=459

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGY   L    + LQ +NLS MN DPWYSAYHYSHP L ERL A+    +K
Sbjct  404  KALGYTQHLARALINLQIKNLSTMNVDPWYSAYHYSHPTLAERLNALGYVSRK  456



>ref|XP_008902128.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
 gb|ETN12113.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
Length=484

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LG+ + L+ G  KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  432  LGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>gb|ETK91894.1| hypothetical protein L915_04651 [Phytophthora parasitica]
 gb|ETP21822.1| hypothetical protein F441_04764 [Phytophthora parasitica CJ01A1]
Length=484

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LG+ + L+ G  KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  432  LGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>gb|ETO80780.1| hypothetical protein F444_04815 [Phytophthora parasitica P1976]
Length=484

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LG+ + L+ G  KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  432  LGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>gb|ETL98448.1| hypothetical protein L917_04490 [Phytophthora parasitica]
 gb|ETM51609.1| hypothetical protein L914_04599 [Phytophthora parasitica]
 gb|ETP49699.1| hypothetical protein F442_04842 [Phytophthora parasitica P10297]
Length=484

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LG+ + L+ G  KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  432  LGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>ref|XP_009532258.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
 gb|EGZ11925.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
Length=468

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LG+ + L+ G  KL  ENLS MN D  YSAYHYSHPPLVERL AI    KKT
Sbjct  416  LGHDVALKSGLTKLAIENLSNMNPDELYSAYHYSHPPLVERLNAITARAKKT  467



>ref|XP_008611054.1| hypothetical protein SDRG_07015 [Saprolegnia diclina VS20]
 gb|EQC35304.1| hypothetical protein SDRG_07015 [Saprolegnia diclina VS20]
Length=453

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            +LG+A  L+ G  K+  ENL+ MN DP YSAYHYSHPPL+ERL AI     KT
Sbjct  400  QLGHADALQSGLTKISLENLANMNPDPMYSAYHYSHPPLLERLCAIGITKHKT  452



>dbj|BAO41720.1| CAAX prenyl protease 1 [Kluyveromyces marxianus DMKU3-1042]
Length=455

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K+LGYA  L    + LQ +NLS MN DP YS+YHYSHP L ERL AI+  ++K
Sbjct  400  KELGYANHLARALINLQIKNLSTMNVDPLYSSYHYSHPTLAERLIAIEYKNEK  452



>dbj|BAP73165.1| CAAX prenyl protease 1 [Kluyveromyces marxianus]
Length=455

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K+LGYA  L    + LQ +NLS MN DP YS+YHYSHP L ERL AI+  ++K
Sbjct  400  KELGYANHLARALINLQIKNLSTMNVDPLYSSYHYSHPTLAERLIAIEYKNEK  452



>pdb|4IL3|A Chain A, Crystal Structure Of S. Mikatae Ste24p
 pdb|4IL3|B Chain B, Crystal Structure Of S. Mikatae Ste24p
Length=461

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|EDN63433.1| zinc metalloprotease [Saccharomyces cerevisiae YJM789]
 gb|AJR59292.1| Ste24p [Saccharomyces cerevisiae YJM1133]
 gb|AJR64495.1| Ste24p [Saccharomyces cerevisiae YJM541]
 gb|AJR64762.1| Ste24p [Saccharomyces cerevisiae YJM554]
Length=453

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>ref|XP_004348317.1| CAAX prenyl protease 1 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93739.1| CAAX prenyl protease 1 [Capsaspora owczarzaki ATCC 30864]
Length=519

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLG+   LR   VKLQ+ NLS M+ DP YS YHYSHPPLVERL AI
Sbjct  469  KLGHGGHLRTALVKLQKNNLSDMDPDPLYSMYHYSHPPLVERLNAI  514



>gb|AJR62890.1| Ste24p [Saccharomyces cerevisiae YJM450]
 gb|AJR71267.1| Ste24p [Saccharomyces cerevisiae YJM1444]
Length=453

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|AJR63219.1| Ste24p [Saccharomyces cerevisiae YJM451]
 gb|AJR66725.1| Ste24p [Saccharomyces cerevisiae YJM1208]
 gb|AJR69612.1| Ste24p [Saccharomyces cerevisiae YJM1419]
Length=453

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|AJR59949.1| Ste24p [Saccharomyces cerevisiae YJM193]
Length=453

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|EWG95205.1| Ste24p [Saccharomyces cerevisiae R103]
Length=453

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>ref|XP_011104176.1| ste24p [Saccharomyces arboricola H-6]
 gb|EJS43087.1| ste24p [Saccharomyces arboricola H-6]
Length=453

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCKALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|AJR68004.1| Ste24p [Saccharomyces cerevisiae YJM1250]
 gb|AJR68974.1| Ste24p [Saccharomyces cerevisiae YJM1417]
 gb|AJR69944.1| Ste24p [Saccharomyces cerevisiae YJM1433]
 gb|AJR73220.1| Ste24p [Saccharomyces cerevisiae YJM1478]
Length=453

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|AJR60934.1| Ste24p [Saccharomyces cerevisiae YJM248]
 gb|AJR68333.1| Ste24p [Saccharomyces cerevisiae YJM1252]
 gb|AJR72235.1| Ste24p [Saccharomyces cerevisiae YJM1460]
 gb|AJR75507.1| Ste24p [Saccharomyces cerevisiae YJM1592]
Length=453

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|AJR67380.1| Ste24p [Saccharomyces cerevisiae YJM1244]
 gb|AJR68650.1| Ste24p [Saccharomyces cerevisiae YJM1415]
Length=453

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|AJR63874.1| Ste24p [Saccharomyces cerevisiae YJM456]
 gb|AJR70937.1| Ste24p [Saccharomyces cerevisiae YJM1443]
 gb|AJR74185.1| Ste24p [Saccharomyces cerevisiae YJM1527]
Length=453

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>emb|CAY80831.1| Ste24p [Saccharomyces cerevisiae EC1118]
 gb|AJR61257.1| Ste24p [Saccharomyces cerevisiae YJM270]
Length=453

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|EDZ71132.1| YJR117Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|EEU08090.1| Ste24p [Saccharomyces cerevisiae JAY291]
 gb|EGA86133.1| Ste24p [Saccharomyces cerevisiae VL3]
 dbj|GAA24463.1| K7_Ste24p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EWG85204.1| Ste24p [Saccharomyces cerevisiae R008]
 gb|EWG88038.1| Ste24p [Saccharomyces cerevisiae P301]
 gb|EWH17657.1| Ste24p [Saccharomyces cerevisiae P283]
 gb|AHY79097.1| Ste24p [Saccharomyces cerevisiae YJM993]
 gb|AJP39798.1| Ste24p [Saccharomyces cerevisiae YJM1078]
 gb|AJR54062.1| Ste24p [Saccharomyces cerevisiae YJM681]
 gb|AJR54392.1| Ste24p [Saccharomyces cerevisiae YJM682]
 gb|AJR54727.1| Ste24p [Saccharomyces cerevisiae YJM683]
 gb|AJR55052.1| Ste24p [Saccharomyces cerevisiae YJM689]
 gb|AJR55361.1| Ste24p [Saccharomyces cerevisiae YJM693]
 gb|AJR55690.1| Ste24p [Saccharomyces cerevisiae YJM969]
 gb|AJR56020.1| Ste24p [Saccharomyces cerevisiae YJM972]
 gb|AJR56347.1| Ste24p [Saccharomyces cerevisiae YJM975]
 gb|AJR56674.1| Ste24p [Saccharomyces cerevisiae YJM978]
 gb|AJR57000.1| Ste24p [Saccharomyces cerevisiae YJM981]
 gb|AJR57327.1| Ste24p [Saccharomyces cerevisiae YJM984]
 gb|AJR57658.1| Ste24p [Saccharomyces cerevisiae YJM987]
 gb|AJR57986.1| Ste24p [Saccharomyces cerevisiae YJM990]
 gb|AJR58314.1| Ste24p [Saccharomyces cerevisiae YJM996]
 gb|AJR58638.1| Ste24p [Saccharomyces cerevisiae YJM1083]
 gb|AJR58966.1| Ste24p [Saccharomyces cerevisiae YJM1129]
 gb|AJR59618.1| Ste24p [Saccharomyces cerevisiae YJM189]
 gb|AJR60272.1| Ste24p [Saccharomyces cerevisiae YJM195]
 gb|AJR61908.1| Ste24p [Saccharomyces cerevisiae YJM320]
 gb|AJR62236.1| Ste24p [Saccharomyces cerevisiae YJM326]
 gb|AJR62569.1| Ste24p [Saccharomyces cerevisiae YJM428]
 gb|AJR63546.1| Ste24p [Saccharomyces cerevisiae YJM453]
 gb|AJR65090.1| Ste24p [Saccharomyces cerevisiae YJM555]
 gb|AJR65420.1| Ste24p [Saccharomyces cerevisiae YJM627]
 gb|AJR65749.1| Ste24p [Saccharomyces cerevisiae YJM1190]
 gb|AJR66077.1| Ste24p [Saccharomyces cerevisiae YJM1199]
 gb|AJR66400.1| Ste24p [Saccharomyces cerevisiae YJM1202]
 gb|AJR67053.1| Ste24p [Saccharomyces cerevisiae YJM1242]
 gb|AJR67676.1| Ste24p [Saccharomyces cerevisiae YJM1248]
 gb|AJR69283.1| Ste24p [Saccharomyces cerevisiae YJM1418]
 gb|AJR70278.1| Ste24p [Saccharomyces cerevisiae YJM1434]
 gb|AJR70606.1| Ste24p [Saccharomyces cerevisiae YJM1439]
 gb|AJR72563.1| Ste24p [Saccharomyces cerevisiae YJM1463]
 gb|AJR72890.1| Ste24p [Saccharomyces cerevisiae YJM1477]
 gb|AJR73551.1| Ste24p [Saccharomyces cerevisiae YJM1479]
 gb|AJR73867.1| Ste24p [Saccharomyces cerevisiae YJM1526]
 gb|AJR74512.1| Ste24p [Saccharomyces cerevisiae YJM1549]
 gb|AJR74842.1| Ste24p [Saccharomyces cerevisiae YJM1573]
 gb|AJR75177.1| Ste24p [Saccharomyces cerevisiae YJM1574]
 gb|AJR75836.1| Ste24p [Saccharomyces cerevisiae YJM1615]
Length=453

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|AJR60606.1| Ste24p [Saccharomyces cerevisiae YJM244]
Length=453

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|EDV12854.1| CAAX prenyl protease 1 [Saccharomyces cerevisiae RM11-1a]
Length=453

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|EHN06284.1| Ste24p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=453

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|AJR61585.1| Ste24p [Saccharomyces cerevisiae YJM271]
Length=453

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|AJR71904.1| Ste24p [Saccharomyces cerevisiae YJM1450]
Length=453

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>ref|NP_012651.1| Ste24p [Saccharomyces cerevisiae S288c]
 sp|P47154.1|STE24_YEAST RecName: Full=CAAX prenyl protease 1; AltName: Full=A-factor-converting 
enzyme; AltName: Full=Prenyl protein-specific endoprotease 
1; Short=PPSEP 1 [Saccharomyces cerevisiae S288c]
 emb|CAA89647.1| STE24 [Saccharomyces cerevisiae]
 gb|AAB38271.1| zinc metallo-protease [Saccharomyces cerevisiae]
 tpg|DAA08902.1| TPA: Ste24p [Saccharomyces cerevisiae S288c]
 gb|EIW09642.1| Ste24p [Saccharomyces cerevisiae CEN.PK113-7D]
Length=453

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|EJT41596.1| STE24-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=453

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>gb|EHN01607.1| Ste24p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=453

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEK  450



>ref|XP_003880033.1| putative peptidase family M48 domain-containing protein [Neospora 
caninum Liverpool]
 emb|CBZ49998.1| putative peptidase family M48 domain-containing protein [Neospora 
caninum Liverpool]
Length=429

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            +LGY+ PL+ G V +  EN S ++ DPW+S +HYSHPPL+ERL AI+   +K
Sbjct  373  ELGYSEPLKQGLVAIHAENKSCLDPDPWFSFWHYSHPPLLERLRAIEAIQEK  424



>ref|XP_453545.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAH00641.1| KLLA0D10846p [Kluyveromyces lactis]
Length=456

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K+LGYA  L    + LQ +NLS MN DP YS+YHYSHP L ERL AI+  ++K
Sbjct  401  KELGYAPHLARALINLQIKNLSTMNVDPLYSSYHYSHPTLAERLIAIEYKNEK  453



>gb|ETL45293.1| hypothetical protein L916_04606 [Phytophthora parasitica]
Length=484

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LG+ + L+ G  KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  432  LGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>gb|ETI52023.1| hypothetical protein F443_04763 [Phytophthora parasitica P1569]
Length=484

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            LG+ + L+ G  KL  ENLS MN D  YSAYHYSHPPLVERL AI    KK+
Sbjct  432  LGHDVALKSGLTKLAIENLSNMNPDVLYSAYHYSHPPLVERLNAITARAKKS  483



>ref|XP_447605.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG60542.1| unnamed protein product [Candida glabrata]
Length=460

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGY   L    + LQ +NLS M+ DP YS+YHYSHP L ERL AID  ++K
Sbjct  405  KALGYTQNLGRALINLQIKNLSTMDVDPLYSSYHYSHPTLAERLTAIDFVNEK  457



>gb|EME39248.1| hypothetical protein DOTSEDRAFT_75093 [Dothistroma septosporum 
NZE10]
Length=462

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGYA  L    +KLQ +NLS+M+ DP YS+YHYSHP L ERL A+    +K
Sbjct  385  KKLGYAKDLAASLIKLQIQNLSSMDADPLYSSYHYSHPILTERLKAVGWTSEK  437



>gb|KDO33073.1| hypothetical protein SPRG_01888 [Saprolegnia parasitica CBS 223.65]
Length=453

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            +LG+A  L+ G  K+  ENL+ MN DP YSAYHYSHPPL+ERL+AI     K
Sbjct  400  QLGHADALQSGLTKISLENLANMNPDPMYSAYHYSHPPLLERLSAIGAVKHK  451



>emb|CCK69867.1| hypothetical protein KNAG_0D01150 [Kazachstania naganishii CBS 
8797]
Length=460

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGYA  L    + LQ +NLS M+ D WYS+YH+SHP L ERL A+D   +K
Sbjct  405  KTLGYAKNLCRALIDLQIKNLSTMSVDTWYSSYHFSHPTLAERLTALDYVSEK  457



>ref|XP_003622455.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=93

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGY   LR   VK Q ENL   N DPWY AY    PP V RL A+DE DKK 
Sbjct  40   KLGYKSALRSVLVKKQMENLMEFNADPWYYAYRVIQPPAVLRLTAMDELDKKA  92



>ref|XP_002553545.1| KLTH0E01298p [Lachancea thermotolerans]
 emb|CAR23108.1| KLTH0E01298p [Lachancea thermotolerans CBS 6340]
Length=455

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  400  KKLGYTKDLCHALINLQVKNLSTMNVDPLYSSYHYSHPTLPERLEALDYATEK  452



>gb|KFG61038.1| CAAX metallo endopeptidase [Toxoplasma gondii RUB]
Length=204

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            +LGY+  L+ G + +  EN + ++ DPW+S +HYSHPPL+ERL AI+  ++K
Sbjct  148  ELGYSESLKQGLIAIHTENKACLDPDPWFSFWHYSHPPLLERLRAIEAIEEK  199



>gb|ESS30154.1| CAAX metallo endopeptidase, partial [Toxoplasma gondii VEG]
Length=200

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            +LGY+  L+ G + +  EN + ++ DPW+S +HYSHPPL+ERL AI+  ++K
Sbjct  144  ELGYSESLKQGLIAIHTENKACLDPDPWFSFWHYSHPPLLERLRAIEAIEEK  195



>emb|CDO93753.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=455

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K+LG+A  L    + LQ +NLS MN DP YS+YHYSHP L ERL AI+  ++K
Sbjct  400  KELGHASHLAKALINLQIKNLSTMNVDPLYSSYHYSHPTLAERLIAIEYKNEK  452



>ref|XP_008861314.1| hypothetical protein H310_00342 [Aphanomyces invadans]
 gb|ETW09903.1| hypothetical protein H310_00342 [Aphanomyces invadans]
Length=472

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            LGY  PL+    K+  ENL+ MN D  YSAYHYSHPPLVERL AI
Sbjct  417  LGYGDPLQSALTKISLENLTNMNPDALYSAYHYSHPPLVERLGAI  461



>ref|XP_003685564.1| hypothetical protein TPHA_0E00340 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE63130.1| hypothetical protein TPHA_0E00340 [Tetrapisispora phaffii CBS 
4417]
Length=457

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGY+  L    + LQ +NLS MN DP YS+YHYSHP L ERL A+D   +K
Sbjct  402  KDLGYSKHLCKALISLQVKNLSTMNVDPLYSSYHYSHPTLAERLNALDYVSEK  454



>ref|XP_009822213.1| hypothetical protein H257_00958 [Aphanomyces astaci]
 gb|ETV87350.1| hypothetical protein H257_00958 [Aphanomyces astaci]
Length=479

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  334
            LG+  PL+    K+  ENL+ MN D  YSAYHYSHPPLVERLAAI +
Sbjct  424  LGHGEPLQSALTKISLENLANMNPDTLYSAYHYSHPPLVERLAAISK  470



>ref|XP_002174544.2| CAA Xprenyl protease [Schizosaccharomyces japonicus yFS275]
 gb|EEB08251.2| CAA Xprenyl protease [Schizosaccharomyces japonicus yFS275]
Length=446

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            K+LGY   L  G ++L E+N+S ++ D W+SAYH++HPPL+ERL AI    + T
Sbjct  389  KRLGYGDALAEGLIRLHEDNMSPLDFDRWFSAYHHNHPPLLERLEAIGYGAQTT  442



>gb|AJR64199.1| Ste24p [Saccharomyces cerevisiae YJM470]
Length=453

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLGY   L    + LQ +NLS MN DP YS+Y+YSHP L ERL A+D   +K
Sbjct  398  KKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYYYSHPTLAERLTALDYVSEK  450



>gb|EPB83925.1| hypothetical protein HMPREF1544_09315 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=442

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGYA  LR   +KL  +NL   N DPWYSA+++SHP LVERL A+
Sbjct  379  KLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNHSHPSLVERLKAL  424



>dbj|GAN04268.1| metallopeptidase [Mucor ambiguus]
Length=442

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGYA  LR   +KL  +NL   N DPWYSA+++SHP LVERL A+
Sbjct  379  KLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNHSHPSLVERLKAL  424



>emb|CEG66514.1| hypothetical protein RMATCC62417_03079 [Rhizopus microsporus]
Length=440

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGYA  LR   +KL  +NL   N DPWYSA+++SHP LVERL A+
Sbjct  377  KLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNHSHPSLVERLNAL  422



>emb|CEP19164.1| hypothetical protein [Parasitella parasitica]
Length=442

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGYA  LR   +KL  +NL   N DPWYSA+++SHP LVERL A+
Sbjct  379  KLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNHSHPSLVERLKAL  424



>emb|CEJ00851.1| hypothetical protein RMCBS344292_14897 [Rhizopus microsporus]
Length=440

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGYA  LR   +KL  +NL   N DPWYSA+++SHP LVERL A+
Sbjct  377  KLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNHSHPSLVERLNAL  422



>ref|XP_005100140.1| PREDICTED: CAAX prenyl protease 1 homolog [Aplysia californica]
Length=490

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI-DEPDKKT  319
            +G++  LR   +KL E+NLS   +D  YSA+H+SHPPL++RL A+ D+PDKKT
Sbjct  437  MGWSDTLRSALIKLNEDNLSFPLSDWLYSAWHFSHPPLLDRLRALHDQPDKKT  489



>ref|XP_002496515.1| ZYRO0D01892p [Zygosaccharomyces rouxii]
 emb|CAR27582.1| ZYRO0D01892p [Zygosaccharomyces rouxii]
Length=497

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            K LGY   L    + LQ +NLS MN DP YSAYHYSHP L ERL A+
Sbjct  442  KGLGYTQYLAQALINLQIKNLSTMNVDPLYSAYHYSHPTLAERLTAL  488



>dbj|GAA95272.1| hypothetical protein E5Q_01928 [Mixia osmundae IAM 14324]
 gb|KEI41234.1| hypothetical protein L969DRAFT_45748 [Mixia osmundae IAM 14324]
Length=492

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            K LGYA  L+ G ++L  +N + +  D  YSA+H+SHP L+ERLAA+++ DKK+
Sbjct  438  KNLGYAQQLKVGLIRLMSKNSAVLTYDALYSAFHHSHPTLIERLAALEQIDKKS  491



>emb|CDS07769.1| hypothetical protein LRAMOSA01718 [Absidia idahoensis var. thermophila]
Length=447

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGYA  LR   +KL  +NL   N DPWYSA++ SHP L ERLAA+
Sbjct  382  KLGYAATLRSALIKLSVKNLGGFNVDPWYSAWNRSHPSLTERLAAL  427



>ref|XP_008886307.1| CAAX metallo endopeptidase [Hammondia hammondi]
 gb|KEP63193.1| CAAX metallo endopeptidase [Hammondia hammondi]
Length=432

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            +LGY+  L+ G + +  EN + ++ DPW+S +HYSHPPL+ERL AI+  ++K
Sbjct  376  ELGYSESLKQGLIAIHTENKACLDPDPWFSFWHYSHPPLLERLRAIEAIEEK  427



>ref|XP_002369947.1| peptidase family M48 domain-containing protein [Toxoplasma gondii 
ME49]
 gb|EPR58595.1| CAAX metallo endopeptidase [Toxoplasma gondii GT1]
 gb|EPT31952.1| CAAX metallo endopeptidase [Toxoplasma gondii ME49]
Length=432

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            +LGY+  L+ G + +  EN + ++ DPW+S +HYSHPPL+ERL AI+  ++K
Sbjct  376  ELGYSESLKQGLIAIHTENKACLDPDPWFSFWHYSHPPLLERLRAIEAIEEK  427



>gb|EPZ36837.1| Peptidase M48 domain-containing protein [Rozella allomycis CSF55]
Length=276

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K GY+L L    +K+  ENLS +N D WY  YHY HP L ER+ AI   D K
Sbjct  223  KHGYSLELVNALIKIHSENLSNLNPDRWYVTYHYCHPTLFERIEAITSVDIK  274



>emb|CDH48818.1| prenyl protease [Lichtheimia corymbifera JMRC:FSU:9682]
Length=447

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGYA  LR   +KL  +NL   N DPWYSA++ SHP L ERL+A+
Sbjct  382  KLGYAATLRSALIKLSVKNLGGFNVDPWYSAWNRSHPSLTERLSAL  427



>emb|CDJ60176.1| peptidase family M48 domain-containing protein, putative [Eimeria 
maxima]
Length=489

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            +L Y   L+     +  EN S ++ DPWYS +HYSHPPL+ERL+AID    KT
Sbjct  389  ELNYGEQLKEALCTIHTENKSTLDPDPWYSWWHYSHPPLLERLSAIDAILTKT  441



>gb|KGO76072.1| Peptidase M48 [Penicillium italicum]
Length=456

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            +KLGY+  L    +KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  384  QKLGYSDKLASSLLKLQIQNLSTMDADPIYASYHYSHPILTERLAAL  430



>gb|KGO40189.1| Peptidase M48 [Penicillium expansum]
 gb|KGO53048.1| Peptidase M48 [Penicillium expansum]
 gb|KGO63477.1| Peptidase M48 [Penicillium expansum]
Length=456

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            +KLGY+  L    +KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  384  QKLGYSDKLASSLLKLQIQNLSTMDADPIYASYHYSHPILTERLAAL  430



>gb|KEH18809.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=436

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLGY   LR   VK Q ENL   N DPWY AY    PP V RL A+DE DKK
Sbjct  383  KLGYKSALRSVLVKKQMENLMEFNADPWYYAYRVIQPPAVLRLTAMDELDKK  434



>gb|EKV19760.1| CaaX prenyl protease Ste24 [Penicillium digitatum PHI26]
 gb|EKV20861.1| CaaX prenyl protease Ste24 [Penicillium digitatum Pd1]
Length=456

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGY+  L    +KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  385  KLGYSDKLASSLLKLQIQNLSTMDADPIYASYHYSHPILTERLAAL  430



>ref|XP_009497192.1| hypothetical protein H696_05044 [Fonticula alba]
 gb|KCV68760.1| hypothetical protein H696_05044 [Fonticula alba]
Length=451

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            LGY   LR G +K+Q EN+S M  D  YS Y+Y+HPP++ER++AID+  +K
Sbjct  399  LGYGKVLRSGLLKMQLENMSQMLPDSLYSLYNYTHPPMLERISAIDKLLQK  449



>gb|KIW01377.1| hypothetical protein PV09_07145 [Verruconis gallopava]
Length=462

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLGY   L    +KLQ +NLS+M+ D +YS+YHYSHP L ERL AI    +K
Sbjct  389  KLGYQAELAQALIKLQIKNLSSMDADFYYSSYHYSHPILTERLKAIQWTGEK  440



>ref|XP_005651455.1| hypothetical protein COCSUDRAFT_27312 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26911.1| hypothetical protein COCSUDRAFT_27312 [Coccomyxa subellipsoidea 
C-169]
Length=437

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
             LG A  L+     L  +N SA+N DP YSAYH+SHPPLVERL A+D   KK
Sbjct  384  SLGKAEELKQALKILDAKNRSAVNVDPLYSAYHHSHPPLVERLTAVDAATKK  435



>ref|XP_003850777.1| CAAX prenyl protease 1 [Zymoseptoria tritici IPO323]
 gb|EGP85753.1| hypothetical protein MYCGRDRAFT_74210 [Zymoseptoria tritici IPO323]
Length=457

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLGYA  L    +KLQ +NLS+M+ D  YS+YHYSHP L ERL A+    +K
Sbjct  388  KLGYAKELAASLIKLQIQNLSSMDADHMYSSYHYSHPILTERLKAVGWTSEK  439



>gb|EJK43644.1| hypothetical protein THAOC_37888 [Thalassiosira oceanica]
Length=477

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLG+   L+ G  K+  ENL A++ D  YS YHYSHPPL ERL+A+   D K
Sbjct  424  KLGFGQQLQSGLCKINIENLGALSPDRLYSTYHYSHPPLTERLSAMMALDSK  475



>gb|EMF09871.1| CaaX prenyl protease [Sphaerulina musiva SO2202]
Length=465

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            LGYA  L    +KLQ++NLS+M+ D  YSA+HYSHP L ERL AI
Sbjct  387  LGYASELAAALIKLQKQNLSSMDADWMYSAFHYSHPILTERLKAI  431



>ref|XP_009152612.1| STE24 endopeptidase [Exophiala dermatitidis NIH/UT8656]
 gb|EHY52151.1| STE24 endopeptidase [Exophiala dermatitidis NIH/UT8656]
Length=471

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            + LGY   L    +KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  392  RNLGYQKELAKSLIKLQVQNLSTMDADPLYASYHYSHPILAERLAAL  438



>gb|KFH71808.1| hypothetical protein MVEG_02102 [Mortierella verticillata NRRL 
6337]
Length=451

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEP  331
            + LGYA  L  G +KLQ +NL  MN D  +S YH SHP LVERL AI++P
Sbjct  393  RDLGYAGSLASGLIKLQLKNLGTMNPDWLHSMYHRSHPELVERLNAINQP  442



>ref|XP_007780353.1| STE24 endopeptidase [Coniosporium apollinis CBS 100218]
 gb|EON65036.1| STE24 endopeptidase [Coniosporium apollinis CBS 100218]
Length=457

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KKLGY   L     KLQ +NLS+M+ D  YS+YHYSHP L ERL AI
Sbjct  386  KKLGYTAELASALTKLQIQNLSSMDADWMYSSYHYSHPILTERLKAI  432



>emb|CDI76342.1| peptidase family M48 domain-containing protein, putative [Eimeria 
acervulina]
Length=472

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            +L Y   L+     +  EN S ++ DPWYS +HYSHPPL+ERL+AID   KK
Sbjct  375  ELNYGEQLKEALCTIHTENKSTLDPDPWYSWWHYSHPPLLERLSAIDAILKK  426



>ref|XP_001639206.1| predicted protein [Nematostella vectensis]
 gb|EDO47143.1| predicted protein [Nematostella vectensis]
Length=563

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            K+LG+A  LR   +KL ++NL     D  YSAYHYSHPPL+ERL A+
Sbjct  512  KQLGFAPHLRSALIKLHQDNLGFPIADKLYSAYHYSHPPLLERLRAL  558



>ref|XP_003669587.1| hypothetical protein NDAI_0D00300 [Naumovozyma dairenensis CBS 
421]
 emb|CCD24344.1| hypothetical protein NDAI_0D00300 [Naumovozyma dairenensis CBS 
421]
Length=459

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LGY   L    ++LQ +NLS MN D  YS+YHYSHP L ERL A+    +K
Sbjct  404  KALGYTQHLCRALIELQIKNLSTMNVDTLYSSYHYSHPTLAERLTALGYVSEK  456



>gb|ETO31171.1| hypothetical protein RFI_05949 [Reticulomyxa filosa]
Length=179

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDK  325
            LGY   +  G +K+ +EN + +N D  +SAYHYSHPPL++RL AI +  K
Sbjct  129  LGYQDHIYHGLIKIHQENKATLNPDWLFSAYHYSHPPLIQRLQAIRDAKK  178



>emb|CDM27808.1| CAAX prenyl protease 1 [Penicillium roqueforti FM164]
Length=456

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            + LGY+  L    +KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  384  QNLGYSDKLASSLLKLQIQNLSTMDADPIYASYHYSHPILTERLAAL  430



>ref|XP_002565802.1| Pc22g18990 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP99187.1| Pc22g18990 [Penicillium rubens Wisconsin 54-1255]
Length=456

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            + LGY+  L    +KLQ +NLS M+ DP Y++YHYSHP L ERLAA+
Sbjct  384  QNLGYSDKLASSLLKLQIQNLSTMDADPIYASYHYSHPILTERLAAL  430



>emb|CDJ68920.1| peptidase family M48 domain-containing protein, putative [Eimeria 
necatrix]
Length=474

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  337
            +L Y   L+     +  EN S ++ DPWYS +HYSHPPL+ERLAAID
Sbjct  375  RLHYGEQLKEALCTVHTENKSTLDPDPWYSWWHYSHPPLLERLAAID  421



>emb|CCG83629.1| CaaX prenyl protease Ste24 [Taphrina deformans PYCC 5710]
Length=448

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KL Y   L    +KLQ  NLS M+ D W+SAYH+SHP L ERL AI    KK+
Sbjct  395  KLNYKDELAEALIKLQVSNLSTMDPDTWFSAYHHSHPVLTERLRAIGFKGKKS  447



>emb|CDJ42877.1| peptidase family M48 domain-containing protein, putative [Eimeria 
tenella]
Length=474

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  337
            +L Y   L+     +  EN S ++ DPWYS +HYSHPPL+ERLAAID
Sbjct  375  QLHYGEQLKEALCTVHTENKSTLDPDPWYSWWHYSHPPLLERLAAID  421



>gb|EZF29046.1| hypothetical protein H101_07272 [Trichophyton interdigitale H6]
Length=140

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGY+  L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  68   KLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  113



>gb|KHJ35024.1| putative peptidase family m48 [Erysiphe necator]
Length=456

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (62%), Gaps = 11/65 (17%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI-----------DE  334
            K+LGY+  L    +KLQ +NLS M+ D  Y++YH+SHP L ERL+AI           DE
Sbjct  384  KELGYSKDLAQSLIKLQIQNLSTMDADWIYASYHFSHPILTERLSAIGWYSEQKIVGNDE  443

Query  333  PDKKT  319
             D+KT
Sbjct  444  KDEKT  448



>emb|CDJ47135.1| peptidase family M48 domain-containing protein, putative [Eimeria 
brunetti]
Length=458

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            +L Y   L+     +  EN S ++ DPWYS +HYSHPPL+ERL+AID   KK
Sbjct  360  ELDYGEQLKEALCTIHTENKSTLDPDPWYSWWHYSHPPLLERLSAIDAILKK  411



>dbj|GAM83450.1| hypothetical protein ANO11243_014380 [fungal sp. No.11243]
Length=446

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGYA  L    +KLQ +NLS+M+ D  +S+YHYSHP L ERL AI
Sbjct  375  KLGYANELASSLIKLQIQNLSSMDADWMFSSYHYSHPILTERLKAI  420



>gb|KEQ83545.1| CAAX prenyl protease 1 [Aureobasidium pullulans EXF-150]
Length=458

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLGY+  L    +KLQ +NLS+M+ D  YS++HYSHP L ERL A+    +K
Sbjct  385  KLGYSAELASSLIKLQIQNLSSMDADWMYSSFHYSHPILTERLKAVGWTSEK  436



>gb|KEQ71244.1| hypothetical protein M436DRAFT_83534 [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=458

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLGY+  L    +KLQ +NLS+M+ D  YS++HYSHP L ERL A+    +K
Sbjct  385  KLGYSAELASSLIKLQIQNLSSMDADWMYSSFHYSHPILTERLKAVGWTSEK  436



>gb|KEQ63120.1| hypothetical protein M437DRAFT_47585 [Aureobasidium melanogenum 
CBS 110374]
Length=458

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLGY+  L    +KLQ +NLS+M+ D  YS++HYSHP L ERL A+    +K
Sbjct  385  KLGYSAELASSLIKLQIQNLSSMDADWMYSSFHYSHPILTERLKAVGWTSEK  436



>gb|KEQ90314.1| hypothetical protein AUEXF2481DRAFT_9558 [Aureobasidium subglaciale 
EXF-2481]
Length=459

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLGY+  L    +KLQ +NLS+M+ D  YS++HYSHP L ERL A+    +K
Sbjct  385  KLGYSAELASSLIKLQIQNLSSMDADWMYSSFHYSHPILTERLKAVGWTSEK  436



>ref|XP_007584901.1| putative prenyl protease protein [Neofusicoccum parvum UCRNP2]
 gb|EOD47581.1| putative prenyl protease protein [Neofusicoccum parvum UCRNP2]
Length=456

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            K GYA  L    +KLQ +NLSAM+ D  YS++HYSHP L ERL AI    +K+
Sbjct  387  KQGYAQELAGSLIKLQIQNLSAMDADWMYSSFHYSHPILTERLRAIGYKGEKS  439



>ref|XP_002427421.1| caax prenyl protease ste24, putative [Pediculus humanus corporis]
 gb|EEB14683.1| caax prenyl protease ste24, putative [Pediculus humanus corporis]
Length=465

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  328
            KKLG++  L+   +KL  +NL     DPWYS +H+SHPPL+ERL A+ + D
Sbjct  415  KKLGHSNALKNALIKLNSDNLGFPIYDPWYSKWHHSHPPLLERLQALSKED  465



>ref|XP_003954896.1| hypothetical protein KAFR_0A03260 [Kazachstania africana CBS 
2517]
 emb|CCF55761.1| hypothetical protein KAFR_0A03260 [Kazachstania africana CBS 
2517]
Length=456

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LG+   L    + LQ +NLS MN D  YS+YHYSHP L ERL A++   +K
Sbjct  401  KMLGFENDLCHALINLQIKNLSTMNVDSLYSSYHYSHPTLAERLTALNYVSEK  453



>ref|XP_009028164.1| hypothetical protein HELRODRAFT_193946 [Helobdella robusta]
 gb|ESN93745.1| hypothetical protein HELRODRAFT_193946 [Helobdella robusta]
Length=1187

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGY   ++   VKL  +NLS   TD  YS +HYSHPPL+ERL+A+   D  T
Sbjct  357  KLGYCRYIKSALVKLNLDNLSFPITDKLYSTFHYSHPPLLERLSAMGGADTDT  409



>gb|EIE81350.1| hypothetical protein RO3G_06055 [Rhizopus delemar RA 99-880]
Length=442

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGYA  LR   +KL  +NL   N DP YSA+++SHP LVERL A+
Sbjct  379  KLGYASTLRSALIKLSIKNLGGFNVDPLYSAWNHSHPSLVERLNAL  424



>ref|XP_001939034.1| CaaX prenyl protease [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU41753.1| CaaX prenyl protease [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=461

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EPDKKT  319
            KLGYA  L    +KLQ +NLS+M+ D +YS++H+SHP L ERL A+    DKK 
Sbjct  389  KLGYARELGSSLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMKWTGDKKV  442



>ref|XP_008031232.1| hypothetical protein SETTUDRAFT_35606 [Setosphaeria turcica Et28A]
 gb|EOA80677.1| hypothetical protein SETTUDRAFT_35606 [Setosphaeria turcica Et28A]
Length=461

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EPDKKT  319
            KLGYA  L    +KLQ +NLS+M+ D +YS++H+SHP L ERL A++   DKK 
Sbjct  389  KLGYARELGASLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMNWVGDKKV  442



>emb|CDK25391.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=446

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  471  GYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  337
            GYA  L+   + L +ENLS+++TD  +S+YH+SHP L ERL AID
Sbjct  393  GYATELKTALITLHKENLSSLSTDWLFSSYHHSHPHLTERLEAID  437



>ref|XP_003300873.1| hypothetical protein PTT_12236 [Pyrenophora teres f. teres 0-1]
 gb|EFQ91005.1| hypothetical protein PTT_12236 [Pyrenophora teres f. teres 0-1]
Length=484

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EPDKKT  319
            KLGYA  L    +KLQ +NLS+M+ D +YS++H+SHP L ERL A+    DKK 
Sbjct  412  KLGYARELGSSLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMKWTGDKKV  465



>gb|KIW82886.1| hypothetical protein Z517_02129 [Fonsecaea pedrosoi CBS 271.37]
Length=472

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            KLGY   L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+     K+
Sbjct  393  KLGYEKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKSSKS  445



>gb|EFZ21267.1| hypothetical protein SINV_07351 [Solenopsis invicta]
Length=436

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  334
            KLG+  PL+   +KLQ++NL     D WYS +++SHPP++ERL AID+
Sbjct  387  KLGHGEPLKAALLKLQKDNLGYPLYDKWYSCWNHSHPPIIERLEAIDK  434



>ref|XP_001623710.1| predicted protein [Nematostella vectensis]
 gb|EDO31610.1| predicted protein [Nematostella vectensis]
Length=450

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            K+LG+A  LR   +KL ++NL     D  YSAYHYSHPPL+ERL A+
Sbjct  399  KQLGFAPHLRSALIKLHQDNLGFPIADKLYSAYHYSHPPLLERLRAL  445



>gb|EGU13174.1| putative CAAX prenyl protease [Rhodotorula glutinis ATCC 204091]
Length=510

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -3

Query  477  KLG--YALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  337
            KLG  YA  L+ G V + E+NLS  + DP YSAY+Y+HP LVERL A+D
Sbjct  451  KLGDSYAKNLKKGLVSIHEKNLSLYDVDPLYSAYNYTHPTLVERLGALD  499



>ref|XP_007688928.1| hypothetical protein COCMIDRAFT_27157 [Bipolaris oryzae ATCC 
44560]
 gb|EUC44545.1| hypothetical protein COCMIDRAFT_27157 [Bipolaris oryzae ATCC 
44560]
Length=461

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLGYA  L    +KLQ +NLS+M+ D +YS++H+SHP L ERL A+    +K
Sbjct  389  KLGYARELGASLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMKWTGEK  440



>ref|XP_007712871.1| hypothetical protein COCCADRAFT_37287 [Bipolaris zeicola 26-R-13]
 gb|EUC32856.1| hypothetical protein COCCADRAFT_37287 [Bipolaris zeicola 26-R-13]
 gb|EUN26116.1| hypothetical protein COCVIDRAFT_38569 [Bipolaris victoriae FI3]
Length=461

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLGYA  L    +KLQ +NLS+M+ D +YS++H+SHP L ERL A+    +K
Sbjct  389  KLGYARELGASLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMKWTGEK  440



>gb|EMD85103.1| hypothetical protein COCHEDRAFT_1035767 [Bipolaris maydis C5]
 gb|ENH99233.1| hypothetical protein COCC4DRAFT_28605 [Bipolaris maydis ATCC 
48331]
Length=461

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLGYA  L    +KLQ +NLS+M+ D +YS++H+SHP L ERL A+    +K
Sbjct  389  KLGYARELGASLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMKWTGEK  440



>ref|XP_007681419.1| hypothetical protein BAUCODRAFT_39566 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC91397.1| hypothetical protein BAUCODRAFT_39566 [Baudoinia compniacensis 
UAMH 10762]
Length=475

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  471  GYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            GYA  L    +KLQ +NLSAM+ D  YS YHYSHP L ERL AI
Sbjct  393  GYASELAASLIKLQIQNLSAMDADWMYSTYHYSHPILTERLKAI  436



>ref|XP_007702220.1| hypothetical protein COCSADRAFT_146923 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD61824.1| hypothetical protein COCSADRAFT_146923 [Bipolaris sorokiniana 
ND90Pr]
Length=462

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KLGYA  L    +KLQ +NLS+M+ D +YS++H+SHP L ERL A+    +K
Sbjct  390  KLGYARELGASLIKLQIQNLSSMDADWFYSSFHHSHPILTERLKAMKWTGEK  441



>ref|XP_011175799.1| PREDICTED: CAAX prenyl protease 1 homolog [Solenopsis invicta]
Length=441

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  334
            KLG+  PL+   +KLQ++NL     D WYS +++SHPP++ERL AID+
Sbjct  392  KLGHGEPLKAALLKLQKDNLGYPLYDKWYSCWNHSHPPIIERLEAIDK  439



>gb|EPX72601.1| CAA Xprenyl protease [Schizosaccharomyces octosporus yFS286]
Length=457

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            KKLG A  L  G +++  +NLS +  DP Y++YH+SHP L +RLAAID  + K
Sbjct  402  KKLGLAKDLGDGLIRIHNDNLSPLEYDPLYTSYHHSHPILTDRLAAIDYMELK  454



>ref|XP_007720431.1| STE24 endopeptidase [Capronia coronata CBS 617.96]
 gb|EXJ96202.1| STE24 endopeptidase [Capronia coronata CBS 617.96]
Length=491

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 5/69 (7%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTX**VEQ  301
            + LG+   L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+     K       
Sbjct  412  RNLGFQKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKSSKPA-----  466

Query  300  PHAPGVHLN  274
            P+  GV L+
Sbjct  467  PNGKGVELD  475



>ref|XP_003647857.1| hypothetical protein Ecym_7192 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET41040.1| hypothetical protein Ecym_7192 [Eremothecium cymbalariae DBVPG#7215]
Length=456

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  337
            + LGY   L    V+L + NL  ++ D WYS YHYSHP L+ERL+A++
Sbjct  401  RSLGYTESLAAALVRLDKANLLPVHVDKWYSTYHYSHPTLIERLSALE  448



>gb|KIX97886.1| hypothetical protein Z520_06664 [Fonsecaea multimorphosa CBS 
102226]
Length=472

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            +LGY   L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+     K+
Sbjct  393  RLGYEKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKSSKS  445



>ref|XP_003023010.1| hypothetical protein TRV_02831 [Trichophyton verrucosum HKI 0517]
 gb|EFE42392.1| hypothetical protein TRV_02831 [Trichophyton verrucosum HKI 0517]
Length=585

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGY+  L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  512  KLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  557



>gb|KIX06592.1| hypothetical protein Z518_04568 [Rhinocladiella mackenziei CBS 
650.93]
Length=465

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKT  319
            + LGY   L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+     K+
Sbjct  386  RNLGYQKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAALGWKSSKS  439



>ref|XP_008080326.1| hypothetical protein GLAREA_07447 [Glarea lozoyensis ATCC 20868]
 gb|EHK96814.1| putative CAAX prenyl protease 1 [Glarea lozoyensis 74030]
 gb|EPE32314.1| hypothetical protein GLAREA_07447 [Glarea lozoyensis ATCC 20868]
Length=456

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            + LGY+  L    +KLQ +NLS M+ D  Y++YH+SHP L ERL A+   D+K
Sbjct  384  QNLGYSTELARSLIKLQIQNLSTMDADWMYASYHFSHPILSERLGALGWIDEK  436



>ref|XP_008553204.1| PREDICTED: CAAX prenyl protease 1 homolog [Microplitis demolitor]
 gb|EZA46084.1| prenyl protease type I-like protein [Microplitis demolitor]
Length=445

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  328
            KKLG+A  L+   VKL ++NLS    D  YS +H+SHPPL+ERL A+D+ D
Sbjct  395  KKLGHAAALKRALVKLHKDNLSFPLYDKLYSGWHHSHPPLLERLEALDKYD  445



>ref|XP_007754023.1| STE24 endopeptidase [Cladophialophora yegresii CBS 114405]
 gb|EXJ65456.1| STE24 endopeptidase [Cladophialophora yegresii CBS 114405]
Length=474

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            K LGY   L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  392  KDLGYQNELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAAL  438



>ref|XP_008724234.1| hypothetical protein G647_10020 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI26921.1| hypothetical protein G647_10020 [Cladophialophora carrionii CBS 
160.54]
Length=474

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            K LGY   L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  392  KDLGYQNELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAAL  438



>ref|XP_003661486.1| hypothetical protein MYCTH_2300946 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO56241.1| hypothetical protein MYCTH_2300946 [Myceliophthora thermophila 
ATCC 42464]
Length=461

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EPDKKT  319
            KLGY + L    +KLQ +NLS M+ D  +++YH+SHP L ERL A++ +P +K 
Sbjct  385  KLGYNIQLARSLIKLQIQNLSTMDADWMFASYHFSHPILTERLKALNWQPTEKV  438



>emb|CEP63868.1| LALA0S09e04302g1_1 [Lachancea lanzarotensis]
Length=455

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  337
            K LGY   L    + LQ +NLS MN D  +S+YHYSHP L ERL A++
Sbjct  400  KNLGYTKDLCRALINLQVKNLSTMNVDSLFSSYHYSHPTLPERLEALE  447



>ref|XP_001949388.2| PREDICTED: CAAX prenyl protease 1 homolog [Acyrthosiphon pisum]
 ref|XP_008186215.1| PREDICTED: CAAX prenyl protease 1 homolog [Acyrthosiphon pisum]
Length=450

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  328
            KKLGYA PL  G ++L  +NL     D  +SA+H++HP L+ERL AI + D
Sbjct  400  KKLGYAKPLESGLIRLHNDNLGFPVYDSLFSAWHHTHPQLLERLEAISKTD  450



>gb|ELU11443.1| hypothetical protein CAPTEDRAFT_171238 [Capitella teleta]
Length=459

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  328
            K LG A PLR   VKL ++NL    +D  YS +HYSHPPL+ER+ A+++ +
Sbjct  409  KSLGRAAPLRSALVKLNKDNLGFPISDWLYSTWHYSHPPLIERMKALEKEE  459



>emb|CEJ80463.1| hypothetical protein VHEMI00644 [Torrubiella hemipterigena]
Length=459

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            K+LGY   L  G +KL ++NLS+M+ D  Y+ YH+SHP L ERL A+
Sbjct  384  KELGYETQLATGLIKLHKQNLSSMDADWMYATYHFSHPHLSERLKAL  430



>gb|EGD96703.1| CaaX prenyl protease [Trichophyton tonsurans CBS 112818]
Length=431

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGY+  L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  385  KLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  430



>gb|EMS19341.1| STE24 endopeptidase [Rhodosporidium toruloides NP11]
Length=554

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -3

Query  477  KLG--YALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  337
            KLG  YA  L+ G V + E+NL+  + DP YSAY+Y+HP LVERL A+D
Sbjct  495  KLGDSYAKNLKKGLVSIHEKNLALYDVDPLYSAYNYTHPTLVERLGALD  543



>emb|CDR49210.1| RHTO0S24e00782g1_1 [Rhodosporidium toruloides]
Length=546

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -3

Query  477  KLG--YALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID  337
            KLG  YA  L+ G V + E+NL+  + DP YSAY+Y+HP LVERL A+D
Sbjct  487  KLGDSYAKNLKKGLVSIHEKNLALYDVDPLYSAYNYTHPTLVERLGALD  535



>ref|XP_003172087.1| CAAX prenyl protease 1 [Microsporum gypseum CBS 118893]
 gb|EFR01676.1| CAAX prenyl protease 1 [Microsporum gypseum CBS 118893]
Length=457

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGY+  L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  385  KLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  430



>ref|XP_007787411.1| hypothetical protein EPUS_00192 [Endocarpon pusillum Z07020]
 gb|ERF75399.1| hypothetical protein EPUS_00192 [Endocarpon pusillum Z07020]
Length=465

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGY   L    +KLQ +NLS M+ D  Y++YHYSHP L ERL A+
Sbjct  393  KLGYTTELAKSLIKLQIQNLSTMDADWMYASYHYSHPILSERLGAL  438



>gb|EGE06070.1| CAAX prenyl protease [Trichophyton equinum CBS 127.97]
 gb|KDB23738.1| hypothetical protein H109_04418 [Trichophyton interdigitale MR816]
Length=457

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGY+  L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  385  KLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  430



>ref|XP_003236858.1| CaaX prenyl protease [Trichophyton rubrum CBS 118892]
 gb|EGD85309.1| hypothetical protein TERG_01583 [Trichophyton rubrum CBS 118892]
 gb|EZF13842.1| hypothetical protein H100_06223 [Trichophyton rubrum MR850]
 gb|EZF39575.1| hypothetical protein H102_06190 [Trichophyton rubrum CBS 100081]
 gb|EZF50099.1| hypothetical protein H103_06215 [Trichophyton rubrum CBS 288.86]
 gb|EZF60731.1| hypothetical protein H104_06202 [Trichophyton rubrum CBS 289.86]
 gb|EZF71568.1| hypothetical protein H105_06229 [Trichophyton soudanense CBS 
452.61]
 gb|EZF82058.1| hypothetical protein H110_06211 [Trichophyton rubrum MR1448]
 gb|EZF92801.1| hypothetical protein H113_06258 [Trichophyton rubrum MR1459]
 gb|EZG03811.1| hypothetical protein H106_06053 [Trichophyton rubrum CBS 735.88]
 gb|EZG14381.1| hypothetical protein H107_06355 [Trichophyton rubrum CBS 202.88]
 gb|KDB31307.1| hypothetical protein H112_06208 [Trichophyton rubrum D6]
Length=459

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            KLGY+  L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  386  KLGYSKELARSLLKLQIQNLSTMDADWMYASYHYSHPILSERLAAL  431



>ref|XP_011299959.1| PREDICTED: CAAX prenyl protease 1 homolog [Fopius arisanus]
Length=442

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPD  328
            KKLG+A  L+   VKLQ++NL+    D  YS +++SHPPL+ERL A+D+ D
Sbjct  392  KKLGHAAALKRALVKLQKDNLAYPLFDKLYSGWYHSHPPLLERLEALDKVD  442



>gb|KFH61944.1| hypothetical protein MVEG_12278 [Mortierella verticillata NRRL 
6337]
Length=450

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -3

Query  474  LGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDE  334
            LGYA  L  G +KLQ +NL  MN D  YS YH +HP LVERL AI +
Sbjct  392  LGYASSLSSGLIKLQLKNLENMNPDWLYSVYHRNHPELVERLNAIKQ  438



>ref|XP_007917686.1| putative caax prenyl protease 1 protein [Togninia minima UCRPA7]
 gb|EON97602.1| putative caax prenyl protease 1 protein [Togninia minima UCRPA7]
Length=462

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 1/55 (2%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAID-EPDKKT  319
            + LGY+  L    +KLQ +NLS M+ D  Y++YH+SHP L ERL A++ +P +K 
Sbjct  384  RNLGYSTDLARSLIKLQIQNLSTMDADSLYASYHFSHPILSERLKALEWQPTEKI  438



>ref|XP_001643526.1| hypothetical protein Kpol_1008p4 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO15668.1| hypothetical protein Kpol_1008p4 [Vanderwaltozyma polyspora DSM 
70294]
Length=458

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K LG++  L    + L+ +NL+ MN DP YS YHYSHP L ERL A+    +K
Sbjct  403  KNLGHSEKLCSSLISLEMKNLATMNVDPLYSKYHYSHPHLAERLTALGYVSEK  455



>gb|KIW94481.1| hypothetical protein Z519_04457 [Cladophialophora bantiana CBS 
173.52]
Length=471

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            +LGY   L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  393  RLGYEKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAAL  438



>ref|XP_004181343.1| hypothetical protein TBLA_0F02850 [Tetrapisispora blattae CBS 
6284]
 emb|CCH61824.1| hypothetical protein TBLA_0F02850 [Tetrapisispora blattae CBS 
6284]
Length=468

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -3

Query  480  KKLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKK  322
            K L +   L    + LQ +NLS MN D  YS+YHYSHP L ERL+A+    +K
Sbjct  413  KSLKFTHHLSRALINLQIKNLSTMNVDSLYSSYHYSHPTLAERLSALGYVSEK  465



>gb|KIW26412.1| hypothetical protein PV07_09509 [Cladophialophora immunda]
Length=472

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -3

Query  477  KLGYALPLRXGXVKLQEENLSAMNTDPWYSAYHYSHPPLVERLAAI  340
            +LGY   L    +KLQ +NLS M+ D  Y++YHYSHP L ERLAA+
Sbjct  393  RLGYEKELARSLIKLQVQNLSTMDADWMYASYHYSHPILAERLAAL  438



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140