BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF039L13

Length=797
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002266672.1|  PREDICTED: probable aspartyl aminopeptidase ...    270   3e-83   Vitis vinifera
ref|XP_003591777.1|  Aspartyl aminopeptidase                            262   5e-83   
ref|XP_004249975.1|  PREDICTED: probable aspartyl aminopeptidase        269   1e-82   Solanum lycopersicum
ref|XP_009596186.1|  PREDICTED: probable aspartyl aminopeptidase        269   1e-82   Nicotiana tomentosiformis
ref|XP_006361458.1|  PREDICTED: probable aspartyl aminopeptidase-...    269   1e-82   Solanum tuberosum [potatoes]
ref|XP_009802964.1|  PREDICTED: probable aspartyl aminopeptidase        269   2e-82   Nicotiana sylvestris
ref|XP_003591778.1|  Aspartyl aminopeptidase                            262   3e-82   
ref|XP_007213437.1|  hypothetical protein PRUPE_ppa025466mg             264   3e-81   
ref|XP_008375605.1|  PREDICTED: probable aspartyl aminopeptidase        261   7e-81   
emb|CDO99897.1|  unnamed protein product                                265   7e-81   Coffea canephora [robusta coffee]
ref|XP_011076920.1|  PREDICTED: probable aspartyl aminopeptidase ...    262   3e-80   
gb|KJB78672.1|  hypothetical protein B456_013G012600                    263   3e-80   Gossypium raimondii
gb|KCW51474.1|  hypothetical protein EUGRSUZ_J00993                     257   5e-80   Eucalyptus grandis [rose gum]
gb|KHG01889.1|  Aspartyl aminopeptidase                                 263   6e-80   Gossypium arboreum [tree cotton]
ref|XP_009336015.1|  PREDICTED: probable aspartyl aminopeptidase ...    261   7e-80   Pyrus x bretschneideri [bai li]
ref|XP_011076919.1|  PREDICTED: probable aspartyl aminopeptidase ...    262   9e-80   Sesamum indicum [beniseed]
gb|AES62027.2|  aspartyl aminopeptidase-like protein, putative          261   1e-79   Medicago truncatula
ref|XP_009336013.1|  PREDICTED: probable aspartyl aminopeptidase ...    261   1e-79   Pyrus x bretschneideri [bai li]
ref|XP_008347038.1|  PREDICTED: probable aspartyl aminopeptidase        261   1e-79   
ref|XP_010244532.1|  PREDICTED: probable aspartyl aminopeptidase ...    261   1e-79   Nelumbo nucifera [Indian lotus]
ref|XP_008232012.1|  PREDICTED: probable aspartyl aminopeptidase        261   1e-79   Prunus mume [ume]
ref|XP_007010329.1|  Zn-dependent exopeptidases superfamily prote...    260   2e-79   
ref|XP_003591776.1|  Aspartyl aminopeptidase                            261   2e-79   
gb|KDO42030.1|  hypothetical protein CISIN_1g009941mg                   257   2e-79   Citrus sinensis [apfelsine]
ref|XP_010694702.1|  PREDICTED: probable aspartyl aminopeptidase ...    259   4e-79   
ref|XP_004150844.1|  PREDICTED: probable aspartyl aminopeptidase-...    259   5e-79   
ref|XP_010694701.1|  PREDICTED: probable aspartyl aminopeptidase ...    259   5e-79   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN52197.1|  hypothetical protein Csa_5G615200                       259   6e-79   
gb|KDO42028.1|  hypothetical protein CISIN_1g009941mg                   257   7e-79   Citrus sinensis [apfelsine]
ref|XP_004496198.1|  PREDICTED: probable aspartyl aminopeptidase-...    259   8e-79   
ref|XP_008446766.1|  PREDICTED: probable aspartyl aminopeptidase        259   9e-79   Cucumis melo [Oriental melon]
ref|XP_007143804.1|  hypothetical protein PHAVU_007G103100g             258   1e-78   Phaseolus vulgaris [French bean]
gb|KDO42027.1|  hypothetical protein CISIN_1g009941mg                   258   1e-78   Citrus sinensis [apfelsine]
ref|XP_010088778.1|  Aspartyl aminopeptidase                            258   2e-78   Morus notabilis
ref|XP_010032079.1|  PREDICTED: probable aspartyl aminopeptidase ...    258   2e-78   Eucalyptus grandis [rose gum]
ref|XP_006436620.1|  hypothetical protein CICLE_v10031166mg             258   2e-78   
ref|XP_006485213.1|  PREDICTED: probable aspartyl aminopeptidase-...    257   3e-78   Citrus sinensis [apfelsine]
ref|XP_006436621.1|  hypothetical protein CICLE_v10031166mg             258   4e-78   
ref|XP_003556268.2|  PREDICTED: probable aspartyl aminopeptidase-...    257   4e-78   Glycine max [soybeans]
gb|KHN00906.1|  Aspartyl aminopeptidase                                 257   5e-78   Glycine soja [wild soybean]
ref|XP_009356123.1|  PREDICTED: probable aspartyl aminopeptidase        255   2e-77   Pyrus x bretschneideri [bai li]
ref|XP_010907134.1|  PREDICTED: probable aspartyl aminopeptidase ...    252   5e-77   
tpg|DAA55692.1|  TPA: hypothetical protein ZEAMMB73_277076              243   6e-77   
ref|XP_002311031.2|  hypothetical protein POPTR_0008s02250g             253   7e-77   
emb|CDX70207.1|  BnaA10g25560D                                          253   9e-77   
ref|XP_010543610.1|  PREDICTED: probable aspartyl aminopeptidase        253   1e-76   Tarenaya hassleriana [spider flower]
emb|CDY44874.1|  BnaC09g50740D                                          253   1e-76   Brassica napus [oilseed rape]
ref|XP_002311016.2|  hypothetical protein POPTR_0008s02250g             253   2e-76   
ref|XP_011032849.1|  PREDICTED: probable aspartyl aminopeptidase        253   2e-76   Populus euphratica
ref|XP_006398926.1|  hypothetical protein EUTSA_v10013255mg             252   3e-76   Eutrema salsugineum [saltwater cress]
gb|EMT26810.1|  Aspartyl aminopeptidase                                 246   3e-76   
ref|XP_009122574.1|  PREDICTED: probable aspartyl aminopeptidase        252   3e-76   Brassica rapa
gb|EYU19780.1|  hypothetical protein MIMGU_mgv1a004147mg                253   3e-76   Erythranthe guttata [common monkey flower]
ref|XP_006287486.1|  hypothetical protein CARUB_v10000697mg             252   5e-76   Capsella rubella
ref|XP_010907133.1|  PREDICTED: probable aspartyl aminopeptidase ...    251   5e-76   Elaeis guineensis
ref|XP_010490993.1|  PREDICTED: probable aspartyl aminopeptidase        251   9e-76   Camelina sativa [gold-of-pleasure]
gb|KDP35783.1|  hypothetical protein JCGZ_10419                         251   1e-75   Jatropha curcas
ref|XP_003565148.1|  PREDICTED: probable aspartyl aminopeptidase        249   2e-75   Brachypodium distachyon [annual false brome]
ref|XP_002873165.1|  hypothetical protein ARALYDRAFT_487250             249   3e-75   
ref|XP_006645339.1|  PREDICTED: probable aspartyl aminopeptidase-...    249   4e-75   Oryza brachyantha
dbj|BAC43404.1|  putative aspartyl aminopeptidase                       249   4e-75   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196091.1|  Zn-dependent exopeptidases superfamily protein        249   4e-75   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001045513.1|  Os01g0967900                                       249   5e-75   
ref|XP_010423546.1|  PREDICTED: probable aspartyl aminopeptidase        249   6e-75   Camelina sativa [gold-of-pleasure]
ref|XP_008788174.1|  PREDICTED: probable aspartyl aminopeptidase        248   9e-75   Phoenix dactylifera
gb|KFK24913.1|  hypothetical protein AALP_AA8G041200                    248   1e-74   Arabis alpina [alpine rockcress]
ref|XP_010452373.1|  PREDICTED: probable aspartyl aminopeptidase        248   1e-74   Camelina sativa [gold-of-pleasure]
dbj|BAJ86698.1|  predicted protein                                      248   1e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008674488.1|  PREDICTED: probable aspartyl aminopeptidase        245   2e-74   
ref|XP_002524995.1|  Aspartyl aminopeptidase, putative                  248   2e-74   Ricinus communis
gb|EEC72239.1|  hypothetical protein OsI_05355                          246   3e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_004971395.1|  PREDICTED: probable aspartyl aminopeptidase-...    245   1e-73   
ref|XP_004971394.1|  PREDICTED: probable aspartyl aminopeptidase-...    245   1e-73   Setaria italica
ref|XP_002457006.1|  hypothetical protein SORBIDRAFT_03g047100          244   3e-73   Sorghum bicolor [broomcorn]
ref|XP_009390025.1|  PREDICTED: probable aspartyl aminopeptidase        244   7e-73   
gb|KHN37829.1|  Aspartyl aminopeptidase                                 242   9e-73   Glycine soja [wild soybean]
gb|EPS58587.1|  aspartyl aminopeptidase                                 236   8e-71   Genlisea aurea
ref|XP_006851486.1|  hypothetical protein AMTR_s00040p00143220          234   3e-69   
ref|XP_002975004.1|  hypothetical protein SELMODRAFT_442726             223   2e-65   
ref|XP_002977420.1|  hypothetical protein SELMODRAFT_176342             221   3e-65   
ref|XP_001420830.1|  predicted protein                                  217   3e-63   Ostreococcus lucimarinus CCE9901
gb|ABR25597.1|  aspartyl aminopeptidase                                 206   7e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_001751765.1|  predicted protein                                  214   2e-62   
ref|XP_008360788.1|  PREDICTED: probable aspartyl aminopeptidase        205   9e-62   
ref|XP_011024060.1|  PREDICTED: probable aspartyl aminopeptidase        213   2e-61   Populus euphratica
ref|XP_003082377.1|  aspartyl aminopeptidase (ISS)                      212   4e-61   
dbj|BAK02635.1|  predicted protein                                      202   7e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CEF99925.1|  Peptidase M18                                          212   9e-61   Ostreococcus tauri
ref|XP_008464464.1|  PREDICTED: probable aspartyl aminopeptidase ...    211   1e-60   Cucumis melo [Oriental melon]
ref|XP_011044185.1|  PREDICTED: probable aspartyl aminopeptidase        210   2e-60   Populus euphratica
ref|XP_002318119.2|  aspartyl aminopeptidase family protein             210   2e-60   
ref|XP_004138058.1|  PREDICTED: probable aspartyl aminopeptidase-...    210   2e-60   
ref|XP_004165826.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    209   2e-60   
gb|KGN63496.1|  hypothetical protein Csa_1G002160                       209   4e-60   
ref|XP_002321687.1|  aspartyl aminopeptidase family protein             209   5e-60   Populus trichocarpa [western balsam poplar]
gb|KFK26680.1|  hypothetical protein AALP_AA8G278900                    208   6e-60   Arabis alpina [alpine rockcress]
ref|XP_008239439.1|  PREDICTED: probable aspartyl aminopeptidase        208   7e-60   Prunus mume [ume]
ref|XP_002511215.1|  Aspartyl aminopeptidase, putative                  207   8e-60   
ref|XP_009134060.1|  PREDICTED: probable aspartyl aminopeptidase        207   1e-59   Brassica rapa
emb|CDY34036.1|  BnaC03g27790D                                          207   1e-59   Brassica napus [oilseed rape]
ref|XP_002963681.1|  hypothetical protein SELMODRAFT_80579              207   1e-59   
emb|CDX83160.1|  BnaA03g23460D                                          207   1e-59   
ref|NP_200824.1|  zn-dependent exopeptidases superfamily protein        207   1e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61631.1|  aspartyl aminopeptidase-like protein                    207   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001066463.1|  Os12g0236500                                       207   2e-59   
ref|XP_002866374.1|  hypothetical protein ARALYDRAFT_332278             207   2e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_010536640.1|  PREDICTED: probable aspartyl aminopeptidase        207   2e-59   Tarenaya hassleriana [spider flower]
ref|XP_002974770.1|  hypothetical protein SELMODRAFT_101663             207   2e-59   
sp|B9RAJ0.2|DNPEP_RICCO  RecName: Full=Probable aspartyl aminopep...    207   2e-59   Ricinus communis
tpg|DAA58400.1|  TPA: hypothetical protein ZEAMMB73_107325              202   2e-59   
ref|XP_007209960.1|  hypothetical protein PRUPE_ppa004869mg             207   3e-59   Prunus persica
ref|XP_006664453.1|  PREDICTED: probable aspartyl aminopeptidase-...    206   5e-59   Oryza brachyantha
gb|AFK46082.1|  unknown                                                 206   5e-59   Lotus japonicus
ref|XP_006476998.1|  PREDICTED: probable aspartyl aminopeptidase-...    206   6e-59   Citrus sinensis [apfelsine]
ref|XP_007037930.1|  Zn-dependent exopeptidases superfamily protein     206   9e-59   
ref|XP_006402123.1|  hypothetical protein EUTSA_v10015798mg             205   9e-59   
ref|XP_006440072.1|  hypothetical protein CICLE_v10019750mg             206   1e-58   Citrus clementina [clementine]
gb|EYU43065.1|  hypothetical protein MIMGU_mgv1a005789mg                204   1e-58   Erythranthe guttata [common monkey flower]
gb|KHF99832.1|  Aspartyl aminopeptidase                                 204   1e-58   Gossypium arboreum [tree cotton]
ref|XP_010674696.1|  PREDICTED: probable aspartyl aminopeptidase        205   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002458215.1|  hypothetical protein SORBIDRAFT_03g029130          204   1e-58   Sorghum bicolor [broomcorn]
ref|XP_011083884.1|  PREDICTED: probable aspartyl aminopeptidase        204   2e-58   Sesamum indicum [beniseed]
ref|XP_006280394.1|  hypothetical protein CARUB_v10026321mg             204   2e-58   Capsella rubella
ref|XP_003578741.1|  PREDICTED: probable aspartyl aminopeptidase        204   3e-58   Brachypodium distachyon [annual false brome]
ref|NP_001159225.1|  hypothetical protein                               202   3e-58   Zea mays [maize]
ref|XP_009346502.1|  PREDICTED: probable aspartyl aminopeptidase        204   3e-58   Pyrus x bretschneideri [bai li]
ref|XP_009336570.1|  PREDICTED: probable aspartyl aminopeptidase        203   5e-58   Pyrus x bretschneideri [bai li]
ref|XP_006826610.1|  hypothetical protein AMTR_s00138p00074300          199   5e-58   
ref|XP_008374264.1|  PREDICTED: probable aspartyl aminopeptidase        203   5e-58   Malus domestica [apple tree]
ref|XP_010456062.1|  PREDICTED: probable aspartyl aminopeptidase        203   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009359462.1|  PREDICTED: probable aspartyl aminopeptidase        203   6e-58   Pyrus x bretschneideri [bai li]
ref|XP_010483659.1|  PREDICTED: probable aspartyl aminopeptidase        203   7e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010443807.1|  PREDICTED: probable aspartyl aminopeptidase        203   7e-58   Camelina sativa [gold-of-pleasure]
ref|XP_008673044.1|  PREDICTED: hypothetical protein isoform X1         202   9e-58   Zea mays [maize]
ref|XP_003526970.1|  PREDICTED: probable aspartyl aminopeptidase-...    202   9e-58   Glycine max [soybeans]
ref|XP_007137936.1|  hypothetical protein PHAVU_009G167900g             202   1e-57   Phaseolus vulgaris [French bean]
ref|XP_004500663.1|  PREDICTED: probable aspartyl aminopeptidase-...    202   2e-57   Cicer arietinum [garbanzo]
ref|XP_008392833.1|  PREDICTED: probable aspartyl aminopeptidase        202   2e-57   
ref|XP_004960722.1|  PREDICTED: probable aspartyl aminopeptidase-...    201   2e-57   Setaria italica
ref|XP_008367478.1|  PREDICTED: probable aspartyl aminopeptidase        202   2e-57   
ref|XP_010102886.1|  Aspartyl aminopeptidase                            202   3e-57   
ref|XP_009379936.1|  PREDICTED: probable aspartyl aminopeptidase        201   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010026684.1|  PREDICTED: probable aspartyl aminopeptidase        201   4e-57   Eucalyptus grandis [rose gum]
ref|XP_001756754.1|  predicted protein                                  201   4e-57   
ref|XP_009404266.1|  PREDICTED: probable aspartyl aminopeptidase        201   5e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB27157.1|  hypothetical protein B456_004G282900                    200   8e-57   Gossypium raimondii
gb|KJB27156.1|  hypothetical protein B456_004G282900                    200   8e-57   Gossypium raimondii
gb|KJB27155.1|  hypothetical protein B456_004G282900                    199   8e-57   Gossypium raimondii
gb|KCW83184.1|  hypothetical protein EUGRSUZ_B00132                     201   9e-57   Eucalyptus grandis [rose gum]
ref|XP_003602076.1|  Aspartyl aminopeptidase                            200   9e-57   Medicago truncatula
ref|XP_002283475.1|  PREDICTED: probable aspartyl aminopeptidase        200   1e-56   Vitis vinifera
emb|CDP05422.1|  unnamed protein product                                199   1e-56   Coffea canephora [robusta coffee]
ref|XP_011463290.1|  PREDICTED: probable aspartyl aminopeptidase        199   2e-56   Fragaria vesca subsp. vesca
ref|XP_006351481.1|  PREDICTED: probable aspartyl aminopeptidase-...    199   2e-56   Solanum tuberosum [potatoes]
ref|XP_009624334.1|  PREDICTED: probable aspartyl aminopeptidase        199   2e-56   Nicotiana tomentosiformis
ref|XP_010248918.1|  PREDICTED: probable aspartyl aminopeptidase ...    199   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_009790447.1|  PREDICTED: probable aspartyl aminopeptidase        199   3e-56   Nicotiana sylvestris
ref|XP_003523136.1|  PREDICTED: probable aspartyl aminopeptidase-...    199   3e-56   Glycine max [soybeans]
gb|KDP30945.1|  hypothetical protein JCGZ_11321                         199   3e-56   Jatropha curcas
ref|XP_004236341.1|  PREDICTED: probable aspartyl aminopeptidase        198   4e-56   Solanum lycopersicum
gb|EPS62030.1|  aspartyl aminopeptidase-like protein                    198   4e-56   Genlisea aurea
ref|XP_004172613.1|  PREDICTED: probable aspartyl aminopeptidase-...    196   8e-56   
ref|XP_008807558.1|  PREDICTED: probable aspartyl aminopeptidase ...    196   2e-55   Phoenix dactylifera
ref|XP_008807556.1|  PREDICTED: probable aspartyl aminopeptidase ...    196   3e-55   
gb|KCW51472.1|  hypothetical protein EUGRSUZ_J00993                     196   4e-55   Eucalyptus grandis [rose gum]
gb|ABR17053.1|  unknown                                                 196   4e-55   Picea sitchensis
ref|XP_010930126.1|  PREDICTED: probable aspartyl aminopeptidase        195   5e-55   Elaeis guineensis
gb|KJB19571.1|  hypothetical protein B456_003G109700                    192   5e-55   Gossypium raimondii
gb|KDO42029.1|  hypothetical protein CISIN_1g009941mg                   195   9e-55   Citrus sinensis [apfelsine]
ref|XP_002507546.1|  aspartyl aminopeptidase                            195   1e-54   Micromonas commoda
gb|KJB19572.1|  hypothetical protein B456_003G109700                    192   6e-54   Gossypium raimondii
ref|XP_004165827.1|  PREDICTED: probable aspartyl aminopeptidase-...    191   1e-53   
ref|XP_004138060.1|  PREDICTED: probable aspartyl aminopeptidase-...    191   1e-53   
ref|XP_010694703.1|  PREDICTED: probable aspartyl aminopeptidase ...    191   3e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS55846.1|  Aspartyl aminopeptidase                                 193   4e-53   Triticum urartu
ref|XP_008464465.1|  PREDICTED: probable aspartyl aminopeptidase ...    190   4e-53   Cucumis melo [Oriental melon]
ref|XP_002907085.1|  aspartyl aminopeptidase, putative                  189   7e-53   Phytophthora infestans T30-4
dbj|BAD94988.1|  aspartyl aminopeptidase                                178   9e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001690598.1|  aspartyl aminopeptidase-like protein               190   3e-52   Chlamydomonas reinhardtii
ref|XP_004336070.1|  aspartyl aminopeptidase                            186   3e-52   Acanthamoeba castellanii str. Neff
ref|XP_008909814.1|  hypothetical protein PPTG_14635                    187   4e-52   Phytophthora parasitica INRA-310
ref|XP_009519985.1|  hypothetical protein PHYSODRAFT_539739             186   9e-52   Phytophthora sojae
ref|XP_007512692.1|  predicted protein                                  187   4e-51   Bathycoccus prasinos
ref|XP_003060266.1|  predicted protein                                  182   3e-50   Micromonas pusilla CCMP1545
gb|EMT03759.1|  Aspartyl aminopeptidase                                 187   3e-50   
ref|XP_003055398.1|  predicted protein                                  179   5e-49   Micromonas pusilla CCMP1545
ref|XP_005648131.1|  peptidase M18, aminopeptidase I                    178   2e-48   Coccomyxa subellipsoidea C-169
ref|XP_011396821.1|  Aspartyl aminopeptidase                            177   4e-48   Auxenochlorella protothecoides
emb|CEJ00699.1|  Putative Aspartyl aminopeptidase                       172   6e-48   Rhizopus microsporus
ref|XP_007514776.1|  predicted protein                                  177   9e-48   Bathycoccus prasinos
gb|ETO14766.1|  hypothetical protein RFI_22603                          166   3e-47   Reticulomyxa filosa
gb|KJE94975.1|  aspartyl aminopeptidase                                 174   4e-47   Capsaspora owczarzaki ATCC 30864
ref|XP_004346183.2|  aspartyl aminopeptidase                            174   4e-47   Capsaspora owczarzaki ATCC 30864
gb|EXX59698.1|  Ape4p                                                   174   4e-47   Rhizophagus irregularis DAOM 197198w
ref|XP_001421486.1|  predicted protein                                  175   5e-47   Ostreococcus lucimarinus CCE9901
ref|XP_002505350.1|  predicted protein                                  174   6e-47   Micromonas commoda
gb|ESA11968.1|  hypothetical protein GLOINDRAFT_335422                  174   7e-47   
emb|CEG01789.1|  Peptidase M18                                          174   8e-47   Ostreococcus tauri
emb|CCA15777.1|  aspartyl aminopeptidase putative                       172   2e-46   Albugo laibachii Nc14
emb|CEG81490.1|  Putative Aspartyl aminopeptidase                       171   4e-46   Rhizopus microsporus
emb|CCI46763.1|  unnamed protein product                                173   7e-46   Albugo candida
ref|XP_003083329.1|  aspartyl aminopeptidase (ISS)                      175   1e-45   
ref|XP_011457668.1|  PREDICTED: probable aspartyl aminopeptidase        160   5e-45   Fragaria vesca subsp. vesca
ref|XP_002678138.1|  predicted protein                                  168   6e-45   Naegleria gruberi strain NEG-M
ref|XP_008863481.1|  hypothetical protein H310_01914                    168   6e-45   Aphanomyces invadans
gb|EPB92944.1|  aspartyl aminopeptidase                                 168   9e-45   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN09714.1|  aspartyl aminopeptidase                                167   1e-44   Mucor ambiguus
gb|EPB84012.1|  aspartyl aminopeptidase                                 168   1e-44   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_008620058.1|  aspartyl aminopeptidase                            167   1e-44   Saprolegnia diclina VS20
gb|KDO32253.1|  hypothetical protein SPRG_02733                         167   1e-44   Saprolegnia parasitica CBS 223.65
ref|XP_002960428.1|  hypothetical protein SELMODRAFT_164111             167   2e-44   
ref|XP_002967289.1|  hypothetical protein SELMODRAFT_86972              167   2e-44   
emb|CDS03243.1|  hypothetical protein LRAMOSA00645                      167   2e-44   Lichtheimia ramosa
ref|XP_009825683.1|  hypothetical protein H257_03355                    166   3e-44   Aphanomyces astaci
dbj|GAN06933.1|  aspartyl aminopeptidase                                167   3e-44   Mucor ambiguus
gb|EIE78284.1|  hypothetical protein RO3G_02988                         166   3e-44   Rhizopus delemar RA 99-880
ref|XP_002129082.1|  PREDICTED: aspartyl aminopeptidase-like            164   1e-43   Ciona intestinalis [sea vase]
emb|CDH60153.1|  aspartyl aminopeptidase                                164   3e-43   Lichtheimia corymbifera JMRC:FSU:9682
gb|EIE88868.1|  hypothetical protein RO3G_13579                         163   4e-43   Rhizopus delemar RA 99-880
emb|CEP14293.1|  hypothetical protein                                   163   4e-43   Parasitella parasitica
ref|XP_009025082.1|  hypothetical protein HELRODRAFT_187369             163   6e-43   Helobdella robusta
emb|CEJ04001.1|  Putative Aspartyl aminopeptidase                       163   7e-43   Rhizopus microsporus
emb|CEI95696.1|  Putative Aspartyl aminopeptidase                       162   1e-42   Rhizopus microsporus
emb|CEG69346.1|  Putative Aspartyl aminopeptidase                       162   1e-42   Rhizopus microsporus
emb|CEG81693.1|  Putative Aspartyl aminopeptidase                       162   2e-42   Rhizopus microsporus
ref|XP_007879166.1|  hypothetical protein PFL1_03458                    160   1e-41   Anthracocystis flocculosa PF-1
ref|XP_005849269.1|  hypothetical protein CHLNCDRAFT_143544             159   1e-41   Chlorella variabilis
emb|CBQ68247.1|  probable aspartyl aminopeptidase                       159   3e-41   Sporisorium reilianum SRZ2
ref|XP_004994670.1|  aspartyl aminopeptidase                            158   4e-41   Salpingoeca rosetta
ref|XP_001745410.1|  hypothetical protein                               157   5e-41   Monosiga brevicollis MX1
emb|CCF51316.1|  probable aspartyl aminopeptidase                       158   5e-41   Ustilago hordei
emb|CDI51753.1|  probable aspartyl aminopeptidase                       157   1e-40   Melanopsichium pennsylvanicum 4
ref|XP_004361073.1|  aspartyl aminopeptidase                            157   1e-40   Cavenderia fasciculata
gb|ELU07857.1|  hypothetical protein CAPTEDRAFT_158105                  156   1e-40   Capitella teleta
ref|XP_005415861.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-40   
dbj|GAC99602.1|  aspartyl aminopeptidase                                156   2e-40   Pseudozyma hubeiensis SY62
ref|XP_011386806.1|  putative aspartyl aminopeptidase                   156   3e-40   Ustilago maydis 521
gb|KDN49618.1|  putative aspartyl aminopeptidase                        156   3e-40   Tilletiaria anomala UBC 951
ref|NP_001279935.1|  aspartyl aminopeptidase                            155   3e-40   Callorhinchus milii [Australian ghost shark]
gb|AFK11572.1|  aspartyl aminopeptidase                                 155   3e-40   Callorhinchus milii [Australian ghost shark]
ref|XP_002289000.1|  probable aspartyl aminopeptidase                   155   5e-40   Thalassiosira pseudonana CCMP1335
ref|XP_007883309.1|  PREDICTED: aspartyl aminopeptidase                 155   7e-40   Callorhinchus milii [Australian ghost shark]
gb|ABQ22407.1|  aspartyl aminopeptidase-like protein                    148   9e-40   Callithrix jacchus [common marmoset]
gb|EWC43491.1|  aspartyl aminopeptidase                                 154   1e-39   Drechslerella stenobrocha 248
gb|KFQ24176.1|  Aspartyl aminopeptidase                                 149   1e-39   Merops nubicus
ref|XP_001837079.1|  aspartyl aminopeptidase                            154   1e-39   Coprinopsis cinerea okayama7#130
ref|XP_008947935.1|  PREDICTED: aspartyl aminopeptidase                 149   1e-39   Merops nubicus
ref|XP_006683342.1|  hypothetical protein BATDEDRAFT_18145              153   3e-39   Batrachochytrium dendrobatidis JAM81
ref|XP_009033025.1|  hypothetical protein AURANDRAFT_20254              153   3e-39   Aureococcus anophagefferens
ref|XP_010181866.1|  PREDICTED: aspartyl aminopeptidase                 150   4e-39   Mesitornis unicolor
ref|XP_002155387.2|  PREDICTED: aspartyl aminopeptidase-like            152   4e-39   
ref|XP_011481489.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    152   5e-39   
ref|XP_006035444.1|  PREDICTED: aspartyl aminopeptidase                 152   6e-39   
ref|XP_005452349.1|  PREDICTED: aspartyl aminopeptidase-like isof...    152   6e-39   Oreochromis niloticus
ref|XP_003446617.1|  PREDICTED: aspartyl aminopeptidase-like isof...    152   7e-39   Oreochromis niloticus
ref|XP_008323212.1|  PREDICTED: aspartyl aminopeptidase isoform X2      152   8e-39   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_002840917.1|  hypothetical protein                               151   9e-39   Tuber melanosporum Mel28
ref|XP_008323213.1|  PREDICTED: aspartyl aminopeptidase isoform X3      151   9e-39   
ref|XP_008323211.1|  PREDICTED: aspartyl aminopeptidase isoform X1      152   9e-39   
ref|XP_002592514.1|  hypothetical protein BRAFLDRAFT_69005              151   9e-39   Branchiostoma floridae
ref|XP_004563350.1|  PREDICTED: aspartyl aminopeptidase-like isof...    151   1e-38   Maylandia zebra
dbj|GAC74074.1|  histone acetyltransferase                              155   1e-38   Moesziomyces antarcticus T-34
dbj|GAK61818.1|  acyltransferase                                        155   1e-38   Moesziomyces antarcticus
ref|XP_005330568.1|  PREDICTED: aspartyl aminopeptidase                 151   1e-38   Ictidomys tridecemlineatus
ref|XP_004563349.1|  PREDICTED: aspartyl aminopeptidase-like isof...    151   1e-38   Maylandia zebra
gb|KIK06798.1|  hypothetical protein K443DRAFT_674082                   151   1e-38   Laccaria amethystina LaAM-08-1
gb|ETS64061.1|  hypothetical protein PaG_02398                          155   1e-38   Moesziomyces aphidis DSM 70725
gb|EJK61550.1|  hypothetical protein THAOC_17943                        152   1e-38   Thalassiosira oceanica
gb|KFQ19689.1|  Aspartyl aminopeptidase                                 150   1e-38   Mesitornis unicolor
ref|XP_007575368.1|  PREDICTED: aspartyl aminopeptidase isoform X1      151   1e-38   Poecilia formosa
ref|XP_007575369.1|  PREDICTED: aspartyl aminopeptidase isoform X2      150   2e-38   Poecilia formosa
ref|XP_009553937.1|  PREDICTED: aspartyl aminopeptidase                 150   2e-38   Cuculus canorus
gb|KFO72178.1|  Aspartyl aminopeptidase                                 150   2e-38   Cuculus canorus
gb|EST06743.1|  histone acetyltransferase                               155   2e-38   Kalmanozyma brasiliensis GHG001
gb|EPY30718.1|  aspartyl aminopeptidase                                 145   2e-38   Strigomonas culicis
ref|XP_005154153.1|  PREDICTED: aspartyl aminopeptidase                 150   2e-38   Melopsittacus undulatus
ref|XP_010022905.1|  PREDICTED: aspartyl aminopeptidase                 149   2e-38   Nestor notabilis
ref|XP_005279931.1|  PREDICTED: aspartyl aminopeptidase                 150   2e-38   Chrysemys picta bellii
gb|KFQ45573.1|  Aspartyl aminopeptidase                                 149   2e-38   Nestor notabilis
ref|XP_011123681.1|  hypothetical protein AOL_s00083g200                150   2e-38   
ref|XP_006272731.1|  PREDICTED: aspartyl aminopeptidase                 150   2e-38   
gb|EJT49728.1|  aspartyl aminopeptidase                                 150   3e-38   
ref|XP_009069815.1|  PREDICTED: aspartyl aminopeptidase                 149   3e-38   
gb|EMC84232.1|  Aspartyl aminopeptidase                                 149   3e-38   
emb|CEJ81993.1|  Putative Aspartyl aminopeptidase                       150   3e-38   
ref|XP_002736578.1|  PREDICTED: aspartyl aminopeptidase-like            146   4e-38   
gb|KFP77222.1|  Aspartyl aminopeptidase                                 149   4e-38   
gb|ENH77871.1|  aspartyl aminopeptidase                                 150   4e-38   
ref|XP_007068759.1|  PREDICTED: aspartyl aminopeptidase                 149   4e-38   
ref|NP_001172115.1|  aspartyl aminopeptidase                            149   4e-38   
gb|KFV81952.1|  Aspartyl aminopeptidase                                 148   4e-38   
ref|XP_005101285.1|  PREDICTED: aspartyl aminopeptidase-like            149   5e-38   
gb|KEZ42556.1|  Aspartyl aminopeptidase                                 150   5e-38   
ref|XP_002712541.1|  PREDICTED: aspartyl aminopeptidase isoform X2      149   6e-38   
ref|XP_005814088.1|  PREDICTED: aspartyl aminopeptidase-like            149   6e-38   
ref|XP_008293067.1|  PREDICTED: aspartyl aminopeptidase isoform X1      149   6e-38   
gb|KGL86427.1|  Aspartyl aminopeptidase                                 148   7e-38   
ref|XP_007234617.1|  PREDICTED: aspartyl aminopeptidase                 149   7e-38   
ref|XP_008257444.1|  PREDICTED: aspartyl aminopeptidase isoform X1      149   7e-38   
gb|KFQ94690.1|  Aspartyl aminopeptidase                                 148   7e-38   
emb|CCF41181.1|  aspartyl aminopeptidase                                149   7e-38   
ref|XP_010405218.1|  PREDICTED: aspartyl aminopeptidase                 148   7e-38   
gb|KFO52747.1|  Aspartyl aminopeptidase                                 148   8e-38   
dbj|GAM24522.1|  hypothetical protein SAMD00019534_076970               150   8e-38   
ref|XP_008293068.1|  PREDICTED: aspartyl aminopeptidase isoform X2      149   8e-38   
ref|XP_003510642.1|  PREDICTED: aspartyl aminopeptidase                 149   8e-38   
gb|ETE70732.1|  Aspartyl aminopeptidase                                 149   8e-38   
ref|WP_028469943.1|  aminopeptidase                                     148   9e-38   
emb|CEP14325.1|  hypothetical protein                                   152   9e-38   
ref|XP_007279968.1|  aspartyl aminopeptidase                            147   9e-38   
gb|KFV63385.1|  Aspartyl aminopeptidase                                 148   9e-38   
ref|XP_005361637.1|  PREDICTED: aspartyl aminopeptidase isoform X2      149   9e-38   
ref|XP_009674526.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-37   
ref|XP_005070528.1|  PREDICTED: aspartyl aminopeptidase                 149   1e-37   
dbj|GAM18899.1|  hypothetical protein SAMD00019534_020740               148   1e-37   
ref|XP_005361636.1|  PREDICTED: aspartyl aminopeptidase isoform X1      149   1e-37   
ref|XP_009882434.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-37   
ref|XP_004576859.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-37   
ref|XP_008626911.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-37   
ref|XP_005498746.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-37   
gb|KFY19397.1|  hypothetical protein V491_04461                         145   1e-37   
ref|XP_009460435.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-37   
ref|XP_009086531.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-37   
ref|XP_006906751.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-37   
ref|XP_005049624.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-37   
ref|XP_010567906.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-37   
ref|XP_009994576.1|  PREDICTED: aspartyl aminopeptidase                 148   1e-37   
emb|CCE31713.1|  probable aspartyl aminopeptidase                       148   2e-37   
ref|XP_006245246.1|  PREDICTED: aspartyl aminopeptidase isoform X1      148   2e-37   
ref|XP_005610686.1|  PREDICTED: aspartyl aminopeptidase isoform X3      148   2e-37   
ref|NP_001020050.1|  aspartyl aminopeptidase                            148   2e-37   
gb|KFU88502.1|  Aspartyl aminopeptidase                                 147   2e-37   
ref|XP_010748613.1|  PREDICTED: aspartyl aminopeptidase isoform X2      148   2e-37   
ref|XP_005610687.1|  PREDICTED: aspartyl aminopeptidase isoform X4      148   2e-37   
ref|XP_010748612.1|  PREDICTED: aspartyl aminopeptidase isoform X1      148   2e-37   
ref|XP_001492028.3|  PREDICTED: aspartyl aminopeptidase isoform X1      148   2e-37   
gb|KHC41084.1|  aspartyl aminopeptidase                                 148   2e-37   
ref|XP_713998.1|  hypothetical protein CaO19.9871                       148   2e-37   
gb|EEQ42153.1|  hypothetical protein CAWG_00351                         148   2e-37   
gb|KGR14305.1|  aspartyl aminopeptidase                                 148   2e-37   
gb|EFQ27027.1|  aminopeptidase I zinc metalloprotease                   148   2e-37   
gb|ELR06737.1|  hypothetical protein GMDG_00354                         148   2e-37   
ref|XP_007600979.1|  aminopeptidase I zinc metalloprotease              148   2e-37   
gb|KHC89264.1|  aspartyl aminopeptidase                                 148   2e-37   
gb|KGT71532.1|  aspartyl aminopeptidase                                 148   2e-37   
ref|XP_005234414.1|  PREDICTED: aspartyl aminopeptidase                 147   2e-37   
gb|ELK17177.1|  Aspartyl aminopeptidase                                 148   2e-37   
gb|AAD01212.1|  aspartyl aminopeptidase                                 148   2e-37   
gb|KGL77727.1|  Aspartyl aminopeptidase                                 147   2e-37   
emb|CBY20487.1|  unnamed protein product                                147   2e-37   
ref|XP_005520045.1|  PREDICTED: aspartyl aminopeptidase                 148   2e-37   
ref|XP_006245247.1|  PREDICTED: aspartyl aminopeptidase isoform X2      148   2e-37   
ref|XP_010334576.1|  PREDICTED: aspartyl aminopeptidase isoform X3      148   2e-37   
gb|KGQ90736.1|  aspartyl aminopeptidase                                 148   2e-37   
ref|XP_002417658.1|  aspartyl amino peptidase, putative                 148   2e-37   
gb|KHC60383.1|  aspartyl aminopeptidase                                 148   2e-37   
ref|XP_005610685.1|  PREDICTED: aspartyl aminopeptidase isoform X2      148   2e-37   
gb|KHC56043.1|  aspartyl aminopeptidase                                 148   2e-37   
gb|KHC84477.1|  aspartyl aminopeptidase                                 148   2e-37   
ref|XP_010334577.1|  PREDICTED: aspartyl aminopeptidase isoform X4      147   2e-37   
gb|KIL70156.1|  hypothetical protein M378DRAFT_156218                   147   2e-37   
ref|XP_010213657.1|  PREDICTED: aspartyl aminopeptidase                 147   2e-37   
ref|XP_007086232.1|  PREDICTED: aspartyl aminopeptidase                 147   3e-37   
ref|XP_003925541.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   3e-37   
ref|XP_008594228.1|  aminopeptidase I zinc metalloprotease              147   3e-37   
ref|XP_006739743.1|  PREDICTED: aspartyl aminopeptidase                 147   3e-37   
gb|KGQ12368.1|  Aspartyl aminopeptidase                                 147   3e-37   
ref|XP_004402808.1|  PREDICTED: aspartyl aminopeptidase isoform 1       147   3e-37   
ref|XP_007956515.1|  PREDICTED: aspartyl aminopeptidase                 147   3e-37   
ref|XP_004762903.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   3e-37   
gb|ABY89804.1|  aspartyl aminopeptidase (predicted)                     147   3e-37   
ref|XP_005485343.1|  PREDICTED: aspartyl aminopeptidase                 148   3e-37   
ref|XP_008495745.1|  PREDICTED: aspartyl aminopeptidase                 147   3e-37   
ref|XP_003347186.1|  hypothetical protein SMAC_08078                    147   3e-37   
gb|KFO95292.1|  Aspartyl aminopeptidase                                 147   3e-37   
ref|XP_008528206.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    148   3e-37   
ref|XP_008997792.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   3e-37   
ref|XP_008997791.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   3e-37   
ref|XP_004402809.1|  PREDICTED: aspartyl aminopeptidase isoform 2       147   3e-37   
ref|XP_004762907.1|  PREDICTED: aspartyl aminopeptidase isoform X6      147   3e-37   
ref|XP_006668022.1|  aspartyl aminopeptidase                            148   3e-37   
ref|XP_001877081.1|  aspartyl aminopeptidase                            147   3e-37   
ref|XP_006867902.1|  PREDICTED: aspartyl aminopeptidase                 147   3e-37   
gb|KIO30255.1|  hypothetical protein M407DRAFT_157151                   147   3e-37   
ref|NP_001085525.1|  aspartyl aminopeptidase                            147   3e-37   
ref|XP_010334575.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   3e-37   
ref|XP_008688803.1|  PREDICTED: aspartyl aminopeptidase                 147   3e-37   
ref|XP_004325558.1|  PREDICTED: aspartyl aminopeptidase isoform 1       147   3e-37   
ref|NP_001104301.1|  aspartyl aminopeptidase isoform a                  147   3e-37   
ref|XP_005443029.1|  PREDICTED: aspartyl aminopeptidase                 147   3e-37   
ref|XP_004262732.1|  PREDICTED: aspartyl aminopeptidase isoform 2       147   3e-37   
gb|KFA55851.1|  hypothetical protein S40293_01900                       147   3e-37   
ref|NP_058574.3|  aspartyl aminopeptidase isoform b                     147   3e-37   
ref|XP_002192610.2|  PREDICTED: aspartyl aminopeptidase                 147   3e-37   
dbj|BAE32800.1|  unnamed protein product                                147   3e-37   
ref|XP_003729436.1|  PREDICTED: aspartyl aminopeptidase-like            148   3e-37   
ref|XP_004325559.1|  PREDICTED: aspartyl aminopeptidase isoform 2       147   3e-37   
ref|XP_009909456.1|  PREDICTED: aspartyl aminopeptidase                 148   4e-37   
dbj|BAC30079.1|  unnamed protein product                                147   4e-37   
gb|KIY46623.1|  peptidase M18, aminopeptidase I                         147   4e-37   
gb|KEY64841.1|  hypothetical protein S7711_08849                        147   4e-37   
ref|XP_004325560.1|  PREDICTED: aspartyl aminopeptidase isoform 3       147   4e-37   
gb|AAH04854.2|  DNPEP protein                                           145   4e-37   
ref|NP_001012937.1|  aspartyl aminopeptidase                            147   4e-37   
ref|XP_004262731.1|  PREDICTED: aspartyl aminopeptidase isoform 1       147   4e-37   
gb|KFZ06387.1|  hypothetical protein V501_07458                         147   4e-37   
ref|XP_008823998.1|  PREDICTED: aspartyl aminopeptidase isoform X3      147   4e-37   
gb|ACA64864.1|  aspartyl aminopeptidase (predicted)                     147   4e-37   
ref|XP_006935665.1|  PREDICTED: aspartyl aminopeptidase isoform X3      147   4e-37   
gb|KDN65494.1|  putative aminopeptidase I zinc metalloprotease          147   4e-37   
ref|XP_004762902.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   4e-37   
ref|XP_005202875.1|  PREDICTED: aspartyl aminopeptidase isoform X5      147   4e-37   
ref|XP_008823997.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   4e-37   
gb|KFA70034.1|  hypothetical protein S40285_02036                       147   4e-37   
gb|KDR83853.1|  hypothetical protein GALMADRAFT_236273                  147   4e-37   
ref|XP_005640751.1|  PREDICTED: aspartyl aminopeptidase isoform X4      147   4e-37   
emb|CCC13957.1|  unnamed protein product                                147   4e-37   
ref|NP_001016026.1|  aspartyl aminopeptidase                            147   4e-37   
ref|NP_001088602.1|  uncharacterized protein LOC495491                  147   4e-37   
ref|XP_008823992.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   4e-37   
ref|XP_006935664.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   4e-37   
ref|XP_005956749.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   4e-37   
gb|ELR60782.1|  Aspartyl aminopeptidase                                 147   4e-37   
ref|XP_007445869.1|  PREDICTED: aspartyl aminopeptidase                 147   4e-37   
ref|XP_008578710.1|  PREDICTED: aspartyl aminopeptidase                 147   4e-37   
gb|AAX07699.1|  aspartyl aminopeptidase-like protein                    147   4e-37   
ref|NP_001039417.1|  aspartyl aminopeptidase                            147   4e-37   
gb|EDL00397.1|  aspartyl aminopeptidase, isoform CRA_b                  147   4e-37   
pdb|3VAR|A  Chain A, Crystal Structure Of Dnpep, Znzn Form              147   4e-37   
ref|XP_005676645.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   4e-37   
ref|XP_004674317.1|  PREDICTED: aspartyl aminopeptidase                 147   4e-37   
ref|XP_007122487.1|  PREDICTED: aspartyl aminopeptidase                 147   4e-37   
ref|XP_007519740.1|  PREDICTED: aspartyl aminopeptidase                 147   5e-37   
ref|XP_003966622.1|  PREDICTED: aspartyl aminopeptidase-like            147   5e-37   
ref|XP_010890470.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   5e-37   
ref|XP_004005000.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    147   5e-37   
ref|XP_010859551.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   5e-37   
ref|XP_008057077.1|  PREDICTED: aspartyl aminopeptidase                 147   5e-37   
ref|XP_005640748.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   5e-37   
ref|XP_005676646.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   5e-37   
ref|XP_957246.2|  aspartyl aminopeptidase                               147   5e-37   
ref|XP_005640749.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   5e-37   
ref|XP_010890471.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   5e-37   
ref|XP_009850908.1|  aspartyl aminopeptidase                            147   5e-37   
ref|XP_009062504.1|  hypothetical protein LOTGIDRAFT_220342             146   5e-37   
ref|XP_009041924.1|  hypothetical protein AURANDRAFT_34091              147   5e-37   
ref|XP_004701683.1|  PREDICTED: aspartyl aminopeptidase isoform X2      146   5e-37   
gb|EPY40683.1|  aspartyl aminopeptidase                                 143   5e-37   
ref|XP_006935663.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   5e-37   
dbj|BAA13937.1|  unnamed protein product                                145   6e-37   
ref|XP_003713775.1|  aspartyl aminopeptidase                            147   6e-37   
gb|KID79523.1|  aspartyl aminopeptidase                                 147   6e-37   
ref|XP_004467839.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    146   6e-37   
ref|XP_010800626.1|  PREDICTED: aspartyl aminopeptidase isoform X4      146   6e-37   
ref|XP_005956748.1|  PREDICTED: aspartyl aminopeptidase isoform X1      147   7e-37   
ref|XP_010800625.1|  PREDICTED: aspartyl aminopeptidase isoform X3      146   7e-37   
ref|XP_005202874.1|  PREDICTED: aspartyl aminopeptidase isoform X2      147   7e-37   
ref|XP_005395588.1|  PREDICTED: aspartyl aminopeptidase isoform X4      146   8e-37   
ref|XP_008970260.1|  PREDICTED: aspartyl aminopeptidase isoform X3      145   8e-37   
gb|EPY33263.1|  aminopeptidase                                          145   8e-37   
ref|XP_004701682.1|  PREDICTED: aspartyl aminopeptidase isoform X1      146   8e-37   
ref|XP_006960518.1|  aspartyl aminopeptidase                            146   8e-37   
ref|XP_006972210.1|  PREDICTED: aspartyl aminopeptidase isoform X1      146   8e-37   
ref|XP_009236416.1|  PREDICTED: aspartyl aminopeptidase isoform X4      145   8e-37   
ref|XP_005395587.1|  PREDICTED: aspartyl aminopeptidase isoform X3      146   9e-37   
gb|ACE77655.1|  aspartyl aminopeptidase (predicted)                     145   9e-37   
ref|XP_005395586.1|  PREDICTED: aspartyl aminopeptidase isoform X2      146   9e-37   
ref|XP_009217911.1|  aspartyl aminopeptidase                            146   9e-37   
ref|XP_005246489.2|  PREDICTED: aspartyl aminopeptidase isoform X4      145   9e-37   
ref|XP_006460010.1|  hypothetical protein AGABI2DRAFT_116970            146   9e-37   
ref|XP_006972211.1|  PREDICTED: aspartyl aminopeptidase isoform X2      146   9e-37   
ref|XP_005574439.1|  PREDICTED: aspartyl aminopeptidase isoform X5      145   9e-37   
ref|XP_004662959.1|  PREDICTED: aspartyl aminopeptidase                 145   1e-36   
gb|KFG81622.1|  aspartyl aminopeptidase                                 146   1e-36   
gb|AAX27684.2|  SJCHGC06075 protein                                     144   1e-36   
ref|XP_007823244.1|  peptidase M18-like protein                         146   1e-36   
ref|XP_011108047.1|  hypothetical protein H072_2059                     146   1e-36   
gb|KIK30586.1|  hypothetical protein PISMIDRAFT_301057                  145   1e-36   
ref|XP_007799299.1|  putative aspartyl aminopeptidase protein           146   1e-36   
ref|XP_007329540.1|  hypothetical protein AGABI1DRAFT_113568            145   1e-36   
gb|EPY23074.1|  aminopeptidase                                          145   1e-36   
ref|XP_005395585.1|  PREDICTED: aspartyl aminopeptidase isoform X1      145   1e-36   
sp|Q9ULA0.1|DNPEP_HUMAN  RecName: Full=Aspartyl aminopeptidase          145   1e-36   
ref|XP_005246487.2|  PREDICTED: aspartyl aminopeptidase isoform X2      145   1e-36   
ref|XP_008970257.1|  PREDICTED: aspartyl aminopeptidase isoform X2      145   1e-36   
ref|XP_009236412.1|  PREDICTED: aspartyl aminopeptidase isoform X1      145   1e-36   
ref|XP_004427652.1|  PREDICTED: aspartyl aminopeptidase                 145   1e-36   
gb|KII95242.1|  hypothetical protein PLICRDRAFT_48205                   145   1e-36   
gb|AAY15050.1|  unknown                                                 145   1e-36   
ref|NP_036232.2|  aspartyl aminopeptidase                               145   1e-36   
ref|XP_003038056.1|  hypothetical protein SCHCODRAFT_72102              145   1e-36   
ref|XP_001424295.1|  hypothetical protein                               145   1e-36   
ref|NP_001125438.1|  aspartyl aminopeptidase                            145   1e-36   
gb|KFY79508.1|  hypothetical protein V499_01520                         146   1e-36   
ref|XP_004033307.1|  PREDICTED: aspartyl aminopeptidase                 145   1e-36   
ref|NP_594745.1|  aspartyl aminopeptidase Aap1                          145   1e-36   
ref|XP_009236411.1|  PREDICTED: aspartyl aminopeptidase isoform X2      145   1e-36   
ref|XP_001163232.1|  PREDICTED: aspartyl aminopeptidase isoform X1      145   1e-36   
ref|XP_005710409.1|  unnamed protein product                            145   1e-36   
dbj|BAA92014.1|  unnamed protein product                                145   1e-36   



>ref|XP_002266672.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Vitis 
vinifera]
 ref|XP_010658775.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Vitis 
vinifera]
 ref|XP_010658776.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Vitis 
vinifera]
 ref|XP_010658777.1| PREDICTED: probable aspartyl aminopeptidase isoform X4 [Vitis 
vinifera]
 emb|CBI35256.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+T+FLFKEV RIHNLPTQ
Sbjct  404  SADMAHGVHPNFMDKHEEHHRPELQKGLVIKHNANQRYATSGITAFLFKEVGRIHNLPTQ  463

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAYKHFKAFYQ
Sbjct  464  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYKHFKAFYQ  523

Query  437  TFSSVDRKLNVD  402
            TFSSVDRKLNVD
Sbjct  524  TFSSVDRKLNVD  535



>ref|XP_003591777.1| Aspartyl aminopeptidase [Medicago truncatula]
Length=287

 Score =   262 bits (670),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TS LFKEV +IHNLPTQ
Sbjct  155  SADMAHGVHPNFADKHEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQ  214

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ
Sbjct  215  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQ  274

Query  437  TFSSVDRKLNVD  402
             FSS+D+ L VD
Sbjct  275  NFSSIDKMLTVD  286



>ref|XP_004249975.1| PREDICTED: probable aspartyl aminopeptidase [Solanum lycopersicum]
Length=535

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TSFLFKEVAR+H+LPTQ
Sbjct  404  SADMAHGVHPNFVDKHEEHHRPELQKGLVIKHNANQRYATSGITSFLFKEVARLHSLPTQ  463

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILA+GVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFYQ
Sbjct  464  DFVVRNDMGCGSTIGPILAAGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYQ  523

Query  437  TFSSVDRKLNVD  402
            +FSS+DRKLNVD
Sbjct  524  SFSSIDRKLNVD  535



>ref|XP_009596186.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana tomentosiformis]
Length=541

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSGVTSFLFKEVAR+H+LPTQ
Sbjct  410  SADMAHGVHPNFVDKHEEHHRPELQKGLVIKHNANQRYATSGVTSFLFKEVARLHSLPTQ  469

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ
Sbjct  470  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  529

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKL VD
Sbjct  530  TFSSIDRKLIVD  541



>ref|XP_006361458.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum tuberosum]
Length=535

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TSFLFKEVAR+H+LPTQ
Sbjct  404  SADMAHGVHPNFIDKHEEHHRPELQKGLVIKHNANQRYATSGITSFLFKEVARLHSLPTQ  463

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILA+GVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFYQ
Sbjct  464  DFVVRNDMGCGSTIGPILAAGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYQ  523

Query  437  TFSSVDRKLNVD  402
            +FSS+DRKLNVD
Sbjct  524  SFSSIDRKLNVD  535



>ref|XP_009802964.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana sylvestris]
Length=542

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSGVTSFLFKEVAR+H+LPTQ
Sbjct  411  SADMAHGVHPNFVDKHEEHHRPELQKGLVIKHNANQRYATSGVTSFLFKEVARLHSLPTQ  470

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ
Sbjct  471  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  530

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKL VD
Sbjct  531  TFSSIDRKLIVD  542



>ref|XP_003591778.1| Aspartyl aminopeptidase [Medicago truncatula]
Length=332

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TS LFKEV +IHNLPTQ
Sbjct  200  SADMAHGVHPNFADKHEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQ  259

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ
Sbjct  260  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQ  319

Query  437  TFSSVDRKLNVD  402
             FSS+D+ L VD
Sbjct  320  NFSSIDKMLTVD  331



>ref|XP_007213437.1| hypothetical protein PRUPE_ppa025466mg, partial [Prunus persica]
 gb|EMJ14636.1| hypothetical protein PRUPE_ppa025466mg, partial [Prunus persica]
Length=474

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSFLFKE+ +IHNLPTQ
Sbjct  342  SADMAHGVHPNFMDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFLFKEIGKIHNLPTQ  401

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYKHFKAFYQ
Sbjct  402  EFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKHFKAFYQ  461

Query  437  TFSSVDRKLNVD  402
             FSS+D+KLNVD
Sbjct  462  AFSSIDKKLNVD  473



>ref|XP_008375605.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=407

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ
Sbjct  275  SADMAHGVHPNFXDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQ  334

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQ
Sbjct  335  EFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQ  394

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKL+VD
Sbjct  395  TFSSIDRKLDVD  406



>emb|CDO99897.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSGVT+FLFKEVA+++NLPTQ
Sbjct  414  SADMAHGVHPNFMDKHEEHHRPELQKGLVIKHNANQRYATSGVTAFLFKEVAKMNNLPTQ  473

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKED+D AYKHF+AFYQ
Sbjct  474  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDVDFAYKHFRAFYQ  533

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKLNVD
Sbjct  534  TFSSIDRKLNVD  545



>ref|XP_011076920.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Sesamum 
indicum]
Length=493

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP LQKGLVIKHNA+QRYATSGVTSFLFKEVA+IHNLP Q
Sbjct  361  SADMAHGVHPNFMDKHEENHRPVLQKGLVIKHNANQRYATSGVTSFLFKEVAKIHNLPIQ  420

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFY+
Sbjct  421  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYK  480

Query  437  TFSSVDRKLNVD  402
            TFSS+D+KLNVD
Sbjct  481  TFSSIDKKLNVD  492



>gb|KJB78672.1| hypothetical protein B456_013G012600 [Gossypium raimondii]
 gb|KJB78673.1| hypothetical protein B456_013G012600 [Gossypium raimondii]
Length=521

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPE+ KGLVIKHNA+QRYATSGVT+FLFKEVA++HNLPTQ
Sbjct  390  SADMAHGVHPNFMDKHEEHHRPEMHKGLVIKHNANQRYATSGVTAFLFKEVAKMHNLPTQ  449

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAYKHFKAFYQ
Sbjct  450  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYKHFKAFYQ  509

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKL VD
Sbjct  510  TFSSIDRKLIVD  521



>gb|KCW51474.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=360

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNFTDKHEEHHRPE+QKGLVIKHNA+QRYATSG+T+FLFKEV +IHNLPTQ
Sbjct  228  SADMAHGVHPNFTDKHEEHHRPEMQKGLVIKHNANQRYATSGITAFLFKEVGKIHNLPTQ  287

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAY+HFKAFYQ
Sbjct  288  EFAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYQHFKAFYQ  347

Query  437  TFSSVDRKLNVD  402
            +FS VD KL +D
Sbjct  348  SFSHVDSKLTID  359



>gb|KHG01889.1| Aspartyl aminopeptidase [Gossypium arboreum]
Length=549

 Score =   263 bits (671),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPE+ KGLVIKHNA+QRYATSGVT+FLFKEVA++HNLPTQ
Sbjct  418  SADMAHGVHPNFMDKHEEHHRPEMHKGLVIKHNANQRYATSGVTAFLFKEVAKMHNLPTQ  477

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAYKHFKAFYQ
Sbjct  478  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYKHFKAFYQ  537

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKL VD
Sbjct  538  TFSSIDRKLIVD  549



>ref|XP_009336015.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336016.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Pyrus 
x bretschneideri]
Length=529

 Score =   261 bits (668),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ
Sbjct  397  SADMAHGVHPNFMDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQ  456

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQ
Sbjct  457  EFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQ  516

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKL+VD
Sbjct  517  TFSSIDRKLDVD  528



>ref|XP_011076919.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Sesamum 
indicum]
Length=539

 Score =   262 bits (669),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP LQKGLVIKHNA+QRYATSGVTSFLFKEVA+IHNLP Q
Sbjct  407  SADMAHGVHPNFMDKHEENHRPVLQKGLVIKHNANQRYATSGVTSFLFKEVAKIHNLPIQ  466

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFY+
Sbjct  467  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYK  526

Query  437  TFSSVDRKLNVD  402
            TFSS+D+KLNVD
Sbjct  527  TFSSIDKKLNVD  538



>gb|AES62027.2| aspartyl aminopeptidase-like protein, putative [Medicago truncatula]
Length=526

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TS LFKEV +IHNLPTQ
Sbjct  394  SADMAHGVHPNFADKHEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQ  453

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ
Sbjct  454  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQ  513

Query  437  TFSSVDRKLNVD  402
             FSS+D+ L VD
Sbjct  514  NFSSIDKMLTVD  525



>ref|XP_009336013.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336014.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Pyrus 
x bretschneideri]
Length=529

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ
Sbjct  397  SADMAHGVHPNFMDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQ  456

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQ
Sbjct  457  EFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQ  516

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKL+VD
Sbjct  517  TFSSIDRKLDVD  528



>ref|XP_008347038.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=529

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ
Sbjct  397  SADMAHGVHPNFIDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQ  456

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYK+FKAFYQ
Sbjct  457  EFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKYFKAFYQ  516

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKL+VD
Sbjct  517  TFSSIDRKLDVD  528



>ref|XP_010244532.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DK+EEHHRPELQKGLVIKHNA+QRYATSGVT+FLFKE+A IHN+P Q
Sbjct  388  SADMAHGVHPNFMDKYEEHHRPELQKGLVIKHNANQRYATSGVTAFLFKEIANIHNIPVQ  447

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKED+DIAYKHFKAFY+
Sbjct  448  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDVDIAYKHFKAFYK  507

Query  437  TFSSVDRKLNVD  402
            TFS +DRKLNVD
Sbjct  508  TFSGIDRKLNVD  519



>ref|XP_008232012.1| PREDICTED: probable aspartyl aminopeptidase [Prunus mume]
Length=530

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYATSGVTSFLFKE+ +IHNLPTQ
Sbjct  398  SADMAHGVHPNFMDKHEEHHRPEMQKGLVIKHNANQRYATSGVTSFLFKEIGKIHNLPTQ  457

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAYKHFKAFYQ
Sbjct  458  EFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYKHFKAFYQ  517

Query  437  TFSSVDRKLNVD  402
             FSS+D+KL+VD
Sbjct  518  DFSSIDKKLDVD  529



>ref|XP_007010329.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY19139.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
Length=520

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPE++KGLVIKHNA+QRYATSGVT+FLFKEV +IHNLPTQ
Sbjct  389  SADMAHGVHPNFMDKHEEHHRPEMRKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPTQ  448

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGK+DIDIAYKHFKAFYQ
Sbjct  449  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKDDIDIAYKHFKAFYQ  508

Query  437  TFSSVDRKLNVD  402
             FSS+DRKL VD
Sbjct  509  IFSSIDRKLIVD  520



>ref|XP_003591776.1| Aspartyl aminopeptidase [Medicago truncatula]
Length=550

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPELQKGLVIKHNA+QRYATSG+TS LFKEV +IHNLPTQ
Sbjct  418  SADMAHGVHPNFADKHEEHHRPELQKGLVIKHNANQRYATSGITSLLFKEVGKIHNLPTQ  477

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ
Sbjct  478  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQ  537

Query  437  TFSSVDRKLNVD  402
             FSS+D+ L VD
Sbjct  538  NFSSIDKMLTVD  549



>gb|KDO42030.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=410

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ
Sbjct  278  SADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQ  337

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY+
Sbjct  338  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYE  397

Query  437  TFSSVDRKLNVD  402
            +FSS+D+KL VD
Sbjct  398  SFSSIDKKLIVD  409



>ref|XP_010694702.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=507

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP++QKGLVIKHNA+QRYATSGVT+FLFKEVA+IHNLPTQ
Sbjct  376  SADMAHGVHPNFMDKHEENHRPQMQKGLVIKHNANQRYATSGVTAFLFKEVAKIHNLPTQ  435

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVV+NDMGCGSTIGPILA+GVGIRTVDCGI+QLSMHSVREICGKEDIDIAYKHFKAFY+
Sbjct  436  EFVVKNDMGCGSTIGPILAAGVGIRTVDCGISQLSMHSVREICGKEDIDIAYKHFKAFYE  495

Query  437  TFSSVDRKLNVD  402
            +FSS+DRKL+VD
Sbjct  496  SFSSIDRKLSVD  507



>ref|XP_004150844.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=527

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNFTDKHEEHHRPE+QKG+VIKHNA+QRYATSGVT+FLF+EV RIHNLPTQ
Sbjct  395  SADMAHGVHPNFTDKHEEHHRPEMQKGIVIKHNANQRYATSGVTAFLFREVGRIHNLPTQ  454

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHS+REICGKEDID AYK+FKAFY+
Sbjct  455  DFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSIREICGKEDIDTAYKYFKAFYK  514

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKL VD
Sbjct  515  TFSSIDRKLKVD  526



>ref|XP_010694701.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=529

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP++QKGLVIKHNA+QRYATSGVT+FLFKEVA+IHNLPTQ
Sbjct  398  SADMAHGVHPNFMDKHEENHRPQMQKGLVIKHNANQRYATSGVTAFLFKEVAKIHNLPTQ  457

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVV+NDMGCGSTIGPILA+GVGIRTVDCGI+QLSMHSVREICGKEDIDIAYKHFKAFY+
Sbjct  458  EFVVKNDMGCGSTIGPILAAGVGIRTVDCGISQLSMHSVREICGKEDIDIAYKHFKAFYE  517

Query  437  TFSSVDRKLNVD  402
            +FSS+DRKL+VD
Sbjct  518  SFSSIDRKLSVD  529



>gb|KGN52197.1| hypothetical protein Csa_5G615200 [Cucumis sativus]
Length=527

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNFTDKHEEHHRPE+QKG+VIKHNA+QRYATSGVT+FLF+EV RIHNLPTQ
Sbjct  395  SADMAHGVHPNFTDKHEEHHRPEMQKGIVIKHNANQRYATSGVTAFLFREVGRIHNLPTQ  454

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHS+REICGKEDID AYK+FKAFY+
Sbjct  455  DFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSIREICGKEDIDTAYKYFKAFYK  514

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKL VD
Sbjct  515  TFSSIDRKLKVD  526



>gb|KDO42028.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=469

 Score =   257 bits (657),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ
Sbjct  337  SADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQ  396

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY+
Sbjct  397  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYE  456

Query  437  TFSSVDRKLNVD  402
            +FSS+D+KL VD
Sbjct  457  SFSSIDKKLIVD  468



>ref|XP_004496198.1| PREDICTED: probable aspartyl aminopeptidase-like [Cicer arietinum]
Length=534

 Score =   259 bits (662),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF+DKHEEHHRPELQKGLVIKHNA+QRYAT+G+TSFLFKEV +IHNLPTQ
Sbjct  402  SADMAHGVHPNFSDKHEEHHRPELQKGLVIKHNANQRYATTGITSFLFKEVGKIHNLPTQ  461

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHS+REICGKEDIDIAYK+FKAFYQ
Sbjct  462  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSIREICGKEDIDIAYKYFKAFYQ  521

Query  437  TFSSVDRKLNVD  402
             FSS+D+ L VD
Sbjct  522  NFSSIDKMLTVD  533



>ref|XP_008446766.1| PREDICTED: probable aspartyl aminopeptidase [Cucumis melo]
Length=527

 Score =   259 bits (661),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNFTDKHEEHHRPE+QKG+VIK+NA+QRYATSGVT+FLF+EV RIHNLPTQ
Sbjct  395  SADMAHGVHPNFTDKHEEHHRPEMQKGIVIKYNANQRYATSGVTAFLFREVGRIHNLPTQ  454

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHS+REICGKED+D AYK+FKAFY+
Sbjct  455  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSIREICGKEDVDTAYKYFKAFYK  514

Query  437  TFSSVDRKLNVD  402
            TFSS+DRKL VD
Sbjct  515  TFSSIDRKLKVD  526



>ref|XP_007143804.1| hypothetical protein PHAVU_007G103100g [Phaseolus vulgaris]
 gb|ESW15798.1| hypothetical protein PHAVU_007G103100g [Phaseolus vulgaris]
Length=527

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE HRPELQKGLVIKHNA+QRYATSG+TSFLFKEV +IHNLPTQ
Sbjct  395  SADMAHGVHPNFMDKHEELHRPELQKGLVIKHNANQRYATSGITSFLFKEVGKIHNLPTQ  454

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DF VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+RE+CGKEDIDIAYKHFKAFYQ
Sbjct  455  DFAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREMCGKEDIDIAYKHFKAFYQ  514

Query  437  TFSSVDRKLNVD  402
            +FSSVD+ L VD
Sbjct  515  SFSSVDKMLTVD  526



>gb|KDO42027.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=496

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ
Sbjct  364  SADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQ  423

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY+
Sbjct  424  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYE  483

Query  437  TFSSVDRKLNVD  402
            +FSS+D+KL VD
Sbjct  484  SFSSIDKKLIVD  495



>ref|XP_010088778.1| Aspartyl aminopeptidase [Morus notabilis]
 gb|EXB36961.1| Aspartyl aminopeptidase [Morus notabilis]
Length=532

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF D+HEEHHRP +QKGLVIKHNA+QRYATSGVTSFLFKEV RIHNLPTQ
Sbjct  400  SADMAHGVHPNFVDRHEEHHRPVMQKGLVIKHNANQRYATSGVTSFLFKEVGRIHNLPTQ  459

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICGKEDIDIAY+HFKAFY+
Sbjct  460  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGKEDIDIAYQHFKAFYK  519

Query  437  TFSSVDRKLNVD  402
            TFSSVD KL++D
Sbjct  520  TFSSVDMKLSID  531



>ref|XP_010032079.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032080.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Eucalyptus 
grandis]
 ref|XP_010032081.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Eucalyptus 
grandis]
 gb|KCW51471.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=522

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNFTDKHEEHHRPE+QKGLVIKHNA+QRYATSG+T+FLFKEV +IHNLPTQ
Sbjct  390  SADMAHGVHPNFTDKHEEHHRPEMQKGLVIKHNANQRYATSGITAFLFKEVGKIHNLPTQ  449

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+CGKEDIDIAY+HFKAFYQ
Sbjct  450  EFAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCGKEDIDIAYQHFKAFYQ  509

Query  437  TFSSVDRKLNVD  402
            +FS VD KL +D
Sbjct  510  SFSHVDSKLTID  521



>ref|XP_006436620.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
 gb|ESR49860.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
Length=516

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ
Sbjct  384  SADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQ  443

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY+
Sbjct  444  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYE  503

Query  437  TFSSVDRKLNVD  402
            +FSS+D+KL VD
Sbjct  504  SFSSIDKKLIVD  515



>ref|XP_006485213.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485214.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X2 [Citrus 
sinensis]
 gb|KDO42026.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=522

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ
Sbjct  390  SADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQ  449

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY+
Sbjct  450  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYE  509

Query  437  TFSSVDRKLNVD  402
            +FSS+D+KL VD
Sbjct  510  SFSSIDKKLIVD  521



>ref|XP_006436621.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
 gb|ESR49861.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
Length=542

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ
Sbjct  410  SADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQ  469

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY+
Sbjct  470  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYE  529

Query  437  TFSSVDRKLNVD  402
            +FSS+D+KL VD
Sbjct  530  SFSSIDKKLIVD  541



>ref|XP_003556268.2| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=539

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE HRPELQKGLVIKHNA+QRYATSG+TSFLFKEV +IHNLPTQ
Sbjct  407  SADMAHGVHPNFMDKHEELHRPELQKGLVIKHNANQRYATSGITSFLFKEVGKIHNLPTQ  466

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ
Sbjct  467  EFAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQ  526

Query  437  TFSSVDRKLNVD  402
             FSSVD+ L VD
Sbjct  527  NFSSVDKMLTVD  538



>gb|KHN00906.1| Aspartyl aminopeptidase [Glycine soja]
Length=518

 Score =   257 bits (656),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE HRPELQKGLVIKHNA+QRYATSG+TSFLFKEV +IHNLPTQ
Sbjct  386  SADMAHGVHPNFMDKHEELHRPELQKGLVIKHNANQRYATSGITSFLFKEVGKIHNLPTQ  445

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REICGKEDIDIAYKHFKAFYQ
Sbjct  446  EFAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICGKEDIDIAYKHFKAFYQ  505

Query  437  TFSSVDRKLNVD  402
             FSSVD+ L VD
Sbjct  506  NFSSVDKMLTVD  517



>ref|XP_009356123.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=531

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRP++QKGLVIKHNA+QRYATSGVTSF+FKE+ +IHNLPTQ
Sbjct  399  SADMAHGVHPNFMDKHEEHHRPQMQKGLVIKHNANQRYATSGVTSFIFKEIGKIHNLPTQ  458

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREICGKEDIDIAY +FKAFYQ
Sbjct  459  EFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICGKEDIDIAYNYFKAFYQ  518

Query  437  TFSSVDRKLNVD  402
            TFSS+D++L+VD
Sbjct  519  TFSSIDKELDVD  530



>ref|XP_010907134.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Elaeis 
guineensis]
Length=448

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHG+HPNF+DK+EEHHRPELQKGLVIKHN++QRYATS VT+FLFKEVA IHNLP Q
Sbjct  316  SADMAHGLHPNFSDKYEEHHRPELQKGLVIKHNSNQRYATSAVTAFLFKEVANIHNLPVQ  375

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICGKED+DIAYKHF AF+Q
Sbjct  376  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGKEDVDIAYKHFMAFFQ  435

Query  437  TFSSVDRKLNVD  402
            +FS +DRKL+VD
Sbjct  436  SFSDIDRKLSVD  447



>tpg|DAA55692.1| TPA: hypothetical protein ZEAMMB73_277076 [Zea mays]
Length=187

 Score =   243 bits (621),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +KHEE HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q
Sbjct  55   SADMAHALHPNYAEKHEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQ  114

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++
Sbjct  115  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFE  174

Query  437  TFSSVDRKLNVD  402
             FS +DRKLNVD
Sbjct  175  MFSDIDRKLNVD  186



>ref|XP_002311031.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
 gb|EEE88398.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
Length=496

 Score =   253 bits (646),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF +KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKEV +IHNLP+Q
Sbjct  365  SADMAHGVHPNFMEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPSQ  424

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREIC KED+DIAYK+FKAFYQ
Sbjct  425  EFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICAKEDVDIAYKYFKAFYQ  484

Query  437  TFSSVDRKLNVD  402
             FSS+D+KL VD
Sbjct  485  NFSSIDKKLEVD  496



>emb|CDX70207.1| BnaA10g25560D [Brassica napus]
Length=528

 Score =   253 bits (647),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q
Sbjct  396  SADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQ  455

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY+
Sbjct  456  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYR  515

Query  437  TFSSVDRKLNVD  402
            +FSSVDRKL VD
Sbjct  516  SFSSVDRKLTVD  527



>ref|XP_010543610.1| PREDICTED: probable aspartyl aminopeptidase [Tarenaya hassleriana]
Length=533

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHG+HPNF++KHEEHHRP++ KGLVIKHNA+QRYATSG+TS LFKEVA++HNLPTQ
Sbjct  402  SADMAHGIHPNFSEKHEEHHRPQMHKGLVIKHNANQRYATSGITSLLFKEVAKLHNLPTQ  461

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG EDIDIAY+HFKAFY+
Sbjct  462  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTEDIDIAYRHFKAFYE  521

Query  437  TFSSVDRKLNVD  402
            +FS++DRKL VD
Sbjct  522  SFSTIDRKLTVD  533



>emb|CDY44874.1| BnaC09g50740D [Brassica napus]
Length=517

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H LP Q
Sbjct  385  SADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHGLPIQ  444

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY+
Sbjct  445  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYR  504

Query  437  TFSSVDRKLNVD  402
            +FSSVDRKL VD
Sbjct  505  SFSSVDRKLTVD  516



>ref|XP_002311016.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
 gb|EEE88383.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
Length=526

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF +KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKEV +IHNLP+Q
Sbjct  395  SADMAHGVHPNFMEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPSQ  454

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREIC KED+DIAYK+FKAFYQ
Sbjct  455  EFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICAKEDVDIAYKYFKAFYQ  514

Query  437  TFSSVDRKLNVD  402
             FSS+D+KL VD
Sbjct  515  NFSSIDKKLEVD  526



>ref|XP_011032849.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=526

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF +KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKEV +IHNLP+Q
Sbjct  395  SADMAHGVHPNFMEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEVGKIHNLPSQ  454

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMHSVREIC KED+DIAYK+FKAFYQ
Sbjct  455  EFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMHSVREICAKEDVDIAYKYFKAFYQ  514

Query  437  TFSSVDRKLNVD  402
             FSS+D+KL VD
Sbjct  515  NFSSIDKKLEVD  526



>ref|XP_006398926.1| hypothetical protein EUTSA_v10013255mg [Eutrema salsugineum]
 gb|ESQ40379.1| hypothetical protein EUTSA_v10013255mg [Eutrema salsugineum]
Length=523

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP++ KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q
Sbjct  391  SADMAHGVHPNFADKHEENHRPQIHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQ  450

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAYKHFKAFYQ
Sbjct  451  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYKHFKAFYQ  510

Query  437  TFSSVDRKLNVD  402
            +FSSVDRKL VD
Sbjct  511  SFSSVDRKLIVD  522



>gb|EMT26810.1| Aspartyl aminopeptidase [Aegilops tauschii]
Length=332

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q
Sbjct  200  SADMAHALHPNYPDKHEEYHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQ  259

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKEDID  YKHFKAF++
Sbjct  260  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDIDTTYKHFKAFFE  319

Query  437  TFSSVDRKLNVD  402
             FS +D+KLNVD
Sbjct  320  MFSDIDQKLNVD  331



>ref|XP_009122574.1| PREDICTED: probable aspartyl aminopeptidase [Brassica rapa]
Length=527

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP++ KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q
Sbjct  395  SADMAHGVHPNFADKHEENHRPQIHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQ  454

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY+
Sbjct  455  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYR  514

Query  437  TFSSVDRKLNVD  402
            +FSSVDRKL VD
Sbjct  515  SFSSVDRKLTVD  526



>gb|EYU19780.1| hypothetical protein MIMGU_mgv1a004147mg [Erythranthe guttata]
Length=542

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP LQKGLVIKHNA+QRYATSG+TSFLFKEVA++HNLP Q
Sbjct  410  SADMAHGVHPNFIDKHEENHRPLLQKGLVIKHNANQRYATSGITSFLFKEVAKLHNLPIQ  469

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILA+GVGIRTVDCGI QLSMHSVREICGKEDIDIAYKHF AFY+
Sbjct  470  EFVVRNDMGCGSTIGPILAAGVGIRTVDCGIPQLSMHSVREICGKEDIDIAYKHFMAFYR  529

Query  437  TFSSVDRKLNVD  402
            TFSS+D+KL VD
Sbjct  530  TFSSIDKKLRVD  541



>ref|XP_006287486.1| hypothetical protein CARUB_v10000697mg [Capsella rubella]
 gb|EOA20384.1| hypothetical protein CARUB_v10000697mg [Capsella rubella]
Length=529

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSGVTSFLFKEVA++H+LP Q
Sbjct  397  SADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGVTSFLFKEVAKLHDLPIQ  456

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG+GIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY+
Sbjct  457  EFVVRNDMGCGSTIGPILASGIGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYE  516

Query  437  TFSSVDRKLNVD  402
            +FSSVDRKL VD
Sbjct  517  SFSSVDRKLMVD  528



>ref|XP_010907133.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Elaeis 
guineensis]
Length=528

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHG+HPNF+DK+EEHHRPELQKGLVIKHN++QRYATS VT+FLFKEVA IHNLP Q
Sbjct  396  SADMAHGLHPNFSDKYEEHHRPELQKGLVIKHNSNQRYATSAVTAFLFKEVANIHNLPVQ  455

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICGKED+DIAYKHF AF+Q
Sbjct  456  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGKEDVDIAYKHFMAFFQ  515

Query  437  TFSSVDRKLNVD  402
            +FS +DRKL+VD
Sbjct  516  SFSDIDRKLSVD  527



>ref|XP_010490993.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=530

 Score =   251 bits (641),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q
Sbjct  398  SADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQ  457

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICG +DIDIAY+HFKAFYQ
Sbjct  458  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGTDDIDIAYRHFKAFYQ  517

Query  437  TFSSVDRKLNVD  402
            +FSSVDRKL VD
Sbjct  518  SFSSVDRKLVVD  529



>gb|KDP35783.1| hypothetical protein JCGZ_10419 [Jatropha curcas]
Length=526

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPE++KGLVIKHNA+QRYAT+G+T+FLFKEV +I +LPTQ
Sbjct  395  SADMAHGVHPNFMDKHEEHHRPEMKKGLVIKHNANQRYATNGITAFLFKEVGKILSLPTQ  454

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVRE+C KEDIDIAYKHFKAFY+
Sbjct  455  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREVCAKEDIDIAYKHFKAFYE  514

Query  437  TFSSVDRKLNVD  402
             FSS+D+KL VD
Sbjct  515  NFSSIDKKLQVD  526



>ref|XP_003565148.1| PREDICTED: probable aspartyl aminopeptidase [Brachypodium distachyon]
Length=520

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEEHHRPELQ+GLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q
Sbjct  388  SADMAHALHPNYPDKHEEHHRPELQRGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQ  447

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKEDID AYKHFKAF++
Sbjct  448  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDIDTAYKHFKAFFE  507

Query  437  TFSSVDRKLNVD  402
             FS +D+KLNVD
Sbjct  508  MFSDIDQKLNVD  519



>ref|XP_002873165.1| hypothetical protein ARALYDRAFT_487250 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49424.1| hypothetical protein ARALYDRAFT_487250 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q
Sbjct  393  SADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQ  452

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY+
Sbjct  453  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYR  512

Query  437  TFSSVDRKLNVD  402
            +FSSVD+KL VD
Sbjct  513  SFSSVDKKLVVD  524



>ref|XP_006645339.1| PREDICTED: probable aspartyl aminopeptidase-like [Oryza brachyantha]
Length=525

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEEHHRPELQKGLVIKHNA+QRYATS VT+FLFKE+AR+HNLP Q
Sbjct  393  SADMAHALHPNYPDKHEEHHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARLHNLPVQ  452

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  YKHFKAF++
Sbjct  453  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYKHFKAFFE  512

Query  437  TFSSVDRKLNVD  402
             FS +DRKLNVD
Sbjct  513  MFSDIDRKLNVD  524



>dbj|BAC43404.1| putative aspartyl aminopeptidase [Arabidopsis thaliana]
Length=526

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q
Sbjct  394  SADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQ  453

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY+
Sbjct  454  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYR  513

Query  437  TFSSVDRKLNVD  402
            +FSSVD+KL VD
Sbjct  514  SFSSVDKKLVVD  525



>ref|NP_196091.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 emb|CAB86013.1| aspartyl aminopeptidase-like protein [Arabidopsis thaliana]
 dbj|BAB08975.1| aspartyl aminopeptidase [Arabidopsis thaliana]
 gb|AED90774.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q
Sbjct  394  SADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQ  453

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY+
Sbjct  454  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYR  513

Query  437  TFSSVDRKLNVD  402
            +FSSVD+KL VD
Sbjct  514  SFSSVDKKLVVD  525



>ref|NP_001045513.1| Os01g0967900 [Oryza sativa Japonica Group]
 dbj|BAB85315.1| putative aspartyl aminopeptidase [Oryza sativa Japonica Group]
 dbj|BAF07427.1| Os01g0967900 [Oryza sativa Japonica Group]
 gb|EEE56077.1| hypothetical protein OsJ_04900 [Oryza sativa Japonica Group]
Length=525

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEEHHRPELQKGLVIKHNA+QRYATS VT+FLFKE+AR+HNLP Q
Sbjct  394  SADMAHALHPNYPDKHEEHHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARLHNLPVQ  453

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  YKHFKAF++
Sbjct  454  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYKHFKAFFE  513

Query  437  TFSSVDRKLNVD  402
             FS +DRKLNVD
Sbjct  514  MFSDIDRKLNVD  525



>ref|XP_010423546.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=536

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q
Sbjct  404  SADMAHGVHPNFADKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPIQ  463

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICG +DIDIAY+HFKAFY+
Sbjct  464  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGTDDIDIAYRHFKAFYR  523

Query  437  TFSSVDRKLNVD  402
            +FSSVDRKL VD
Sbjct  524  SFSSVDRKLVVD  535



>ref|XP_008788174.1| PREDICTED: probable aspartyl aminopeptidase [Phoenix dactylifera]
Length=533

 Score =   248 bits (634),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHG+HPNF+DK+EEHHRPELQKGLV+KHNA+QRYATS VT+FLFKEVA IHNLP Q
Sbjct  401  SADMAHGLHPNFSDKYEEHHRPELQKGLVVKHNANQRYATSAVTAFLFKEVANIHNLPVQ  460

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+DIAYKHF AF+Q
Sbjct  461  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREVCGKEDVDIAYKHFLAFFQ  520

Query  437  TFSSVDRKLNVD  402
            +FS +D KL+VD
Sbjct  521  SFSDIDGKLSVD  532



>gb|KFK24913.1| hypothetical protein AALP_AA8G041200 [Arabis alpina]
Length=523

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF +KHEE+HRP+L KGLVIKHNA+QRYATSG+TSFLFKEVA++H+LP Q
Sbjct  391  SADMAHGVHPNFAEKHEENHRPQLHKGLVIKHNANQRYATSGITSFLFKEVAKLHDLPVQ  450

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG +DIDIAY+HFKAFY+
Sbjct  451  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGTDDIDIAYRHFKAFYR  510

Query  437  TFSSVDRKLNVD  402
            +FSSVDRKL +D
Sbjct  511  SFSSVDRKLVMD  522



>ref|XP_010452373.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=530

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP+L KGLV+KHNA+QRYATSG+TSFLFKEVA++H+LP Q
Sbjct  398  SADMAHGVHPNFADKHEENHRPQLHKGLVVKHNANQRYATSGITSFLFKEVAKLHDLPIQ  457

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICG  DIDIAY+HFKAFY+
Sbjct  458  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGTNDIDIAYRHFKAFYR  517

Query  437  TFSSVDRKLNVD  402
            +FSSVDRKL VD
Sbjct  518  SFSSVDRKLVVD  529



>dbj|BAJ86698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q
Sbjct  381  SADMAHALHPNYPDKHEEYHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQ  440

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKEDID  YKHFKAF++
Sbjct  441  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDIDTTYKHFKAFFE  500

Query  437  TFSSVDRKLNVD  402
             FS +D+KLNVD
Sbjct  501  MFSDIDQKLNVD  512



>ref|XP_008674488.1| PREDICTED: probable aspartyl aminopeptidase [Zea mays]
Length=433

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +KHEE HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q
Sbjct  301  SADMAHALHPNYAEKHEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQ  360

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++
Sbjct  361  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFE  420

Query  437  TFSSVDRKLNVD  402
             FS +DRKLNVD
Sbjct  421  MFSDIDRKLNVD  432



>ref|XP_002524995.1| Aspartyl aminopeptidase, putative [Ricinus communis]
 gb|EEF37402.1| Aspartyl aminopeptidase, putative [Ricinus communis]
Length=526

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEEHHRPE+QKGLVIKHNA+QRYAT+G+T+FLFKEV  I  LPTQ
Sbjct  395  SADMAHGVHPNFVDKHEEHHRPEMQKGLVIKHNANQRYATNGITAFLFKEVGNILKLPTQ  454

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRT+DCGI QLSMHSVRE+C KED+D AYKHFKAFYQ
Sbjct  455  EFVVRNDMGCGSTIGPILASGVGIRTIDCGIPQLSMHSVREVCAKEDVDTAYKHFKAFYQ  514

Query  437  TFSSVDRKLNVD  402
             FSS+D+KL VD
Sbjct  515  NFSSIDKKLQVD  526



>gb|EEC72239.1| hypothetical protein OsI_05355 [Oryza sativa Indica Group]
Length=493

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEEHHRPELQKGLVIKHNA+QRYATS VT+FLFKE+AR HNLP Q
Sbjct  362  SADMAHALHPNYPDKHEEHHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARHHNLPVQ  421

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++
Sbjct  422  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFE  481

Query  437  TFSSVDRKLNVD  402
             FS +DRKLNVD
Sbjct  482  MFSDIDRKLNVD  493



>ref|XP_004971395.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X2 [Setaria 
italica]
Length=523

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q
Sbjct  391  SADMAHALHPNYPDKHEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQ  450

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHS+RE+CGKED+D  Y+HFKAF++
Sbjct  451  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSIREMCGKEDVDTTYRHFKAFFE  510

Query  437  TFSSVDRKLNVD  402
             FS +DRKLNVD
Sbjct  511  MFSDIDRKLNVD  522



>ref|XP_004971394.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X1 [Setaria 
italica]
Length=525

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q
Sbjct  393  SADMAHALHPNYPDKHEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQ  452

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHS+RE+CGKED+D  Y+HFKAF++
Sbjct  453  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSIREMCGKEDVDTTYRHFKAFFE  512

Query  437  TFSSVDRKLNVD  402
             FS +DRKLNVD
Sbjct  513  MFSDIDRKLNVD  524



>ref|XP_002457006.1| hypothetical protein SORBIDRAFT_03g047100 [Sorghum bicolor]
 gb|EES02126.1| hypothetical protein SORBIDRAFT_03g047100 [Sorghum bicolor]
Length=524

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +KHEE HRPELQKGLVIKHNA+QRYATS VT+FLFKE+ARIHNLP Q
Sbjct  392  SADMAHALHPNYAEKHEECHRPELQKGLVIKHNANQRYATSAVTAFLFKEIARIHNLPVQ  451

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVRE+CGKED+D  Y+HFKAF++
Sbjct  452  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREMCGKEDVDTTYRHFKAFFE  511

Query  437  TFSSVDRKLNVD  402
             FS +DRKLNVD
Sbjct  512  MFSDIDRKLNVD  523



>ref|XP_009390025.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=536

 Score =   244 bits (622),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHG+HPNF DK+EEHHRP LQKG+VIKHNA+QRYATS +T+FLFKEVA +HNLP Q
Sbjct  404  SADMAHGLHPNFPDKYEEHHRPALQKGVVIKHNANQRYATSSLTAFLFKEVANVHNLPVQ  463

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICGK+DIDIAYKHF AF+Q
Sbjct  464  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGKDDIDIAYKHFMAFFQ  523

Query  437  TFSSVDRKLNVD  402
            +FS +D+KL+VD
Sbjct  524  SFSDIDKKLSVD  535



>gb|KHN37829.1| Aspartyl aminopeptidase [Glycine soja]
Length=500

 Score =   242 bits (618),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE HRP+LQ+ LVIKHNA+QRYATSG+T FLFKE  +IHNLPTQ
Sbjct  368  SADMAHGVHPNFMDKHEELHRPKLQRVLVIKHNANQRYATSGITPFLFKEAGKIHNLPTQ  427

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F VRN MGCGSTIGPILASGVGIRTVDCGIAQLSMHS+REIC KEDIDIAYKHFKAFYQ
Sbjct  428  EFAVRNGMGCGSTIGPILASGVGIRTVDCGIAQLSMHSIREICAKEDIDIAYKHFKAFYQ  487

Query  437  TFSSVDRKLNVD  402
            +FSSVD+ L VD
Sbjct  488  SFSSVDKMLTVD  499



>gb|EPS58587.1| aspartyl aminopeptidase, partial [Genlisea aurea]
Length=468

 Score =   236 bits (603),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF+DKH+E+HRP LQKGLVIKHNA+QRYATSGVT FL KEVAR H+LP Q
Sbjct  336  SADMAHGVHPNFSDKHDENHRPVLQKGLVIKHNANQRYATSGVTGFLLKEVARSHDLPVQ  395

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG+GIRTVDCGI QLSMHSVREICGKED++ AY+ FKAFY+
Sbjct  396  EFVVRNDMGCGSTIGPILASGMGIRTVDCGIPQLSMHSVREICGKEDVESAYRLFKAFYR  455

Query  437  TFSSVDRKLNVD  402
            TFS +D KL VD
Sbjct  456  TFSGIDEKLTVD  467



>ref|XP_006851486.1| hypothetical protein AMTR_s00040p00143220 [Amborella trichopoda]
 gb|ERN13067.1| hypothetical protein AMTR_s00040p00143220 [Amborella trichopoda]
Length=546

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHG+HPNF +KHE+ HRP LQKG+VIKHNA+QRYAT+ VT+FLFKE+A   NLPTQ
Sbjct  413  SADMAHGIHPNFPEKHEDQHRPVLQKGIVIKHNANQRYATNSVTAFLFKEIASACNLPTQ  472

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGI QLSMHSVREICG+ED+D AYKHFKAF++
Sbjct  473  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIPQLSMHSVREICGREDVDTAYKHFKAFFE  532

Query  437  TFSSVDRKLNVD  402
             FSS+D+KL +D
Sbjct  533  MFSSIDKKLCID  544



>ref|XP_002975004.1| hypothetical protein SELMODRAFT_442726 [Selaginella moellendorffii]
 gb|EFJ23789.1| hypothetical protein SELMODRAFT_442726 [Selaginella moellendorffii]
Length=477

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+++KHEE+H+P+L +GLVIKHNA+QRYAT+ VT+FLFKEVAR+  + TQ
Sbjct  345  SADMAHALHPNYSEKHEENHQPKLHEGLVIKHNANQRYATNSVTAFLFKEVARLAGIQTQ  404

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F+VRNDMGCGSTIGPILASG+GIRTVDCG+ QLSMHS+RE+CG +DID AYKHFKAFY+
Sbjct  405  NFIVRNDMGCGSTIGPILASGIGIRTVDCGMPQLSMHSIREMCGTQDIDTAYKHFKAFYR  464

Query  437  TFSSVDRKLNVD  402
            TF+S+D++++VD
Sbjct  465  TFTSIDQQVSVD  476



>ref|XP_002977420.1| hypothetical protein SELMODRAFT_176342 [Selaginella moellendorffii]
 gb|EFJ21424.1| hypothetical protein SELMODRAFT_176342 [Selaginella moellendorffii]
Length=445

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+++KHEE+H+P+L +GLVIKHNA+QRYAT+ V++FLFKEVAR+  + TQ
Sbjct  313  SADMAHALHPNYSEKHEENHQPKLHEGLVIKHNANQRYATNSVSAFLFKEVARLAGIQTQ  372

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F+VRNDMGCGSTIGPILASG+GIRTVDCG+ QLSMHS+RE+CG +DID AYKHFKAFY+
Sbjct  373  NFIVRNDMGCGSTIGPILASGIGIRTVDCGMPQLSMHSIREMCGTQDIDTAYKHFKAFYR  432

Query  437  TFSSVDRKLNVD  402
            TF+S+D++++VD
Sbjct  433  TFTSIDQQVSVD  444



>ref|XP_001420830.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99123.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=465

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P++ KG+V+KHNA+QRYAT+ VTS+LF+E A++ N+PTQ
Sbjct  333  SADMAHALHPNYMDKHEDNHQPKMHKGMVVKHNANQRYATTAVTSYLFRECAKMENVPTQ  392

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPI+A+GVGIRTVD GI QLSMHSVRE+CG EDIDI +KHF AFY+
Sbjct  393  DFVVRNDMGCGSTIGPIIAAGVGIRTVDVGIPQLSMHSVREMCGTEDIDICFKHFTAFYK  452

Query  437  TFSSVDRKLNVD  402
             FS VD  + VD
Sbjct  453  NFSKVDETVTVD  464



>gb|ABR25597.1| aspartyl aminopeptidase [Oryza sativa Indica Group]
Length=149

 Score =   206 bits (524),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H+LP Q
Sbjct  17   SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHHLPIQ  76

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++
Sbjct  77   DFVVRNDMGCGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDIKHSYEHFKAYFE  136

Query  437  TFSSVDRKLNVDC  399
             F+ +D K+ VDC
Sbjct  137  EFTELDSKVKVDC  149



>ref|XP_001751765.1| predicted protein [Physcomitrella patens]
 gb|EDQ83200.1| predicted protein, partial [Physcomitrella patens]
Length=471

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ D+HEE+H+P+L +GLVIK+NA+QRYAT+ VT+FLFKEVA++  +PTQ
Sbjct  340  SADMAHALHPNYADRHEENHQPKLHEGLVIKYNANQRYATNTVTAFLFKEVAKVAGVPTQ  399

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPILASG+GIRTVD G+ QLSMHSVRE+CG ED+D++Y+HFKAFY+
Sbjct  400  NFVVRNDMGCGSTIGPILASGIGIRTVDVGMPQLSMHSVREMCGTEDVDLSYRHFKAFYE  459

Query  437  TFSSVDRKLNVD  402
             F+++D KL VD
Sbjct  460  LFTTID-KLTVD  470



>ref|XP_008360788.1| PREDICTED: probable aspartyl aminopeptidase, partial [Malus domestica]
Length=206

 Score =   205 bits (521),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+ +F+E+AR H+LP Q
Sbjct  74   SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQ  133

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  134  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  193

Query  437  TFSSVDRKLNVDC  399
             F+ +D K+ VD 
Sbjct  194  EFTHLDAKIKVDA  206



>ref|XP_011024060.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=489

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P L  GLVIKHNA+QRYAT+ +TSFLF+E+A  HNLPTQ
Sbjct  357  SADMAHALHPNYMDKHEENHQPRLHGGLVIKHNANQRYATNAITSFLFREIATKHNLPTQ  416

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  417  DFVVRNDMGCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQ  476

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  477  DFSHLDAKITVD  488



>ref|XP_003082377.1| aspartyl aminopeptidase (ISS) [Ostreococcus tauri]
Length=486

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P++ KG+V+KHNA+QRYAT+ VT +LF+E A++ N+PTQ
Sbjct  355  SADMAHALHPNYMDKHEENHQPKMHKGMVVKHNANQRYATTAVTGYLFRECAKMENVPTQ  414

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPI+A+GVGIRTVD GI QLSMHSVRE+CG EDIDI  +HF AFY 
Sbjct  415  DFVVRNDMGCGSTIGPIVAAGVGIRTVDVGIPQLSMHSVREMCGVEDIDICLRHFTAFYD  474

Query  437  TFSSVDRKLNVD  402
             F+ VD  + VD
Sbjct  475  NFAKVDSTVTVD  486



>dbj|BAK02635.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=185

 Score =   202 bits (514),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +KHEE+H+P+L  GLVIKHNA+QRYAT+ +T+F+F+E+A  H LP Q
Sbjct  53   SADMAHALHPNYMEKHEENHQPKLHGGLVIKHNANQRYATNAMTAFIFREIAERHQLPIQ  112

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++
Sbjct  113  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDISHSYEHFKAYFE  172

Query  437  TFSSVDRKLNVDC  399
             F+ +D K+ VDC
Sbjct  173  EFTELDNKVKVDC  185



>emb|CEF99925.1| Peptidase M18 [Ostreococcus tauri]
Length=549

 Score =   212 bits (540),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P++ KG+V+KHNA+QRYAT+ VT +LF+E A++ N+PTQ
Sbjct  418  SADMAHALHPNYMDKHEENHQPKMHKGMVVKHNANQRYATTAVTGYLFRECAKMENVPTQ  477

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPI+A+GVGIRTVD GI QLSMHSVRE+CG EDIDI  +HF AFY 
Sbjct  478  DFVVRNDMGCGSTIGPIVAAGVGIRTVDVGIPQLSMHSVREMCGVEDIDICLRHFTAFYD  537

Query  437  TFSSVDRKLNVD  402
             F+ VD  + VD
Sbjct  538  NFAKVDSTVTVD  549



>ref|XP_008464464.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Cucumis 
melo]
Length=482

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIK+NA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  350  SADMAHALHPNYMDKHEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQ  409

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+
Sbjct  410  DFVVRNDMGCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCATDDVNHSYEHFKAYYE  469

Query  437  TFSSVDRKLNVD  402
             FSS+D KL VD
Sbjct  470  EFSSLDEKLTVD  481



>ref|XP_011044185.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=486

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTSFLF+E+A  HNLPTQ
Sbjct  354  SADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSFLFREIATKHNLPTQ  413

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  414  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  473

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  474  EFSDLDAKITVD  485



>ref|XP_002318119.2| aspartyl aminopeptidase family protein [Populus trichocarpa]
 gb|EEE96339.2| aspartyl aminopeptidase family protein [Populus trichocarpa]
Length=486

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTSFLF+E+A  HNLPTQ
Sbjct  354  SADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSFLFREIATKHNLPTQ  413

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  414  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  473

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  474  EFSDLDAKITVD  485



>ref|XP_004138058.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=485

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIK+NA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  353  SADMAHALHPNYMDKHEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQ  412

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+
Sbjct  413  DFVVRNDMSCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCATDDVNYSYEHFKAYYE  472

Query  437  TFSSVDRKLNVD  402
             FSS+D+KL VD
Sbjct  473  EFSSLDQKLTVD  484



>ref|XP_004165826.1| PREDICTED: LOW QUALITY PROTEIN: probable aspartyl aminopeptidase-like 
[Cucumis sativus]
Length=485

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIK+NA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  353  SADMAHALHPNYMDKHEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQ  412

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+
Sbjct  413  DFVVRNDMSCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCATDDVNYSYEHFKAYYE  472

Query  437  TFSSVDRKLNVD  402
             FSS+D+KL VD
Sbjct  473  EFSSLDQKLTVD  484



>gb|KGN63496.1| hypothetical protein Csa_1G002160 [Cucumis sativus]
Length=512

 Score =   209 bits (533),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIK+NA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  380  SADMAHALHPNYMDKHEENHQPKLHGGLVIKNNANQRYATNAVTSFIFRELAVNHNLPVQ  439

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA+Y+
Sbjct  440  DFVVRNDMSCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCATDDVNYSYEHFKAYYE  499

Query  437  TFSSVDRKLNVD  402
             FSS+D+KL VD
Sbjct  500  EFSSLDQKLTVD  511



>ref|XP_002321687.1| aspartyl aminopeptidase family protein [Populus trichocarpa]
 gb|EEF05814.1| aspartyl aminopeptidase family protein [Populus trichocarpa]
Length=489

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ +TSFLF+E+A  H+LPTQ
Sbjct  357  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAITSFLFREIATKHDLPTQ  416

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  417  DFVVRNDMGCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCSVDDVKYSYEHFKAFFQ  476

Query  437  TFSSVDRKLNVD  402
              S +D K+ VD
Sbjct  477  DISHLDAKITVD  488



>gb|KFK26680.1| hypothetical protein AALP_AA8G278900 [Arabis alpina]
Length=477

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  345  SADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQ  404

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  405  DFVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQ  464

Query  437  TFSSVDRKLNVD  402
             F+ +D KL+VD
Sbjct  465  EFTVLDTKLSVD  476



>ref|XP_008239439.1| PREDICTED: probable aspartyl aminopeptidase [Prunus mume]
Length=490

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTS +F+E+AR HNLP Q
Sbjct  358  SADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSLIFREIARNHNLPVQ  417

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  418  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQ  477

Query  437  TFSSVDRKLNVDC  399
             FS +D K+ VD 
Sbjct  478  EFSHLDEKIKVDA  490



>ref|XP_002511215.1| Aspartyl aminopeptidase, putative [Ricinus communis]
 gb|EEF51817.1| Aspartyl aminopeptidase, putative [Ricinus communis]
Length=441

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P +  GLVIKHNA+QRYAT+ VTSFLFKE+A  HNLP Q
Sbjct  309  SADMAHALHPNYADKHEENHQPRMHGGLVIKHNANQRYATNSVTSFLFKEIASKHNLPVQ  368

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++
Sbjct  369  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFE  428

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  429  DFSHLDSKITVD  440



>ref|XP_009134060.1| PREDICTED: probable aspartyl aminopeptidase [Brassica rapa]
Length=478

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  346  SADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQ  405

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  406  DFVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQ  465

Query  437  TFSSVDRKLNVD  402
             F+ +D KL VD
Sbjct  466  EFTHLDAKLTVD  477



>emb|CDY34036.1| BnaC03g27790D [Brassica napus]
Length=478

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  346  SADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQ  405

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  406  DFVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQ  465

Query  437  TFSSVDRKLNVD  402
             F+ +D KL VD
Sbjct  466  EFTHLDAKLTVD  477



>ref|XP_002963681.1| hypothetical protein SELMODRAFT_80579 [Selaginella moellendorffii]
 gb|EFJ35552.1| hypothetical protein SELMODRAFT_80579 [Selaginella moellendorffii]
Length=475

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P++ KGLV+K+NA+QRYAT+ VTSF+FKE+AR  +LPTQ
Sbjct  344  SADMAHCLHPNYMDKHEENHQPKMHKGLVVKYNANQRYATNAVTSFIFKEIARRQDLPTQ  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+CG +D+  +Y+HFK F++
Sbjct  404  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCGVDDVGYSYRHFKLFFE  463

Query  437  TFSSVDRKLNVD  402
             FS++D+ +NVD
Sbjct  464  DFSALDQHVNVD  475



>emb|CDX83160.1| BnaA03g23460D [Brassica napus]
Length=478

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  346  SADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQ  405

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  406  DFVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQ  465

Query  437  TFSSVDRKLNVD  402
             F+ +D KL VD
Sbjct  466  EFTHLDAKLTVD  477



>ref|NP_200824.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 dbj|BAA97497.1| aspartyl aminopeptidase [Arabidopsis thaliana]
 gb|AAK73942.1| AT5g60160/f15l12_20 [Arabidopsis thaliana]
 gb|AAM91365.1| At5g60160/f15l12_20 [Arabidopsis thaliana]
 gb|AED97287.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=477

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  345  SADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQ  404

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  405  DFVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQ  464

Query  437  TFSSVDRKLNVD  402
             F+ +D KL +D
Sbjct  465  EFTHLDAKLTID  476



>gb|AAM61631.1| aspartyl aminopeptidase-like protein [Arabidopsis thaliana]
Length=477

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  345  SADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQ  404

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  405  DFVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFQ  464

Query  437  TFSSVDRKLNVD  402
             F+ +D KL +D
Sbjct  465  EFTHLDAKLTID  476



>ref|NP_001066463.1| Os12g0236500 [Oryza sativa Japonica Group]
 gb|ABA96906.1| Aspartyl aminopeptidase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29482.1| Os12g0236500 [Oryza sativa Japonica Group]
 gb|EAY82691.1| hypothetical protein OsI_37907 [Oryza sativa Indica Group]
 gb|EAZ20072.1| hypothetical protein OsJ_35672 [Oryza sativa Japonica Group]
Length=478

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H+LP Q
Sbjct  346  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHHLPIQ  405

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++
Sbjct  406  DFVVRNDMGCGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDIKHSYEHFKAYFE  465

Query  437  TFSSVDRKLNVDC  399
             F+ +D K+ VDC
Sbjct  466  EFTELDSKVKVDC  478



>ref|XP_002866374.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42633.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  345  SADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAEKHNLPVQ  404

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q
Sbjct  405  DFVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQ  464

Query  437  TFSSVDRKLNVD  402
             F+ +D KL VD
Sbjct  465  EFTHLDAKLTVD  476



>ref|XP_010536640.1| PREDICTED: probable aspartyl aminopeptidase [Tarenaya hassleriana]
Length=489

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P++  GLVIK NA+QRYAT+ VTSF+FKE+A  HNLP Q
Sbjct  357  SADMAHALHPNYMDKHEENHQPKMHGGLVIKTNANQRYATNAVTSFIFKEIAEKHNLPVQ  416

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  417  DFVVRNDMGCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQ  476

Query  437  TFSSVDRKLNVD  402
             F+ +D KL +D
Sbjct  477  EFAHLDSKLTID  488



>ref|XP_002974770.1| hypothetical protein SELMODRAFT_101663 [Selaginella moellendorffii]
 gb|EFJ24290.1| hypothetical protein SELMODRAFT_101663 [Selaginella moellendorffii]
Length=498

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P++ KGLV+K+NA+QRYAT+ VTSF+FKE+AR  +LPTQ
Sbjct  367  SADMAHCLHPNYMDKHEENHQPKMHKGLVVKYNANQRYATNAVTSFIFKEIARRQDLPTQ  426

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+CG +D+  +Y+HFK F++
Sbjct  427  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCGVDDVGYSYRHFKLFFE  486

Query  437  TFSSVDRKLNVD  402
             FS++D+ +NVD
Sbjct  487  DFSALDQHVNVD  498



>sp|B9RAJ0.2|DNPEP_RICCO RecName: Full=Probable aspartyl aminopeptidase [Ricinus communis]
Length=491

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P +  GLVIKHNA+QRYAT+ VTSFLFKE+A  HNLP Q
Sbjct  359  SADMAHALHPNYADKHEENHQPRMHGGLVIKHNANQRYATNSVTSFLFKEIASKHNLPVQ  418

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++
Sbjct  419  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFE  478

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  479  DFSHLDSKITVD  490



>tpg|DAA58400.1| TPA: hypothetical protein ZEAMMB73_107325 [Zea mays]
Length=321

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP Q
Sbjct  189  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPIQ  248

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++
Sbjct  249  DFVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAADDISYSYEHFKAYFE  308

Query  437  TFSSVDRKLNVD  402
             F+ +D K+ VD
Sbjct  309  EFTELDGKVKVD  320



>ref|XP_007209960.1| hypothetical protein PRUPE_ppa004869mg [Prunus persica]
 gb|EMJ11159.1| hypothetical protein PRUPE_ppa004869mg [Prunus persica]
Length=488

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTS +F+E+AR HNLP Q
Sbjct  356  SADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSLIFREIARNHNLPVQ  415

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DF VRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  416  DFAVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVQYSYEHFKAFFQ  475

Query  437  TFSSVDRKLNVDC  399
             FS +D K+ VD 
Sbjct  476  EFSHLDEKIKVDA  488



>ref|XP_006664453.1| PREDICTED: probable aspartyl aminopeptidase-like [Oryza brachyantha]
Length=474

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H+LP Q
Sbjct  342  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAENHHLPVQ  401

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKA+++
Sbjct  402  DFVVRNDMGCGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDVSHSYEHFKAYFE  461

Query  437  TFSSVDRKLNVDC  399
             F+ +D K+ VDC
Sbjct  462  EFTELDSKVRVDC  474



>gb|AFK46082.1| unknown [Lotus japonicus]
Length=479

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIK+NA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  347  SADMAHALHPNYMDKHEENHQPKLHAGLVIKNNANQRYATNAVTSFIFREIASKHNLPVQ  406

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASG+GIRTVD G  QLSMHS+RE+C  +D++ +YKHFKAF+Q
Sbjct  407  DFVVRNDMACGSTIGPILASGMGIRTVDVGAPQLSMHSIREMCAIDDVNYSYKHFKAFFQ  466

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  467  EFSHLDAKIVVD  478



>ref|XP_006476998.1| PREDICTED: probable aspartyl aminopeptidase-like [Citrus sinensis]
Length=483

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTSF+F+EVA  HNLP Q
Sbjct  351  SADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSFVFREVASKHNLPVQ  410

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  411  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  470

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  471  EFSELDAKIKVD  482



>ref|XP_007037930.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao]
 gb|EOY22431.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao]
Length=520

 Score =   206 bits (524),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  388  SADMAHAVHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMQHNLPVQ  447

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  448  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  507

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  508  EFSHLDTKITVD  519



>ref|XP_006402123.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum]
 gb|ESQ43576.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum]
Length=465

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  333  SADMAHALHPNFMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAVKHNLPVQ  392

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++
Sbjct  393  DFVVRNDMGCGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYEHFKAFFR  452

Query  437  TFSSVDRKLNVD  402
             F+ +D KL VD
Sbjct  453  EFTHLDAKLAVD  464



>ref|XP_006440072.1| hypothetical protein CICLE_v10019750mg [Citrus clementina]
 gb|ESR53312.1| hypothetical protein CICLE_v10019750mg [Citrus clementina]
Length=515

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTSF+F+EVA  HNLP Q
Sbjct  383  SADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSFVFREVASKHNLPVQ  442

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  443  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  502

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  503  EFSELDAKIKVD  514



>gb|EYU43065.1| hypothetical protein MIMGU_mgv1a005789mg [Erythranthe guttata]
Length=470

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSFLF+E+A  HNLP Q
Sbjct  338  SADMAHALHPNYMDKHEENHQPKMHGGLVIKHNANQRYATNAVTSFLFREIAAKHNLPVQ  397

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVR+DM CGSTIGPI+ASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  398  DFVVRSDMLCGSTIGPIIASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  457

Query  437  TFSSVDRKLNVD  402
             FS++D KL VD
Sbjct  458  EFSNLDAKLTVD  469



>gb|KHF99832.1| Aspartyl aminopeptidase [Gossypium arboreum]
Length=463

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTS +F+E+A  HNLP Q
Sbjct  331  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSLIFREIAMKHNLPIQ  390

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRT+D G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  391  DFVVRNDMPCGSTIGPILASGVGIRTIDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  450

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  451  EFSQLDAKITVD  462



>ref|XP_010674696.1| PREDICTED: probable aspartyl aminopeptidase [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+FKE+A  HNLP Q
Sbjct  355  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFKEIALKHNLPVQ  414

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAFY 
Sbjct  415  EFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVMHSYMHFKAFYM  474

Query  437  TFSSVDRKLNVDC  399
             FS +D KL VD 
Sbjct  475  EFSDLDSKLTVDA  487



>ref|XP_002458215.1| hypothetical protein SORBIDRAFT_03g029130 [Sorghum bicolor]
 gb|EES03335.1| hypothetical protein SORBIDRAFT_03g029130 [Sorghum bicolor]
Length=475

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP Q
Sbjct  343  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPVQ  402

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  AY+HFKA+Y+
Sbjct  403  DFVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDISHAYEHFKAYYE  462

Query  437  TFSSVDRKLNVD  402
             F+ +D K+ VD
Sbjct  463  EFTELDSKVKVD  474



>ref|XP_011083884.1| PREDICTED: probable aspartyl aminopeptidase [Sesamum indicum]
Length=480

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P++  GLVIKHNA+QRYAT+ VTSFLF+E+A  H LP Q
Sbjct  348  SADMAHALHPNYMDKHEENHQPKMHSGLVIKHNANQRYATNAVTSFLFREIAAKHKLPVQ  407

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFV+RNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  408  DFVIRNDMLCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYQHFKAFFQ  467

Query  437  TFSSVDRKLNVD  402
             FS +D KL VD
Sbjct  468  EFSHLDAKLAVD  479



>ref|XP_006280394.1| hypothetical protein CARUB_v10026321mg [Capsella rubella]
 gb|EOA13292.1| hypothetical protein CARUB_v10026321mg [Capsella rubella]
Length=478

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKH+E+H+P++  GLVIKHNA+QRYAT+ +TSF+F+E+A  HNLP Q
Sbjct  346  SADMAHALHPNFMDKHDENHQPKMHGGLVIKHNANQRYATNALTSFVFREIAEKHNLPVQ  405

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKAF+Q
Sbjct  406  DFVVRNDMACGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVEHSYEHFKAFFQ  465

Query  437  TFSSVDRKLNVD  402
             F+ +D KL VD
Sbjct  466  EFTHLDAKLTVD  477



>ref|XP_003578741.1| PREDICTED: probable aspartyl aminopeptidase [Brachypodium distachyon]
Length=475

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP Q
Sbjct  344  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAEKHQLPIQ  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  AY+HFKA+++
Sbjct  404  DFVVRNDMGCGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCATDDVKHAYEHFKAYFE  463

Query  437  TFSSVDRKLNVD  402
             F+ +D K+ +D
Sbjct  464  EFTELDSKIIID  475



>ref|NP_001159225.1| hypothetical protein [Zea mays]
 gb|ACN25500.1| unknown [Zea mays]
 tpg|DAA58399.1| TPA: hypothetical protein ZEAMMB73_107325 [Zea mays]
Length=407

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP Q
Sbjct  275  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPIQ  334

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++
Sbjct  335  DFVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAADDISYSYEHFKAYFE  394

Query  437  TFSSVDRKLNVD  402
             F+ +D K+ VD
Sbjct  395  EFTELDGKVKVD  406



>ref|XP_009346502.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VT+ +F+E+AR H+LP Q
Sbjct  354  SADMAHALHPNYMDKHEQNHQPKLHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQ  413

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  414  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQ  473

Query  437  TFSSVDRKLNVDC  399
             F+ +D K+ VD 
Sbjct  474  EFTHLDAKIKVDA  486



>ref|XP_009336570.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ +T+ +F+E+AR H+LP Q
Sbjct  354  SADMAHALHPNYMDKHEQNHQPKLHGGLVIKHNANQRYATNAITALIFREIARNHSLPVQ  413

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  414  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQ  473

Query  437  TFSSVDRKLNVDC  399
             F+ +D K+ VD 
Sbjct  474  EFTHLDAKIKVDA  486



>ref|XP_006826610.1| hypothetical protein AMTR_s00138p00074300 [Amborella trichopoda]
 gb|ERM93847.1| hypothetical protein AMTR_s00138p00074300 [Amborella trichopoda]
Length=344

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P L  GLVIKHNA+QRYA++ VTSF+F+E+A+ H LP Q
Sbjct  212  SADMAHALHPNYMDKHEENHQPRLHGGLVIKHNANQRYASNSVTSFIFREIAKQHKLPVQ  271

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+ 
Sbjct  272  EFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCSVDDVKHSYEHFKAFFH  331

Query  437  TFSSVDRKLNVD  402
             F+ +D K++VD
Sbjct  332  EFAQLDAKISVD  343



>ref|XP_008374264.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VT+ +F+E+AR H+LP Q
Sbjct  354  SADMAHALHPNYMDKHEQNHQPKLHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQ  413

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  414  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  473

Query  437  TFSSVDRKLNVDC  399
             F+ +D K+ VD 
Sbjct  474  EFTRLDSKIKVDA  486



>ref|XP_010456062.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=475

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKH+E+H+P++  GLVIKHNA+QRYAT+ +TSF+F+E+A  HNLP Q
Sbjct  343  SADMAHALHPNFMDKHDENHQPKMHGGLVIKHNANQRYATNALTSFIFREIAEKHNLPVQ  402

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q
Sbjct  403  DFVVRNDMACGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQ  462

Query  437  TFSSVDRKLNVD  402
             F+ +D KL VD
Sbjct  463  EFTHLDAKLTVD  474



>ref|XP_009359462.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ +T+ +F+E+AR H+LP Q
Sbjct  354  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAITALIFREIARNHSLPVQ  413

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  414  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVRHSYEHFKAFFQ  473

Query  437  TFSSVDRKLNVDC  399
             F+ +D K+ VD 
Sbjct  474  EFTHLDAKIKVDA  486



>ref|XP_010483659.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=478

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKH+E+H+P++  GLVIKHNA+QRYAT+ +TSF+F+E+A  HNLP Q
Sbjct  346  SADMAHALHPNFMDKHDENHQPKMHGGLVIKHNANQRYATNALTSFVFREIAEKHNLPVQ  405

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q
Sbjct  406  DFVVRNDMACGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQ  465

Query  437  TFSSVDRKLNVD  402
             F+ +D KL VD
Sbjct  466  EFTHLDAKLTVD  477



>ref|XP_010443807.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=478

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKH+E+H+P++  GLVIKHNA+QRYAT+ +TSF+F+E+A  HNLP Q
Sbjct  346  SADMAHALHPNFMDKHDENHQPKMHGGLVIKHNANQRYATNALTSFVFREIAEKHNLPVQ  405

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILAS VGIRTVD G  QLSMHS+RE+C  +D+  +Y HFKAF+Q
Sbjct  406  DFVVRNDMACGSTIGPILASSVGIRTVDVGAPQLSMHSIREMCAADDVKHSYDHFKAFFQ  465

Query  437  TFSSVDRKLNVD  402
             F+ +D KL VD
Sbjct  466  EFTHLDAKLTVD  477



>ref|XP_008673044.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN26704.1| unknown [Zea mays]
 gb|ACN27911.1| unknown [Zea mays]
 tpg|DAA58398.1| TPA: hypothetical protein ZEAMMB73_107325 [Zea mays]
Length=475

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP Q
Sbjct  343  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPIQ  402

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++
Sbjct  403  DFVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAADDISYSYEHFKAYFE  462

Query  437  TFSSVDRKLNVD  402
             F+ +D K+ VD
Sbjct  463  EFTELDGKVKVD  474



>ref|XP_003526970.1| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=487

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE +H+P+L  GLVIK NASQRYAT+ VTSF+F+E+A  H LP Q
Sbjct  355  SADMAHALHPNYMDKHEANHQPKLHGGLVIKTNASQRYATNVVTSFIFREIASKHKLPVQ  414

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+REIC  +D+  +Y+HFKAFYQ
Sbjct  415  DFVVRNDMSCGSTIGPILASGVGIRTVDVGAPQLSMHSIREICAVDDVKYSYEHFKAFYQ  474

Query  437  TFSSVDRKLNVD  402
             FS VD K+ VD
Sbjct  475  EFSHVDGKMVVD  486



>ref|XP_007137936.1| hypothetical protein PHAVU_009G167900g [Phaseolus vulgaris]
 gb|ESW09930.1| hypothetical protein PHAVU_009G167900g [Phaseolus vulgaris]
Length=481

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +KHE +H+P+L  GLVIK+NA+QRYAT+ VTSFLF+E+A  HNLP Q
Sbjct  349  SADMAHALHPNYMEKHEANHQPKLHGGLVIKNNANQRYATNIVTSFLFREIASKHNLPVQ  408

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAFYQ
Sbjct  409  DFVVRNDMSCGSTIGPILASGVGIRTVDVGAPQLSMHSIREVCAVDDVKYSYEHFKAFYQ  468

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  469  EFSHLDGKMVVD  480



>ref|XP_004500663.1| PREDICTED: probable aspartyl aminopeptidase-like [Cicer arietinum]
Length=482

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIK NA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  350  SADMAHALHPNYMDKHEENHQPKLHGGLVIKQNANQRYATNAVTSFIFREIASKHNLPVQ  409

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRND  CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  410  DFVVRNDTACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQ  469

Query  437  TFSSVDRKLNVD  402
             FS +D  L VD
Sbjct  470  EFSHLDANLVVD  481



>ref|XP_008392833.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ VT+ +F+E+AR H+LP Q
Sbjct  354  SADMAHALHPNYMDKHEENHQPKXHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQ  413

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  414  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  473

Query  437  TFSSVDRKLNVDC  399
             F+ +D K+ VD 
Sbjct  474  EFTHLDAKIKVDA  486



>ref|XP_004960722.1| PREDICTED: probable aspartyl aminopeptidase-like [Setaria italica]
Length=475

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A  H LP Q
Sbjct  343  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAERHQLPVQ  402

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +DI  +Y+HFKA+++
Sbjct  403  DFVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDDISHSYEHFKAYFE  462

Query  437  TFSSVDRKLNVD  402
             F+ +D K+ VD
Sbjct  463  EFTELDSKVKVD  474



>ref|XP_008367478.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ VT+ +F+E+AR H+LP Q
Sbjct  354  SADMAHALHPNYMDKHEENHQPKXHGGLVIKHNANQRYATNAVTALIFREIARNHSLPVQ  413

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  414  DFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  473

Query  437  TFSSVDRKLNVDC  399
             F+ +D K+ VD 
Sbjct  474  EFTHLDAKIKVDA  486



>ref|XP_010102886.1| Aspartyl aminopeptidase [Morus notabilis]
 gb|EXB94323.1| Aspartyl aminopeptidase [Morus notabilis]
Length=507

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIK NA+QRYAT+ VTSFLF+E+A  H +PTQ
Sbjct  376  SADMAHALHPNYMDKHEENHQPKLHGGLVIKSNANQRYATNSVTSFLFREIASKHKIPTQ  435

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  AY+HFKA++Q
Sbjct  436  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVRHAYQHFKAYFQ  495

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  496  EFSHLDSKIIVD  507



>ref|XP_009379936.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=476

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A +HNLP Q
Sbjct  344  SADMAHALHPNFMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAEMHNLPFQ  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D   +Y+HFKA++ 
Sbjct  404  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSYEHFKAYFN  463

Query  437  TFSSVDRKLNVD  402
             F+ +++KL VD
Sbjct  464  EFTKLEKKLVVD  475



>ref|XP_010026684.1| PREDICTED: probable aspartyl aminopeptidase [Eucalyptus grandis]
 gb|KCW83183.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=473

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +KHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A+ H+LP Q
Sbjct  341  SADMAHALHPNYMEKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAQKHDLPIQ  400

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA++Q
Sbjct  401  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVNHSYEHFKAYFQ  460

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  461  EFSYLDAKIAVD  472



>ref|XP_001756754.1| predicted protein [Physcomitrella patens]
 gb|EDQ78351.1| predicted protein [Physcomitrella patens]
Length=467

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +KHEE+H+P++ +GLVIK NA+QRYAT+ +TSF+F+E+A++ NLPTQ
Sbjct  334  SADMAHCLHPNYPEKHEENHQPKMHRGLVIKDNANQRYATNAITSFIFREIAKLRNLPTQ  393

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND+ CGSTIGPILASG+GIRTVD G  QLSMHS+RE+CG +D+  +Y HFKAF++
Sbjct  394  NFVVRNDVACGSTIGPILASGIGIRTVDVGAPQLSMHSIREMCGVDDVGYSYNHFKAFFE  453

Query  437  TFSSVDRKLNVD  402
             FS++D +L VD
Sbjct  454  DFSALDAQLAVD  465



>ref|XP_009404266.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=476

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPNF DKHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+F+E+A +HNLP Q
Sbjct  344  SADMAHALHPNFMDKHEENHQPKLHGGLVIKHNANQRYATNAVTAFIFREIAEMHNLPIQ  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRND+ CGS+IGPILASGVGIRTVD G  QLSMHS+RE+C  +D   +Y+H KA++ 
Sbjct  404  DFVVRNDIPCGSSIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSYEHLKAYFD  463

Query  437  TFSSVDRKLNVDC  399
             F+ +D KL VDC
Sbjct  464  EFTELDNKLIVDC  476



>gb|KJB27157.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=464

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  332  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMKHNLPIQ  391

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRND  CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++
Sbjct  392  DFVVRNDTPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFK  451

Query  437  TFSSVDRKLNVD  402
             FS +D K+  D
Sbjct  452  EFSQLDTKITGD  463



>gb|KJB27156.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=461

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  329  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMKHNLPIQ  388

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRND  CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++
Sbjct  389  DFVVRNDTPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFK  448

Query  437  TFSSVDRKLNVD  402
             FS +D K+  D
Sbjct  449  EFSQLDTKITGD  460



>gb|KJB27155.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=463

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  331  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAMKHNLPIQ  390

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRND  CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++
Sbjct  391  DFVVRNDTPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFK  450

Query  437  TFSSVDRKLNVD  402
             FS +D K+  D
Sbjct  451  EFSQLDTKITGD  462



>gb|KCW83184.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=508

 Score =   201 bits (510),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +KHEE+H+P++  GLVIKHNA+QRYAT+ VTSF+F+E+A+ H+LP Q
Sbjct  376  SADMAHALHPNYMEKHEENHQPKMHGGLVIKHNANQRYATNAVTSFVFREIAQKHDLPIQ  435

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D++ +Y+HFKA++Q
Sbjct  436  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVNHSYEHFKAYFQ  495

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  496  EFSYLDAKIAVD  507



>ref|XP_003602076.1| Aspartyl aminopeptidase [Medicago truncatula]
 gb|AES72327.1| aspartyl aminopeptidase-like protein, putative [Medicago truncatula]
Length=482

 Score =   200 bits (508),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ D+HEE+H+P+L  GLVIK NA+QRYAT+ VTSF+F+E+A  HNLP Q
Sbjct  350  SADMAHALHPNYMDRHEENHQPKLHGGLVIKQNANQRYATNAVTSFIFREIASKHNLPVQ  409

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASG+GIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF++
Sbjct  410  DFVVRNDMACGSTIGPILASGIGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFK  469

Query  437  TFSSVDRKLNVD  402
             FS +D  + VD
Sbjct  470  EFSHLDANIVVD  481



>ref|XP_002283475.1| PREDICTED: probable aspartyl aminopeptidase [Vitis vinifera]
 emb|CBI15632.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKH+E+H+P+L  GLVIKHNA+QRYAT+ VTSF+FKE+A  HNLP Q
Sbjct  353  SADMAHALHPNYMDKHDENHQPKLHGGLVIKHNANQRYATNAVTSFIFKEIAAKHNLPVQ  412

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+   +D+  +Y+HF+A++Q
Sbjct  413  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMSAVDDVKHSYEHFRAYFQ  472

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  473  EFSCLDAKITVD  484



>emb|CDP05422.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  H LP Q
Sbjct  350  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAARHKLPIQ  409

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASG+GIRTVD G  QLSMHS+RE+C  +D+  +Y+HFK+F++
Sbjct  410  DFVVRNDMPCGSTIGPILASGLGIRTVDVGAPQLSMHSIREMCAVDDVRHSYEHFKSFFE  469

Query  437  TFSSVDRKLNVDC  399
             FS +D K+ VD 
Sbjct  470  EFSYLDTKITVDA  482



>ref|XP_011463290.1| PREDICTED: probable aspartyl aminopeptidase, partial [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P+L  GLVIKHNA+QRYAT+ VTS +F+E+A  H+LP Q
Sbjct  323  SADMAHALHPNYMDKHEDNHQPKLHGGLVIKHNANQRYATNAVTSLIFREIAMNHSLPVQ  382

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKA+YQ
Sbjct  383  EFVVRNDMACGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAYYQ  442

Query  437  TFSSVDRKLNVD  402
             F+ +D K+ VD
Sbjct  443  EFTHMDAKIKVD  454



>ref|XP_006351481.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum tuberosum]
Length=483

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ +TSF+F+E+A  HN+P Q
Sbjct  351  SADMAHALHPNYPDKHEENHQPKFHGGLVIKHNANQRYATNAITSFVFREIASKHNIPLQ  410

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFV+RNDM CGSTIGPILASGVGIRTVD G  Q SMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  411  DFVIRNDMPCGSTIGPILASGVGIRTVDVGAPQWSMHSIREMCAVDDVKHSYEHFKAFFQ  470

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  471  DFSQLDGKIAVD  482



>ref|XP_009624334.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana tomentosiformis]
Length=479

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ VTSF+F+E+A  HN+P Q
Sbjct  347  SADMAHALHPNYPDKHEENHQPKFHGGLVIKHNANQRYATNAVTSFIFREIAAKHNIPIQ  406

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFV+RNDM CGSTIGPILASG+GIRTVD G  Q SMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  407  DFVIRNDMPCGSTIGPILASGIGIRTVDVGAPQWSMHSIREMCAVDDVKHSYQHFKAFFQ  466

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  467  DFSLLDGKIAVD  478



>ref|XP_010248918.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Nelumbo 
nucifera]
Length=490

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ VTSF+F+E+A  H LP Q
Sbjct  358  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAVTSFIFREIAEKHGLPIQ  417

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D+  +Y+HFK++++
Sbjct  418  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKSYFR  477

Query  437  TFSSVDRKLNVD  402
             F+ +D K++VD
Sbjct  478  EFTQLDAKISVD  489



>ref|XP_009790447.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana sylvestris]
Length=479

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ VTSF+F+E+A  HN+P Q
Sbjct  347  SADMAHALHPNYPDKHEENHQPKFHGGLVIKHNANQRYATNAVTSFIFREIAAKHNIPIQ  406

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFV+RNDM CGSTIGPILASG+GIRTVD G  Q SMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  407  DFVIRNDMPCGSTIGPILASGIGIRTVDVGAPQWSMHSIREMCAVDDVKHSYEHFKAFFQ  466

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  467  DFSHLDGKIAVD  478



>ref|XP_003523136.1| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=487

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +KHE +H+P+L  GLVIK NA+QRYAT+ VTSF+F+E+A  H LP Q
Sbjct  355  SADMAHALHPNYMEKHEANHQPKLHGGLVIKTNANQRYATNVVTSFIFREIASKHKLPVQ  414

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPILASG+GIRTVD G  QLSMHS+REIC  +D+  +Y+HFKAFY+
Sbjct  415  DFVVRNDMGCGSTIGPILASGIGIRTVDVGAPQLSMHSIREICAVDDVKHSYEHFKAFYE  474

Query  437  TFSSVDRKLNVD  402
             FS VD K+ VD
Sbjct  475  EFSHVDGKMVVD  486



>gb|KDP30945.1| hypothetical protein JCGZ_11321 [Jatropha curcas]
Length=483

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P++  GLVIKHNA+QRYAT+ VT+FLF+E+A  H +P Q
Sbjct  351  SADMAHALHPNYMDKHEDNHQPKMHGGLVIKHNANQRYATNSVTAFLFREIASKHKIPIQ  410

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPI+ASG+GIRTVD G  QLSMHS+RE+C  +D+  +Y+HFKAF+Q
Sbjct  411  DFVVRNDMPCGSTIGPIIASGIGIRTVDVGAPQLSMHSIREMCAVDDVKHSYEHFKAFFQ  470

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  471  EFSHLDAKITVD  482



>ref|XP_004236341.1| PREDICTED: probable aspartyl aminopeptidase [Solanum lycopersicum]
Length=482

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+   GLVIKHNA+QRYAT+ +TSF+F+E+A  HN+P Q
Sbjct  350  SADMAHALHPNYPDKHEENHQPKFHGGLVIKHNANQRYATNAITSFVFREIAAKHNIPLQ  409

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFV+RNDM CGSTIGPILASGVGIRTVD G  Q SMHS+RE+C  +D+  +Y HFKAF+Q
Sbjct  410  DFVIRNDMPCGSTIGPILASGVGIRTVDVGAPQWSMHSIREMCAVDDVKHSYDHFKAFFQ  469

Query  437  TFSSVDRKLNVD  402
             FS +D K+ VD
Sbjct  470  DFSQLDGKIAVD  481



>gb|EPS62030.1| aspartyl aminopeptidase-like protein, partial [Genlisea aurea]
Length=475

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L +GLVIKHNA+QRYAT+ V+SFLF+E+A  + LP Q
Sbjct  344  SADMAHALHPNYMDKHEENHQPKLHEGLVIKHNANQRYATNAVSSFLFREIAARNGLPVQ  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FV+RND+ CGSTIGPILASG GIRTVD G  QLSMHSVRE+CG +D+  +Y HFKAF+ 
Sbjct  404  EFVIRNDLACGSTIGPILASGAGIRTVDVGAPQLSMHSVREMCGVDDVKHSYDHFKAFFL  463

Query  437  TFSSVDRKLNVD  402
             FS++D+ L VD
Sbjct  464  QFSALDQNLAVD  475



>ref|XP_004172613.1| PREDICTED: probable aspartyl aminopeptidase-like, partial [Cucumis 
sativus]
Length=397

 Score =   196 bits (497),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNFTDKHEEHHRPE+QKG+VIKHNA+QRYATSGVT+FLF+EV RIHNLPTQ
Sbjct  301  SADMAHGVHPNFTDKHEEHHRPEMQKGIVIKHNANQRYATSGVTAFLFREVGRIHNLPTQ  360

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  507
            DFVVRNDMGCGSTIGPILASG GIRTVDCGI QLSMH
Sbjct  361  DFVVRNDMGCGSTIGPILASGAGIRTVDCGIPQLSMH  397



>ref|XP_008807558.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Phoenix 
dactylifera]
Length=476

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ ++SF+F+E+A  HN+P Q
Sbjct  344  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAISSFIFREIAERHNIPIQ  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D   +++HFKA++ 
Sbjct  404  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSFEHFKAYFD  463

Query  437  TFSSVDRKLNVD  402
             F+ +D K+ VD
Sbjct  464  EFTQLDAKITVD  475



>ref|XP_008807556.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807557.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Phoenix 
dactylifera]
Length=487

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ ++SF+F+E+A  HN+P Q
Sbjct  355  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAISSFIFREIAERHNIPIQ  414

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D   +++HFKA++ 
Sbjct  415  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSFEHFKAYFD  474

Query  437  TFSSVDRKLNVD  402
             F+ +D K+ VD
Sbjct  475  EFTQLDAKITVD  486



>gb|KCW51472.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=489

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNFTDKHEEHHRPE+QKGLVIKHNA+QRYATSG+T+FLFKEV +IHNLPTQ
Sbjct  390  SADMAHGVHPNFTDKHEEHHRPEMQKGLVIKHNANQRYATSGITAFLFKEVGKIHNLPTQ  449

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  507
            +F VRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH
Sbjct  450  EFAVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  486



>gb|ABR17053.1| unknown [Picea sitchensis]
Length=502

 Score =   196 bits (498),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE++H+P++ KGLVIK NA+QRYAT+ VTSF+F+E+ + + LPTQ
Sbjct  370  SADMAHSLHPNYMDKHEQNHQPQMHKGLVIKFNANQRYATNAVTSFIFREIGKKNKLPTQ  429

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDM CGST+GPILASGVGIRTVD G  QLSMHS+RE+CG +D+  ++ HFKAF++
Sbjct  430  EFVVRNDMPCGSTVGPILASGVGIRTVDVGAPQLSMHSIREMCGVDDVVYSHLHFKAFFE  489

Query  437  TFSSVDRKLNVDC  399
             ++  D+++ VDC
Sbjct  490  DYAEFDKQIKVDC  502



>ref|XP_010930126.1| PREDICTED: probable aspartyl aminopeptidase [Elaeis guineensis]
Length=476

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE+H+P+L  GLVIKHNA+QRYAT+ +TSF+F+E+A  HNLP Q
Sbjct  344  SADMAHALHPNYMDKHEENHQPKLHGGLVIKHNANQRYATNAITSFIFREIAERHNLPIQ  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D   +++HFKA++ 
Sbjct  404  DFVVRNDMPCGSTIGPILASGVGIRTVDVGAPQLSMHSIREMCAVDDAKHSFEHFKAYFD  463

Query  437  TFSSVDRKLNVD  402
             F+ +D  + VD
Sbjct  464  EFTQLDANIIVD  475



>gb|KJB19571.1| hypothetical protein B456_003G109700 [Gossypium raimondii]
Length=337

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE H+ +L  GLVIKHNA+QRYAT+ VTSF+F E+A  HNLP Q
Sbjct  205  SADMAHALHPNYMDKHEESHQSKLHGGLVIKHNANQRYATNAVTSFIFWEIAVKHNLPIQ  264

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILA GVGIRTVD G  QLSMH +RE+C  +D+  + +HFKAF+ 
Sbjct  265  DFVVRNDMPCGSTIGPILAGGVGIRTVDIGAPQLSMHGIREMCAVDDVKHSNEHFKAFFH  324

Query  437  TFSSVDRKLNVD  402
             FS +D K++VD
Sbjct  325  EFSQLDTKISVD  336



>gb|KDO42029.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=510

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 97/97 (100%), Gaps = 0/97 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF++KHEEHHRPE+QKGLVIKHNA+QRYATSGVT+FLFKE+A++HNLPTQ
Sbjct  390  SADMAHGVHPNFSEKHEEHHRPEMQKGLVIKHNANQRYATSGVTAFLFKEIAKLHNLPTQ  449

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  507
            +FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH
Sbjct  450  EFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  486



>ref|XP_002507546.1| aspartyl aminopeptidase [Micromonas sp. RCC299]
 gb|ACO68804.1| aspartyl aminopeptidase [Micromonas sp. RCC299]
Length=500

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE +H P+L  GLVIKHNA+QRYAT+ VT+ LF+E A    +PTQ
Sbjct  367  SADMAHALHPNYADKHESNHAPKLHAGLVIKHNANQRYATNAVTATLFRECASKSGIPTQ  426

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDMGCGSTIGPIL++ +GIRTVD G+ QLSMHSVRE+CG EDIDI Y+HFK+F++
Sbjct  427  EFVVRNDMGCGSTIGPILSANLGIRTVDVGVPQLSMHSVREMCGTEDIDICYRHFKSFFE  486

Query  437  TFSSVDRKLN  408
             F++V    N
Sbjct  487  NFAAVSSDCN  496



>gb|KJB19572.1| hypothetical protein B456_003G109700 [Gossypium raimondii]
Length=450

 Score =   192 bits (487),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHEE H+ +L  GLVIKHNA+QRYAT+ VTSF+F E+A  HNLP Q
Sbjct  318  SADMAHALHPNYMDKHEESHQSKLHGGLVIKHNANQRYATNAVTSFIFWEIAVKHNLPIQ  377

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDM CGSTIGPILA GVGIRTVD G  QLSMH +RE+C  +D+  + +HFKAF+ 
Sbjct  378  DFVVRNDMPCGSTIGPILAGGVGIRTVDIGAPQLSMHGIREMCAVDDVKHSNEHFKAFFH  437

Query  437  TFSSVDRKLNVD  402
             FS +D K++VD
Sbjct  438  EFSQLDTKISVD  449



>ref|XP_004165827.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
 gb|KGN63497.1| hypothetical protein Csa_1G002660 [Cucumis sativus]
Length=481

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +K+EE+HRP+   GLVIK+NAS +YAT+ VT+ LF+E+A  HNLP Q
Sbjct  350  SADMAHALHPNYMEKYEENHRPKFHGGLVIKNNASNKYATNAVTAALFRELAIKHNLPVQ  409

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDM CG+TIGPILASG+GIRTVD G  QLSMHS RE+CG +D+D +Y+HFKA+++
Sbjct  410  EFVVRNDMACGTTIGPILASGLGIRTVDVGAPQLSMHSAREVCGTDDVDYSYQHFKAYFE  469

Query  437  TFSSVD  420
             FSS+D
Sbjct  470  EFSSLD  475



>ref|XP_004138060.1| PREDICTED: probable aspartyl aminopeptidase-like [Cucumis sativus]
Length=481

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +K+EE+HRP+   GLVIK+NAS +YAT+ VT+ LF+E+A  HNLP Q
Sbjct  350  SADMAHALHPNYMEKYEENHRPKFHGGLVIKNNASNKYATNAVTAALFRELAIKHNLPVQ  409

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDM CG+TIGPILASG+GIRTVD G  QLSMHS RE+CG +D+D +Y+HFKA+++
Sbjct  410  EFVVRNDMACGTTIGPILASGLGIRTVDVGAPQLSMHSAREVCGTDDVDYSYQHFKAYFE  469

Query  437  TFSSVD  420
             FSS+D
Sbjct  470  EFSSLD  475



>ref|XP_010694703.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=505

 Score =   191 bits (486),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRP++QKGLVIKHNA+QRYATSGVT+FLFKEVA+IHNLPTQ
Sbjct  398  SADMAHGVHPNFMDKHEENHRPQMQKGLVIKHNANQRYATSGVTAFLFKEVAKIHNLPTQ  457

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  507
            +FVV+NDMGCGSTIGPILA+GVGIRTVDCGI+QLSMH
Sbjct  458  EFVVKNDMGCGSTIGPILAAGVGIRTVDCGISQLSMH  494



>gb|EMS55846.1| Aspartyl aminopeptidase [Triticum urartu]
Length=618

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 112/146 (77%), Gaps = 13/146 (9%)
 Frame = -1

Query  797  SADMAHGVHPNFT-------------DKHEEHHRPELQKGLVIKHNASQRYATSGVTSFL  657
            SADMAH +HPN+              +KHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+
Sbjct  473  SADMAHALHPNYMVIIVFLDQFMGSQEKHEENHQPKLHGGLVIKHNANQRYATNAVTAFI  532

Query  656  FKEVARIHNLPTQDFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKED  477
            F+E+A  H LP QDFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D
Sbjct  533  FQEIAERHQLPIQDFVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDD  592

Query  476  IDIAYKHFKAFYQTFSSVDRKLNVDC  399
            ++ +Y+H KA+++ F+ +D K+ VDC
Sbjct  593  VNYSYEHLKAYFEEFTELDNKVKVDC  618



>ref|XP_008464465.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Cucumis 
melo]
Length=481

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +K+EE+HRP+   GLVIK+NA+ +YAT+ VT+ LF+E+A  HNLP Q
Sbjct  350  SADMAHALHPNYMEKYEENHRPKFHGGLVIKNNANNKYATNAVTAALFRELAIKHNLPVQ  409

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRNDM CG+TIGPILASG+GIRTVD G  QLSMHS RE+CG +D+D +Y+HFKA+++
Sbjct  410  EFVVRNDMACGTTIGPILASGLGIRTVDVGAPQLSMHSAREVCGTDDVDYSYQHFKAYFE  469

Query  437  TFSSVD  420
             FSS+D
Sbjct  470  EFSSLD  475



>ref|XP_002907085.1| aspartyl aminopeptidase, putative [Phytophthora infestans T30-4]
 gb|EEY63649.1| aspartyl aminopeptidase, putative [Phytophthora infestans T30-4]
Length=462

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPN++D+HE++HRP L  G VIKHNA++RYATSG +SFL KE+AR HN+  Q
Sbjct  331  SADMAHGVHPNYSDRHEQNHRPALHAGPVIKHNANERYATSGTSSFLMKELARRHNVDIQ  390

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVR D GCGSTIGPIL++  GIRT+D G+AQLSMHS+RE+CG ED+      F AFY 
Sbjct  391  EFVVRQDTGCGSTIGPILSTNTGIRTIDVGLAQLSMHSIREMCGTEDLVKTLDWFTAFYS  450

Query  437  TFSSVDRKLNVD  402
             FSS+D+ L  D
Sbjct  451  EFSSLDKCLKTD  462



>dbj|BAD94988.1| aspartyl aminopeptidase [Arabidopsis thaliana]
Length=96

 Score =   178 bits (451),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = -1

Query  686  YATSGVTSFLFKEVARIHNLPTQDFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  507
            YATSG+TSFLFKEVA++H+LP Q+FVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH
Sbjct  1    YATSGITSFLFKEVAKLHDLPIQEFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  60

Query  506  SVREICGKEDIDIAYKHFKAFYQTFSSVDRKLNVD  402
            SVREICG +DIDIAY+HFKAFY++FSSVD+KL VD
Sbjct  61   SVREICGTDDIDIAYRHFKAFYRSFSSVDKKLVVD  95



>ref|XP_001690598.1| aspartyl aminopeptidase-like protein [Chlamydomonas reinhardtii]
 gb|EDP05857.1| aspartyl aminopeptidase-like protein [Chlamydomonas reinhardtii]
Length=565

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN++DKH+  H+P +  GLV+KHN +QRYAT+ V++ LF+EVAR H LP Q
Sbjct  414  SADMAHALHPNYSDKHDPDHQPRMHGGLVLKHNNNQRYATNAVSAALFREVARRHGLPVQ  473

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F VRNDM CGSTIGPILAS +G RTVD GIAQLSMHS+RE CG +D+ IAY HF AF++
Sbjct  474  EFSVRNDMPCGSTIGPILASNLGCRTVDVGIAQLSMHSIREQCGADDVAIAYDHFLAFFK  533

Query  437  TFSSVDRKLNVD  402
             FS++D  L+VD
Sbjct  534  EFSALDASLDVD  545



>ref|XP_004336070.1| aspartyl aminopeptidase [Acanthamoeba castellanii str. Neff]
 gb|ELR14057.1| aspartyl aminopeptidase [Acanthamoeba castellanii str. Neff]
Length=372

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ +KHEE+H+P +QKG+ IK+NA+QRYAT+ +T+FL KE+AR H +P Q
Sbjct  241  SADMAHAVHPNYPEKHEENHQPMMQKGVAIKYNANQRYATTSITAFLLKELARRHGVPMQ  300

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGPIL++G GIRT+D G+ QLSMHS+RE+CG +D+  A    KAFY 
Sbjct  301  EFVVRNDSPCGSTIGPILSAGCGIRTIDIGLPQLSMHSIREMCGADDVSHAVNLLKAFYS  360

Query  437  TFSSVDRKLNVD  402
             FS +D  L VD
Sbjct  361  DFSKLDESLVVD  372



>ref|XP_008909814.1| hypothetical protein PPTG_14635 [Phytophthora parasitica INRA-310]
 gb|ETI40343.1| hypothetical protein F443_14241 [Phytophthora parasitica P1569]
 gb|ETK80443.1| hypothetical protein L915_13884 [Phytophthora parasitica]
 gb|ETL33871.1| hypothetical protein L916_13780 [Phytophthora parasitica]
 gb|ETL87142.1| hypothetical protein L917_13587 [Phytophthora parasitica]
 gb|ETM40342.1| hypothetical protein L914_13693 [Phytophthora parasitica]
 gb|ETN04877.1| hypothetical protein PPTG_14635 [Phytophthora parasitica INRA-310]
 gb|ETO69064.1| hypothetical protein F444_14258 [Phytophthora parasitica P1976]
 gb|ETP10176.1| hypothetical protein F441_14138 [Phytophthora parasitica CJ01A1]
 gb|ETP38275.1| hypothetical protein F442_14083 [Phytophthora parasitica P10297]
Length=462

 Score =   187 bits (475),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPN++D+HE++HRP L  G VIKHNA++RYATSG + FL KE+AR HN+  Q
Sbjct  331  SADMAHGVHPNYSDRHEQNHRPALHAGPVIKHNANERYATSGTSCFLMKELARRHNVDIQ  390

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVR D GCGSTIGPIL++  GIRT+D G+AQLSMHS+RE+CG ED+      F AFY 
Sbjct  391  EFVVRQDTGCGSTIGPILSTNTGIRTIDVGLAQLSMHSIREMCGTEDLVKTMDWFTAFYS  450

Query  437  TFSSVDRKLNVD  402
             FSS+D+ L  D
Sbjct  451  EFSSLDKCLKTD  462



>ref|XP_009519985.1| hypothetical protein PHYSODRAFT_539739 [Phytophthora sojae]
 gb|EGZ24697.1| hypothetical protein PHYSODRAFT_539739 [Phytophthora sojae]
Length=462

 Score =   186 bits (473),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPN+++KHE++HRP L  G VIK+NA++RYATSG ++FL KE+AR HN+  Q
Sbjct  331  SADMAHGVHPNYSEKHEQNHRPALHAGPVIKYNANERYATSGTSAFLMKELARRHNVDIQ  390

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVR D GCGSTIGPIL++  GIRT+D G+AQLSMHS+RE+CG ED+  +   F AFY 
Sbjct  391  EFVVRQDTGCGSTIGPILSTNTGIRTIDVGLAQLSMHSIREMCGTEDLVKSLDWFTAFYS  450

Query  437  TFSSVDRKLNVD  402
             FSS+D+ L  D
Sbjct  451  EFSSLDKCLKTD  462



>ref|XP_007512692.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17292.1| predicted protein [Bathycoccus prasinos]
Length=615

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+T+KHEE H+P   KG+V+KHNA+QRYAT+ +T+++F+E A++  +PTQ
Sbjct  483  SADMAHAIHPNYTEKHEEQHQPLFHKGVVVKHNANQRYATTALTAYMFRECAKLSGIPTQ  542

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVV+NDMGCGSTIGPI+++  GIRTVD G+ QLSMHSVRE+ G ED+DI +KHF AFY+
Sbjct  543  EFVVKNDMGCGSTIGPIVSAQTGIRTVDVGVPQLSMHSVREMMGTEDVDICHKHFLAFYE  602

Query  437  TFSSVD  420
              + VD
Sbjct  603  NIAKVD  608



>ref|XP_003060266.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55035.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=444

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ DKHE  H+P+   G+V+KHNA+QRYAT  V+S+LFKE+     LP Q
Sbjct  313  SADMAHAVHPNYADKHEPGHKPKFGAGVVVKHNANQRYATDAVSSYLFKEIGERAGLPVQ  372

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVR+D+GCGSTIGP L++  GIRTVD G AQLSMHSVRE+CG +D++ A KHF A Y+
Sbjct  373  EFVVRSDLGCGSTIGPTLSTNTGIRTVDVGAAQLSMHSVREMCGAKDVEHAVKHFTAVYE  432

Query  437  TFSSVDRKLNVD  402
             F+++D  L VD
Sbjct  433  GFTALDATLMVD  444



>gb|EMT03759.1| Aspartyl aminopeptidase [Aegilops tauschii]
Length=893

 Score =   187 bits (474),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 110/144 (76%), Gaps = 13/144 (9%)
 Frame = -1

Query  797  SADMAHGVHPNFT-------------DKHEEHHRPELQKGLVIKHNASQRYATSGVTSFL  657
            SADMAH +HPN+              +KHEE+H+P+L  GLVIKHNA+QRYAT+ VT+F+
Sbjct  536  SADMAHALHPNYMVIVVFLDQFMGSQEKHEENHQPKLHGGLVIKHNANQRYATNAVTAFI  595

Query  656  FKEVARIHNLPTQDFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKED  477
            F+E+A  H LP QDFVVRNDM CGSTIGPILASGVGIRTVD G  QLSMHS+RE+C  +D
Sbjct  596  FREIAERHQLPIQDFVVRNDMACGSTIGPILASGVGIRTVDIGAPQLSMHSIREMCAVDD  655

Query  476  IDIAYKHFKAFYQTFSSVDRKLNV  405
            ++ +Y+H KA+++ F+ +D K+ +
Sbjct  656  VNYSYEHLKAYFEEFTELDNKVKI  679



>ref|XP_003055398.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60650.1| predicted protein [Micromonas pusilla CCMP1545]
Length=476

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE +H P++  G+V+KHNA+QRYAT+  T+ LF+E A    +PTQ
Sbjct  344  SADMAHALHPNYMDKHESNHSPKMHAGVVVKHNANQRYATTATTATLFRECAAKEGIPTQ  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRNDMGCGSTIGPIL++ +G+RTVD G+ QLSMHSVRE+CG EDID+ ++HF+AF+ 
Sbjct  404  DFVVRNDMGCGSTIGPILSTNLGVRTVDVGVPQLSMHSVREMCGTEDIDVCFRHFRAFFD  463

Query  437  TFSSVD  420
             F+ +D
Sbjct  464  HFAEID  469



>ref|XP_005648131.1| peptidase M18, aminopeptidase I [Coccomyxa subellipsoidea C-169]
 gb|EIE23587.1| peptidase M18, aminopeptidase I [Coccomyxa subellipsoidea C-169]
Length=482

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKHE  H+P+  KGLV+KHN  QRYAT+ V++ LF+E+A+   +PTQ
Sbjct  331  SADMAHALHPNYADKHEPDHKPQFHKGLVLKHNVHQRYATNAVSATLFRELAKRRGIPTQ  390

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F VR+DM CGSTIGPILASG+G RTVD G  QLSMHS+RE+C  +D+   Y HF AF++
Sbjct  391  EFCVRSDMACGSTIGPILASGLGCRTVDVGAPQLSMHSIREMCAVDDMSHTYNHFCAFFK  450

Query  437  TFSSVDRKLNVD  402
             FS++D  ++VD
Sbjct  451  DFSALDASIDVD  462



>ref|XP_011396821.1| Aspartyl aminopeptidase [Auxenochlorella protothecoides]
 gb|KFM23943.1| Aspartyl aminopeptidase [Auxenochlorella protothecoides]
Length=469

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ D+H+  H P L  G+V+KHNA+QRYAT+ V++ LF+EV R   +PT 
Sbjct  333  SADMAHALHPNYPDRHDAAHAPRLGDGIVLKHNANQRYATTAVSATLFREVCRQAGVPTA  392

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DF VR+DMGCGSTIGPILASG+G+RTVD G+ QLSMHS+RE+C   D+   Y+ F AFYQ
Sbjct  393  DFAVRSDMGCGSTIGPILASGLGLRTVDVGLPQLSMHSIREMCAVADVGHGYRAFLAFYQ  452

Query  437  TFSSVDRKL  411
            T S++D  L
Sbjct  453  TVSALDAAL  461



>emb|CEJ00699.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=300

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+++KHEE+HRPE+ KG VIK NA+QRYAT+ VTS + KE+A+ HN+P Q
Sbjct  169  SADMAHAIHPNYSEKHEENHRPEMHKGTVIKVNANQRYATTAVTSLVLKELAKKHNIPIQ  228

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       + FYQ
Sbjct  229  EFVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIRETGGTDDVKHGIDLLRVFYQ  288

Query  437  TFSSVDRKLNVD  402
             F  +++KL VD
Sbjct  289  EFFVLEQKLIVD  300



>ref|XP_007514776.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15016.1| predicted protein [Bathycoccus prasinos]
Length=522

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ DKHE  H+P+   G+VIKHNA+QRY+T  +TSF+FKE+     + +Q
Sbjct  352  SADMAHAVHPNYADKHEPGHKPKFGDGVVIKHNANQRYSTDAITSFIFKEIGERRKIKSQ  411

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVR+D+GCGSTIGPIL++  GIRTVD G+ QLSMHS+RE+CG ED  +  +HFKA Y+
Sbjct  412  EFVVRSDLGCGSTIGPILSTRSGIRTVDVGMPQLSMHSIREMCGTEDTRLCVEHFKAVYE  471

Query  437  TFSSVDRKLNVD  402
             F  +D K+ VD
Sbjct  472  DFFEMDEKMIVD  483



>gb|ETO14766.1| hypothetical protein RFI_22603 [Reticulomyxa filosa]
Length=160

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAH +HPN+++KHE  H P + KGLV+K+N +QRYATS  TSF   E+AR  N+P Q
Sbjct  29   SSDMAHALHPNYSEKHESLHGPLIHKGLVVKYNCNQRYATSMATSFHLTELARKLNIPLQ  88

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
             FVVRND  CGSTIGPILA+  GIR VD GI QLSMHS+RE+CG +D+  A   F AFY+
Sbjct  89   KFVVRNDSPCGSTIGPILATACGIRAVDVGIPQLSMHSIREVCGVKDVVSATNLFTAFYE  148

Query  437  TFSSVDRKLNVD  402
             F  +D    VD
Sbjct  149  NFVKLDATFKVD  160



>gb|KJE94975.1| aspartyl aminopeptidase [Capsaspora owczarzaki ATCC 30864]
Length=474

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN++DKHEE+HRP +  G VIK NA+QRYAT+ V+  + +E+AR HN+P Q
Sbjct  343  SADMAHAVHPNYSDKHEENHRPVIHGGPVIKSNANQRYATNSVSGTVIREIARKHNIPVQ  402

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGPI+A  +G+RT+D G  QLSMHS+RE CG +D+  A +  KAF++
Sbjct  403  EFVVRNDSACGSTIGPIVAGNLGMRTIDIGNPQLSMHSIRETCGVDDVTYAVQLIKAFFE  462

Query  437  TFSSVDRKLNVD  402
             F ++D +L+VD
Sbjct  463  DFPAMDARLDVD  474



>ref|XP_004346183.2| aspartyl aminopeptidase [Capsaspora owczarzaki ATCC 30864]
Length=478

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN++DKHEE+HRP +  G VIK NA+QRYAT+ V+  + +E+AR HN+P Q
Sbjct  347  SADMAHAVHPNYSDKHEENHRPVIHGGPVIKSNANQRYATNSVSGTVIREIARKHNIPVQ  406

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGPI+A  +G+RT+D G  QLSMHS+RE CG +D+  A +  KAF++
Sbjct  407  EFVVRNDSACGSTIGPIVAGNLGMRTIDIGNPQLSMHSIRETCGVDDVTYAVQLIKAFFE  466

Query  437  TFSSVDRKLNVD  402
             F ++D +L+VD
Sbjct  467  DFPAMDARLDVD  478



>gb|EXX59698.1| Ape4p [Rhizophagus irregularis DAOM 197198w]
Length=466

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ +KHEE+HRP++ +G+VIK NA+QRYAT+ VTS + ++VA+ + +P Q
Sbjct  335  SADMAHAVHPNYCEKHEENHRPQMNQGVVIKTNANQRYATTSVTSLILRQVAKKYKVPLQ  394

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRND  CGSTIGP++++ +G+RT+D G  QLSMHS+RE  G +D+D A K  KAF++
Sbjct  395  DFVVRNDSPCGSTIGPMISANLGLRTLDIGNPQLSMHSIRETAGTKDVDHAIKLIKAFFE  454

Query  437  TFSSVDRKLNVD  402
             F+ +DR + VD
Sbjct  455  DFAEIDRNITVD  466



>ref|XP_001421486.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99779.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=512

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAH +HPN+ D+HE  H P++  GLVIKHNA+QRYAT  VT+F+F+E+     +P Q
Sbjct  344  SSDMAHALHPNYADRHEPAHAPKMHGGLVIKHNANQRYATDAVTAFMFREIGERAGVPVQ  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVR+D GCGSTIGPI ++  GIRTVD G AQLSMHS+RE+CG +DID A KH  A Y 
Sbjct  404  EFVVRSDTGCGSTIGPIFSTRTGIRTVDVGAAQLSMHSIREVCGADDIDHAVKHLTAVYL  463

Query  437  TFSSVDRKLNVD  402
             F  +DR L VD
Sbjct  464  HFIDLDRTLIVD  475



>ref|XP_002505350.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66608.1| predicted protein [Micromonas sp. RCC299]
Length=495

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ DKHE  HRP    G+VIKHNA+QRYAT  VT++LF+E+     +P Q
Sbjct  353  SADMAHAVHPNYADKHEPGHRPRFGDGVVIKHNANQRYATDAVTAWLFRELGERAGVPVQ  412

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVR+D+GCGSTIGPIL++  GIRTVD G  QLSMHSVRE+CG +D+  +  HF A Y+
Sbjct  413  EFVVRSDLGCGSTIGPILSTRTGIRTVDVGAPQLSMHSVREMCGCDDVKHSVAHFTAVYE  472

Query  437  TFSSVDRKLNVD  402
             F+ +D  L VD
Sbjct  473  GFTKLDETLMVD  484



>gb|ESA11968.1| hypothetical protein GLOINDRAFT_335422 [Rhizophagus irregularis 
DAOM 181602]
Length=496

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ +KHEE+HRP++ +G+VIK NA+QRYAT+ VTS + ++VA+ + +P Q
Sbjct  365  SADMAHAVHPNYCEKHEENHRPQMNQGVVIKTNANQRYATTSVTSLILRQVAKKYKVPLQ  424

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVRND  CGSTIGP++++ +G+RT+D G  QLSMHS+RE  G +D+D A K  KAF++
Sbjct  425  DFVVRNDSPCGSTIGPMISANLGLRTLDIGNPQLSMHSIRETAGTKDVDHAIKLIKAFFE  484

Query  437  TFSSVDRKLNVD  402
             F+ +DR + VD
Sbjct  485  DFAEIDRNITVD  496



>emb|CEG01789.1| Peptidase M18 [Ostreococcus tauri]
Length=499

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAH +HPN+TD+HE  H P+L  GLVIKHNA+QRYAT  VT+F+F+E+     +P Q
Sbjct  333  SSDMAHALHPNYTDRHEPAHTPKLHGGLVIKHNANQRYATDAVTAFMFRELGERVGVPVQ  392

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVV++DMGCGSTIGPI ++  GIRTVD G AQLSMHS+RE+CG +D++ A KHF + + 
Sbjct  393  EFVVKSDMGCGSTIGPIFSTRTGIRTVDVGAAQLSMHSIREVCGTDDVEHAIKHFTSTFM  452

Query  437  TFSSVDRKLNVD  402
             F  +DR   VD
Sbjct  453  NFLDLDRTFIVD  464



>emb|CCA15777.1| aspartyl aminopeptidase putative [Albugo laibachii Nc14]
Length=459

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPN++ KHEE+HRP L  G VIK+NA+QRY+TS  ++FL KE+AR H +  Q
Sbjct  330  SADMAHGVHPNYSQKHEENHRPALHAGPVIKYNANQRYSTSSESAFLMKELARRHKIKFQ  389

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVR D  CGSTIGPI+A+  G+ T+D G+AQLSMHS+RE+CG +D+++    FKAF+ 
Sbjct  390  EFVVRQDTACGSTIGPIMATNTGMSTIDVGLAQLSMHSIREMCGTDDLELGLTWFKAFFS  449

Query  437  TFSSVDRKLN  408
             F+++  +L+
Sbjct  450  EFTALKSRLS  459



>emb|CEG81490.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=468

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+++KHEE+HRPE+ KG VIK NA+QRYAT+ VTS + KE+A+ HN+P Q
Sbjct  337  SADMAHAIHPNYSEKHEENHRPEMHKGTVIKVNANQRYATTAVTSLVLKELAKKHNIPIQ  396

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       + FYQ
Sbjct  397  EFVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIRETGGTDDVKHGIDLLRVFYQ  456

Query  437  TFSSVDRKLNVD  402
             F  +++KL VD
Sbjct  457  EFFVLEQKLIVD  468



>emb|CCI46763.1| unnamed protein product [Albugo candida]
Length=663

 Score =   173 bits (438),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPN++ KHE +HRP L  G VIK+NA+QRYAT+  ++FL KE+AR H +  Q
Sbjct  534  SADMAHGVHPNYSQKHEHNHRPALHAGPVIKYNANQRYATTSESAFLMKELARRHGVKLQ  593

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVR D GCGSTIGPI+++  G+RT+D G+AQLSMHS+RE+CG +D+++    FKAF+ 
Sbjct  594  EFVVRQDTGCGSTIGPIMSTNTGMRTIDVGLAQLSMHSIREMCGTDDLELGLTWFKAFFS  653

Query  437  TFSSVDRKLN  408
             F++++  L+
Sbjct  654  EFTNLNSYLS  663



>ref|XP_003083329.1| aspartyl aminopeptidase (ISS), partial [Ostreococcus tauri]
Length=1045

 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAH +HPN+TD+HE  H P+L  GLVIKHNA+QRYAT  VT+F+F+E+     +P Q
Sbjct  333  SSDMAHALHPNYTDRHEPAHTPKLHGGLVIKHNANQRYATDAVTAFMFRELGERVGVPVQ  392

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVV++DMGCGSTIGPI ++  GIRTVD G AQLSMHS+RE+CG +D++ A KHF + + 
Sbjct  393  EFVVKSDMGCGSTIGPIFSTRTGIRTVDVGAAQLSMHSIREVCGTDDVEHAIKHFTSTFM  452

Query  437  TFSSVDRKLNVD  402
             F  +DR   VD
Sbjct  453  NFLDLDRTFIVD  464



>ref|XP_011457668.1| PREDICTED: probable aspartyl aminopeptidase [Fragaria vesca subsp. 
vesca]
Length=147

 Score =   160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 82/97 (85%), Gaps = 13/97 (13%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPNF DKHEE+HRPE+QKGLVIKHNA+QRYATSGVTSFL             
Sbjct  55   SADMAHGVHPNFMDKHEEYHRPEMQKGLVIKHNANQRYATSGVTSFL-------------  101

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMH  507
            +FVVRNDMGCGSTIGPILASG GIRTVDCGIAQLSMH
Sbjct  102  EFVVRNDMGCGSTIGPILASGAGIRTVDCGIAQLSMH  138



>ref|XP_002678138.1| predicted protein [Naegleria gruberi]
 gb|EFC45394.1| predicted protein [Naegleria gruberi]
Length=476

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S DMAH VHPN+++KH+  HRP++ +GLVIK NA+QRYAT+G TSFLF E+A+ HN+P Q
Sbjct  344  SCDMAHAVHPNYSEKHQAKHRPQIHQGLVIKTNANQRYATNGHTSFLFGELAKRHNIPIQ  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
             FVVRND  CGSTIGPI +S   IRT+D GI QLSMHS+RE CG  DI      F  ++ 
Sbjct  404  QFVVRNDSACGSTIGPITSSNTSIRTIDVGIPQLSMHSIREQCGCVDIKSTIDLFTEYFN  463

Query  437  TFSSVDRKLNVD  402
             FS +D  L++D
Sbjct  464  EFSEIDSTLHID  475



>ref|XP_008863481.1| hypothetical protein H310_01914 [Aphanomyces invadans]
 gb|ETW07388.1| hypothetical protein H310_01914 [Aphanomyces invadans]
Length=463

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN++ +HE++ + ++ +G  IK+NA+QRYAT+  TSFL KE+ R HNL  Q
Sbjct  332  SADMAHAVHPNYSARHEQNSKLQMGQGAAIKYNANQRYATTAETSFLLKEIGRRHNLNVQ  391

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
             FV R D GCGSTIGPIL++  GIRT+D G+AQLSMHS+RE+CG  DI+ + + FKAF+ 
Sbjct  392  SFVTRQDCGCGSTIGPILSTHTGIRTIDVGVAQLSMHSIREMCGVTDIETSVELFKAFFN  451

Query  437  TFSSVDRKLNVD  402
             FS+VD  +  D
Sbjct  452  DFSTVDGFVKTD  463



>gb|EPB92944.1| aspartyl aminopeptidase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=475

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH ++PN+ DKHEE+HRPE+ KG VIK NA+QRYAT+ +TS + KE+A+ H +P Q
Sbjct  344  SADMAHAINPNYADKHEENHRPEMHKGTVIKVNANQRYATTAITSLVLKELAKKHQIPIQ  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       +AFY+
Sbjct  404  EFVVRNDSSCGSTIGPMLSAKLGLRTVDIGNPQLSMHSIRETGGTDDVKHGIDLLRAFYE  463

Query  437  TFSSVDRKLNVD  402
             F+ +++K  VD
Sbjct  464  EFAVLEQKFIVD  475



>dbj|GAN09714.1| aspartyl aminopeptidase [Mucor ambiguus]
Length=470

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH ++PN+ DKHEE+HRPE+ KG VIK NA+QRYAT+ +TS + KE+A+ H +P Q
Sbjct  339  SADMAHAINPNYADKHEENHRPEMHKGTVIKINANQRYATTAITSLVLKELAKKHQIPIQ  398

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       +AFY+
Sbjct  399  EFVVRNDSSCGSTIGPMLSAKLGLRTVDIGNPQLSMHSIRETGGTDDVKHGIDLLRAFYE  458

Query  437  TFSSVDRKLNVD  402
             F+ +++K  VD
Sbjct  459  EFAVLEQKFIVD  470



>gb|EPB84012.1| aspartyl aminopeptidase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=524

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+T+K+EE+HRP++ KG VIK NA+QRYAT+  TS + KE+AR   +P Q
Sbjct  393  SADMAHAVHPNYTEKYEENHRPQMHKGTVIKINANQRYATTAPTSLILKEIARQKEIPIQ  452

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RT+D G  QLSMHS+REI G +D+       KAF+Q
Sbjct  453  EFVVRNDSSCGSTIGPMLSAKLGLRTIDVGNPQLSMHSIREIGGVDDVKNGTDLLKAFFQ  512

Query  437  TFSSVDRKLNVD  402
             F  VD ++ VD
Sbjct  513  LFPYVDSRVTVD  524



>ref|XP_008620058.1| aspartyl aminopeptidase [Saprolegnia diclina VS20]
 gb|EQC26479.1| aspartyl aminopeptidase [Saprolegnia diclina VS20]
Length=470

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPN+++KHE + R ++  G VIK+NA++RYATSG T+ L KE+ R H L  Q
Sbjct  335  SADMAHGVHPNYSEKHEVNSRIQMHSGPVIKYNANERYATSGETALLIKELGRRHGLDIQ  394

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFV R D GCGSTIGPILA+  GIRTVD G+AQ SMHS+RE CG  D+++A + F AFY 
Sbjct  395  DFVSRQDCGCGSTIGPILATSTGIRTVDMGLAQFSMHSIREQCGTVDLELAIELFSAFYN  454

Query  437  TFSSVDRKLNVD  402
             F  +D  +  D
Sbjct  455  DFVEIDGSIATD  466



>gb|KDO32253.1| hypothetical protein SPRG_02733 [Saprolegnia parasitica CBS 223.65]
Length=470

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPN+++KHE + R ++  G VIK+NA++RYATSG T+ L KE+ R H L  Q
Sbjct  335  SADMAHGVHPNYSEKHEVNSRIQMHSGPVIKYNANERYATSGETALLIKELGRRHGLDIQ  394

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFV R D GCGSTIGPILA+  GIRTVD G+AQ SMHS+RE CG  D+++A + F AFY 
Sbjct  395  DFVSRQDCGCGSTIGPILATSTGIRTVDMGLAQFSMHSIREQCGTVDLELAIELFSAFYN  454

Query  437  TFSSVDRKLNVD  402
             F  +D  +  D
Sbjct  455  DFVEIDGSIATD  466



>ref|XP_002960428.1| hypothetical protein SELMODRAFT_164111 [Selaginella moellendorffii]
 gb|EFJ37967.1| hypothetical protein SELMODRAFT_164111 [Selaginella moellendorffii]
Length=516

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN  +   EH++P+L  GLVIKHN +Q  AT  +++FLFKEVA+ + +PTQ
Sbjct  384  SADMAHALHPNNAENDVEHNQPKLHDGLVIKHNVTQNNATDAISAFLFKEVAKRNCIPTQ  443

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            ++ V +D+GC STI  +LA+G GIR VDCG+ QL+MHSVRE+CG EDID A++HF+AF+Q
Sbjct  444  NYSVVSDVGCCSTIDSVLAAGYGIRLVDCGLPQLAMHSVREMCGTEDIDAAFRHFRAFFQ  503

Query  437  TFSSVDRKLNVD  402
              +S+D +L VD
Sbjct  504  EIASLDDQLRVD  515



>ref|XP_002967289.1| hypothetical protein SELMODRAFT_86972 [Selaginella moellendorffii]
 gb|EFJ31888.1| hypothetical protein SELMODRAFT_86972 [Selaginella moellendorffii]
Length=519

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN  +   EH++P+L  GLVIKHN +Q  AT  +++FLFKEVA+ + +PTQ
Sbjct  387  SADMAHALHPNNAENDVEHNQPKLHDGLVIKHNLTQNNATDAISAFLFKEVAKRNCIPTQ  446

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            ++ V +D+GC STI  +LA+G GIR VDCG+ QL+MHSVRE+CG EDID A++HF+AF+Q
Sbjct  447  NYSVVSDVGCCSTIDSVLAAGYGIRLVDCGLPQLAMHSVREMCGTEDIDAAFRHFRAFFQ  506

Query  437  TFSSVDRKLNVD  402
              +S+D +L VD
Sbjct  507  EIASLDDQLRVD  518



>emb|CDS03243.1| hypothetical protein LRAMOSA00645 [Absidia idahoensis var. thermophila]
Length=468

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+++KHE +HRP + KG VIK NA+QRYAT+ VTS + KE+A+ HN+P Q
Sbjct  337  SADMAHAIHPNYSEKHESNHRPHMHKGTVIKINANQRYATTAVTSLVLKELAKKHNIPIQ  396

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE+ G +D+       K FY+
Sbjct  397  EFVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREVGGTDDVKHGIDLLKVFYE  456

Query  437  TFSSVDRKLNVD  402
             F+ ++ ++ VD
Sbjct  457  EFAELEARIVVD  468



>ref|XP_009825683.1| hypothetical protein H257_03355 [Aphanomyces astaci]
 gb|ETV83991.1| hypothetical protein H257_03355 [Aphanomyces astaci]
Length=459

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+  +HE++ + ++ +G  IK+NA+QRYAT+G TSFL KE+ R HNL  Q
Sbjct  328  SADMAHAVHPNYAARHEQNSKLQMGQGPAIKYNANQRYATTGETSFLLKEIGRRHNLDVQ  387

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
             FV R D GCGSTIGPIL++  GIRT+D G+AQLSMHS+RE+CG  D++ +   FKAFY 
Sbjct  388  SFVSRQDCGCGSTIGPILSTHTGIRTIDVGVAQLSMHSIREMCGVSDVEKSVALFKAFYN  447

Query  437  TFSSVDRKLNVD  402
             F++VD  +  D
Sbjct  448  DFTTVDGFVKTD  459



>dbj|GAN06933.1| aspartyl aminopeptidase [Mucor ambiguus]
Length=528

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+T+K+EE+HRP++ +G VIK NA+QRYAT+  TS + KE+AR   +P Q
Sbjct  397  SADMAHAVHPNYTEKYEENHRPQMHQGTVIKINANQRYATTAPTSLILKEIARQKEIPIQ  456

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RT+D G  QLSMHS+REI G +D+       KAF+Q
Sbjct  457  EFVVRNDSSCGSTIGPMLSAKLGLRTIDVGNPQLSMHSIREIGGVDDVKNGTDLLKAFFQ  516

Query  437  TFSSVDRKLNVD  402
             F  VD ++ VD
Sbjct  517  LFPYVDSRVTVD  528



>gb|EIE78284.1| hypothetical protein RO3G_02988 [Rhizopus delemar RA 99-880]
Length=469

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +KHEE+HRP++ KG VIK NA+QRYAT+ VTS + KE+A+ H +P Q
Sbjct  338  SADMAHAIHPNYAEKHEENHRPQMHKGTVIKVNANQRYATTAVTSLVLKELAKKHKIPIQ  397

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       + FY+
Sbjct  398  EFVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIRETGGTDDVKHGIDLLRVFYE  457

Query  437  TFSSVDRKLNVD  402
             F+ +++K  VD
Sbjct  458  EFAELEQKFIVD  469



>ref|XP_002129082.1| PREDICTED: aspartyl aminopeptidase-like [Ciona intestinalis]
Length=449

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPN+ +KHE H RP L  G VIK N +QRYAT+ +T+ + +E A+I  +PTQ
Sbjct  318  SADMAHGVHPNYPEKHESHMRPTLHGGPVIKTNNNQRYATTAITATIVRESAKIAGVPTQ  377

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            D +VRND GCGSTIGPILA+ +GIRTVD G AQLSMHS RE+CG    +   K + AF+Q
Sbjct  378  DVMVRNDAGCGSTIGPILATRLGIRTVDVGAAQLSMHSCREVCGVLAPEQCLKLYVAFFQ  437

Query  437  TFSSVDRKLNVD  402
             F  +D  ++V+
Sbjct  438  NFPKIDENISVE  449



>emb|CDH60153.1| aspartyl aminopeptidase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=542

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ +KHE +HRP + KG VIK NA+QRYAT+ VTS + KE+A+ H++P Q
Sbjct  411  SADMAHAIHPNYPEKHESNHRPHMHKGTVIKINANQRYATTAVTSLVLKELAKKHSIPIQ  470

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE+ G +D+       K FY+
Sbjct  471  EFVVRNDSSCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREVGGTDDVKHGIDLLKVFYE  530

Query  437  TFSSVDRKLNVD  402
             F+ ++ ++ VD
Sbjct  531  EFAELEARIVVD  542



>gb|EIE88868.1| hypothetical protein RO3G_13579 [Rhizopus delemar RA 99-880]
Length=476

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ DK+EE+HRP++ KG VIK NA+QRYAT+  TS + +E+AR  N+P Q
Sbjct  345  SADMAHAVHPNYADKYEENHRPQMHKGTVIKINANQRYATTAPTSLILREIARQKNIPIQ  404

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G +D+       K+F++
Sbjct  405  EFVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIRETGGVDDVKHGIDLLKSFFE  464

Query  437  TFSSVDRKLNVD  402
             F  +D K+ VD
Sbjct  465  LFPHIDAKVIVD  476



>emb|CEP14293.1| hypothetical protein [Parasitella parasitica]
Length=475

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 101/137 (74%), Gaps = 5/137 (4%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH ++PN+ DKHEE+HRPE+ KG VIK NA+QRYAT+ VTS + KE+A+ H +P Q
Sbjct  339  SADMAHAINPNYPDKHEENHRPEMHKGTVIKVNANQRYATTAVTSLVLKELAKKHQIPIQ  398

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFK----  450
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+RE  G ED+       +    
Sbjct  399  EFVVRNDSSCGSTIGPMLSAKLGLRTVDIGNPQLSMHSIRETGGTEDVKHGIDLLRVGLI  458

Query  449  -AFYQTFSSVDRKLNVD  402
             AFY+ F+ +++K  VD
Sbjct  459  YAFYEEFAVLEQKFIVD  475



>ref|XP_009025082.1| hypothetical protein HELRODRAFT_187369 [Helobdella robusta]
 gb|ESN96961.1| hypothetical protein HELRODRAFT_187369 [Helobdella robusta]
Length=468

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPNF++KHEEHHRP L KG+V+K NA+Q+YA++ +TS + +E+A   ++P Q
Sbjct  337  SADMAHAVHPNFSEKHEEHHRPFLNKGVVLKFNANQKYASTAITSSIMREIAHEASIPIQ  396

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFV+RNDM CGSTIGPIL++ +GI T+D G  QLSMHS+RE+C    + +A   FKA+++
Sbjct  397  DFVMRNDMACGSTIGPILSTRLGIPTLDLGSPQLSMHSIREMCSTSSVHLAISLFKAYFE  456

Query  437  TFSSV  423
             +S +
Sbjct  457  NYSKM  461



>emb|CEJ04001.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ +K+EE+HRP++ KG VIK NA+Q+YAT+  TS + +EVAR  ++P Q
Sbjct  365  SADMAHAVHPNYAEKYEENHRPQMHKGTVIKINANQKYATTAATSLILREVARQRSIPIQ  424

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++
Sbjct  425  EFVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGINLLKSFFE  484

Query  437  TFSSVDRKLNVD  402
             F  +D K+ +D
Sbjct  485  LFPDIDAKVFID  496



>emb|CEI95696.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ +K+EE+HRP++ KG VIK NA+Q+YAT+  TS + +E+AR  ++P Q
Sbjct  365  SADMAHAVHPNYAEKYEENHRPQMHKGTVIKINANQKYATTAATSLILREIARQRSIPIQ  424

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++
Sbjct  425  EFVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGINLLKSFFE  484

Query  437  TFSSVDRKLNVD  402
             F  +D K+ +D
Sbjct  485  LFPDIDAKVFID  496



>emb|CEG69346.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ +K+EE+HRP++ KG VIK NA+Q+YAT+  TS + +E+AR  ++P Q
Sbjct  365  SADMAHAVHPNYAEKYEENHRPQMHKGTVIKINANQKYATTAATSLILREIARQRSIPIQ  424

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++
Sbjct  425  EFVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGINLLKSFFE  484

Query  437  TFSSVDRKLNVD  402
             F  +D K+ +D
Sbjct  485  LFPDIDAKVFID  496



>emb|CEG81693.1| Putative Aspartyl aminopeptidase [Rhizopus microsporus]
Length=496

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ +K+EE+HRP++ KG VIK NA+Q+YAT+  TS + +E+AR  ++P Q
Sbjct  365  SADMAHAVHPNYAEKYEENHRPQMHKGTVIKINANQKYATTAATSLILREIARQRSIPIQ  424

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +FVVRND  CGSTIGP+L++ +G+RTVD G  QLSMHS+REI G +D+       K+F++
Sbjct  425  EFVVRNDSPCGSTIGPMLSAKLGLRTVDVGNPQLSMHSIREISGVDDVKHGIDLLKSFFE  484

Query  437  TFSSVDRKLNVD  402
             F  +D K+ +D
Sbjct  485  LFPDIDAKVFID  496



>ref|XP_007879166.1| hypothetical protein PFL1_03458 [Pseudozyma flocculosa PF-1]
 gb|EPQ29171.1| hypothetical protein PFL1_03458 [Pseudozyma flocculosa PF-1]
Length=516

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAHG HPN+   +EE+HRP+L  G VIK N  QRYAT+G T+FL + +A++ ++P Q
Sbjct  386  SSDMAHGFHPNYPSYYEENHRPKLNGGPVIKTNVKQRYATTGPTAFLIRRIAKLADVPLQ  445

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
             FVV+N+M CGSTIGP+L S +GIRTVD G  QLSMHS+RE CG  D+++  + F+ F++
Sbjct  446  SFVVKNNMPCGSTIGPML-SKLGIRTVDLGNPQLSMHSIRETCGSRDVELKIRLFQHFFE  504

Query  437  TFSSVDRKLNVD  402
            +F  VD +L  D
Sbjct  505  SFEKVDAQLTTD  516



>ref|XP_005849269.1| hypothetical protein CHLNCDRAFT_143544 [Chlorella variabilis]
 gb|EFN57167.1| hypothetical protein CHLNCDRAFT_143544 [Chlorella variabilis]
Length=497

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN+ DKH+    P L  GLV+KHN +QRYAT+ +++ LF+EV R   +PT 
Sbjct  344  SADMAHALHPNYADKHDPDLAPRLGSGLVLKHNVNQRYATTSISATLFREVCRRAGVPTA  403

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREI--CGKEDIDIAYKHFKAF  444
            +F VR+DM CGSTIGPILASG+G+RTVD G+ QL+MHS+RE+  C   D     + F AF
Sbjct  404  EFAVRSDMACGSTIGPILASGLGVRTVDIGVPQLAMHSIRELQMCTVSDAAHGLRAFTAF  463

Query  443  YQTFSSVDRKLNVD  402
            +QT S +DR ++ D
Sbjct  464  FQTISELDRTVDPD  477



>emb|CBQ68247.1| probable aspartyl aminopeptidase [Sporisorium reilianum SRZ2]
Length=502

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAHG HPN+   +EE+HRP++ +G VIK N  QRYAT+G T+FL + +A+  ++P Q
Sbjct  372  SSDMAHGFHPNYPSYYEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAHVPLQ  431

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
             FVV+NDM CGSTIGP+L S +GIRT+D G  QLSMHS+RE CG +D+D   + FK F+ 
Sbjct  432  SFVVKNDMPCGSTIGPML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVDYKIELFKHFFD  490

Query  437  TFSSVDRKLNVD  402
            +F +VD +L +D
Sbjct  491  SFETVDAQLVID  502



>ref|XP_004994670.1| aspartyl aminopeptidase [Salpingoeca rosetta]
 gb|EGD72847.1| aspartyl aminopeptidase [Salpingoeca rosetta]
Length=469

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAH +HPN+ +KHE +H+P +  G VIK N +QRYAT+ VT+ + + VA I ++P Q
Sbjct  338  SSDMAHAIHPNYPEKHEANHQPMMNAGPVIKFNTNQRYATNAVTALILRRVAEIADVPLQ  397

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            D +VRND  CGSTIGPIL++G+GIRT+D G AQL+MHS+RE+ G  DI  A   FK FY 
Sbjct  398  DVMVRNDSACGSTIGPILSAGLGIRTIDIGNAQLAMHSIREMGGSHDIAYAVTLFKTFYC  457

Query  437  TFSSVDRKLNVD  402
             F+ VD  + V+
Sbjct  458  KFAEVDASVTVE  469



>ref|XP_001745410.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89988.1| predicted protein [Monosiga brevicollis MX1]
Length=467

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VH N  +KHE  HRP++ +G+VIK NA+QRYAT+ VT+ + + +A+   +P Q
Sbjct  330  SADMAHAVHMNRGEKHEGLHRPKMNQGVVIKFNANQRYATNAVTASILRLLAKKAGVPLQ  389

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DFVVR DMGCGSTIGPILASG+GIRT+D G  QL+MHS+RE+ G +D+  A   FK F++
Sbjct  390  DFVVRQDMGCGSTIGPILASGLGIRTIDVGNPQLAMHSIREMGGVKDVAYAIDLFKTFFK  449

Query  437  TFSSVDRKLNVDC  399
             F  +D  ++VD 
Sbjct  450  RFPQLDGSVHVDA  462



>emb|CCF51316.1| probable aspartyl aminopeptidase [Ustilago hordei]
Length=504

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAHG HPN+   +EE+HRP++ +G VIK N  QRYAT+G T+FL + +A+   +P Q
Sbjct  374  SSDMAHGFHPNYPSYYEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQ  433

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
             FVV+NDM CGSTIGP+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ 
Sbjct  434  SFVVKNDMPCGSTIGPML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFD  492

Query  437  TFSSVDRKLNVD  402
            +F  VD +L +D
Sbjct  493  SFEQVDAQLTID  504



>emb|CDI51753.1| probable aspartyl aminopeptidase [Melanopsichium pennsylvanicum 
4]
Length=506

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAHG HPN+   +EE+HRP+L +G VIK N  QRYAT+G T+FL + +A+   +P Q
Sbjct  376  SSDMAHGFHPNYPSFYEENHRPKLNQGPVIKTNVKQRYATTGPTAFLVRRIAQRAQVPLQ  435

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
             FVV+NDM CGSTIGP+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ 
Sbjct  436  SFVVKNDMPCGSTIGPML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFD  494

Query  437  TFSSVDRKLNVD  402
            +F  VD +L +D
Sbjct  495  SFEQVDAQLIID  506



>ref|XP_004361073.1| aspartyl aminopeptidase [Dictyostelium fasciculatum]
 gb|EGG23222.1| aspartyl aminopeptidase [Dictyostelium fasciculatum]
Length=572

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH +HPN++  HE  HRP+L KG VIK+NA+ RYAT+G TSF   E+A+ + +P Q
Sbjct  439  SADMAHAIHPNYSGHHEPLHRPQLNKGPVIKYNANLRYATTGPTSFTILELAKRNGIPVQ  498

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F+V+ND  CGSTIGPI++   GIRTVD G  QLSMHS+RE CG  DI   ++  + F++
Sbjct  499  EFLVKNDSPCGSTIGPIISGSYGIRTVDIGNPQLSMHSIRETCGVVDITYGFQLIQKFFE  558

Query  437  TFSSVDRKLNVD  402
             FS +D+ + VD
Sbjct  559  QFSILDKSIKVD  570



>gb|ELU07857.1| hypothetical protein CAPTEDRAFT_158105 [Capitella teleta]
Length=468

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 98/129 (76%), Gaps = 4/129 (3%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAHGVHPN++ KHE+ HRP L KG+VIK NA+QRYAT+ +T+ + +EVA    +P Q
Sbjct  338  SADMAHGVHPNYSSKHEDQHRPALHKGVVIKFNANQRYATTSITTAILREVAARATVPIQ  397

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICG----KEDIDIAYKHFK  450
            DFVVRND  CGSTIGPI+++G+G+ T+D G AQLSMHS+RE+C     K+ +D+    F+
Sbjct  398  DFVVRNDSPCGSTIGPIMSAGLGMPTIDIGCAQLSMHSIREMCDISSVKQSVDLFTTFFE  457

Query  449  AFYQTFSSV  423
             + + F+S+
Sbjct  458  IYPEVFASM  466



>ref|XP_005415861.1| PREDICTED: aspartyl aminopeptidase [Geospiza fortis]
Length=134

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ DKHEE+HRP   KG VIK N++QRYA++ VT  + +++A    +P Q
Sbjct  3    SADMAHAVHPNYVDKHEENHRPAFHKGPVIKVNSNQRYASTAVTEAVIRDIAARVGVPLQ  62

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F+VRND  CG+TIGPILAS +G+R +D G  QL+MHS+RE+C    +  +   FK F++
Sbjct  63   EFMVRNDTPCGTTIGPILASRLGLRVLDIGCPQLAMHSIREMCCTSGVLQSITLFKGFFE  122

Query  437  TFSSVDRKLNVD  402
               +V   L VD
Sbjct  123  LLPTVSSSLVVD  134



>dbj|GAC99602.1| aspartyl aminopeptidase [Pseudozyma hubeiensis SY62]
Length=502

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAHG HPN+   +EE+HRP++ +G VIK N  QRYAT+G T+FL + +A+   +P Q
Sbjct  372  SSDMAHGFHPNYPSFYEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQ  431

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
             FVV+NDM CGSTIGP+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ 
Sbjct  432  SFVVKNDMPCGSTIGPML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFD  490

Query  437  TFSSVDRKLNVD  402
            +F  VD +L +D
Sbjct  491  SFEQVDAQLVID  502



>ref|XP_011386806.1| putative aspartyl aminopeptidase [Ustilago maydis 521]
 gb|KIS72420.1| putative aspartyl aminopeptidase [Ustilago maydis 521]
Length=505

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAHG HPN+   +EE+HRP++ +G VIK N  QRYAT+G T+FL + +A+   +P Q
Sbjct  375  SSDMAHGFHPNYPSFYEENHRPKINQGPVIKTNVKQRYATTGPTAFLIRRIAQRAQVPLQ  434

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
             FVV+NDM CGSTIGP+L S +GIRT+D G  QLSMHS+RE CG +D++   + FK F+ 
Sbjct  435  SFVVKNDMPCGSTIGPML-SKLGIRTLDLGNPQLSMHSIRETCGTKDVEYKIQLFKHFFD  493

Query  437  TFSSVDRKLNVD  402
            +F  +D +L +D
Sbjct  494  SFEQIDAQLVID  505



>gb|KDN49618.1| putative aspartyl aminopeptidase [Tilletiaria anomala UBC 951]
Length=497

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAH  HPN+   +E  HRP+L  G VIK NA QRYA++  T+FL + +A+I N+P Q
Sbjct  367  SSDMAHAFHPNYPSSYENDHRPKLNGGPVIKTNAKQRYASTAPTTFLLRRLAKIANVPLQ  426

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F VRNDM CGSTIGP++ S  GIRTVD G  QL+MHS+RE CG  D +   + F+AF++
Sbjct  427  EFEVRNDMPCGSTIGPMM-SKTGIRTVDIGNPQLAMHSIRETCGSADPEYKIRLFEAFFE  485

Query  437  TFSSVDRKLNVD  402
             F +VD++L VD
Sbjct  486  HFETVDKELKVD  497



>ref|NP_001279935.1| aspartyl aminopeptidase [Callorhinchus milii]
 gb|AFM91016.1| aspartyl aminopeptidase [Callorhinchus milii]
Length=471

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAH VHPN++DKHEE+HRP + KG VIK N++Q+YA++ VT  + +E+AR  N+P Q
Sbjct  340  SSDMAHAVHPNYSDKHEENHRPLMNKGPVIKFNSNQKYASNAVTVSVMREIARRVNIPLQ  399

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            + +VRND  CGSTIGPILA+G+G+R VD G AQL+MHS+RE+C    +  +   +K FY 
Sbjct  400  EVMVRNDSTCGSTIGPILAAGLGLRVVDMGCAQLAMHSIREMCCTSSVLQSVTLYKGFYD  459

Query  437  TFSSVDRKLNVD  402
             + +++  L VD
Sbjct  460  HYPTINSSLVVD  471



>gb|AFK11572.1| aspartyl aminopeptidase [Callorhinchus milii]
Length=471

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAH VHPN++DKHEE+HRP + KG VIK N++Q+YA++ VT  + +E+AR  N+P Q
Sbjct  340  SSDMAHAVHPNYSDKHEENHRPLMNKGPVIKFNSNQKYASNAVTVSVMREIARRVNIPLQ  399

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            + +VRND  CGSTIGPILA+G+G+R VD G AQL+MHS+RE+C    +  +   +K FY 
Sbjct  400  EVMVRNDSTCGSTIGPILAAGLGLRVVDMGCAQLAMHSIREMCCTSSVLQSVTLYKGFYD  459

Query  437  TFSSVDRKLNVD  402
             + +++  L VD
Sbjct  460  HYPTINSSLVVD  471



>ref|XP_002289000.1| probable aspartyl aminopeptidase [Thalassiosira pseudonana CCMP1335]
 gb|EED94436.1| probable aspartyl aminopeptidase, partial [Thalassiosira pseudonana 
CCMP1335]
Length=464

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARI--HNLP  624
            S DMAH VHPN+ +KHE +H P +  G+VIK N +QRYAT+GVT F+ +EVAR    N+P
Sbjct  332  SVDMAHAVHPNYANKHERNHGPRMNAGVVIKTNQNQRYATNGVTGFIAREVARKTEKNIP  391

Query  623  TQDFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAF  444
             Q+FVVR+D  CG+TIGPIL++  GIRTVD G+ QLSMHS RE+ G  D+   Y  FK+F
Sbjct  392  LQEFVVRSDCPCGTTIGPILSANTGIRTVDLGMPQLSMHSCREVMGIADLTNGYNLFKSF  451

Query  443  YQTFSSVDRKL  411
            +  F+ +D  L
Sbjct  452  FDNFNEIDECL  462



>ref|XP_007883309.1| PREDICTED: aspartyl aminopeptidase [Callorhinchus milii]
Length=574

 Score =   155 bits (393),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAH VHPN++DKHEE+HRP + KG VIK N++Q+YA++ VT  + +E+AR  N+P Q
Sbjct  443  SSDMAHAVHPNYSDKHEENHRPLMNKGPVIKFNSNQKYASNAVTVSVMREIARRVNIPLQ  502

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            + +VRND  CGSTIGPILA+G+G+R VD G AQL+MHS+RE+C    +  +   +K FY 
Sbjct  503  EVMVRNDSTCGSTIGPILAAGLGLRVVDMGCAQLAMHSIREMCCTSSVLQSVTLYKGFYD  562

Query  437  TFSSVDRKLNVD  402
             + +++  L VD
Sbjct  563  HYPTINSSLVVD  574



>gb|ABQ22407.1| aspartyl aminopeptidase-like protein [Callithrix jacchus]
Length=206

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ DKHEE+HRP   KG VIK N+ QRYA++ V+  L +EVA   N+P Q
Sbjct  75   SADMAHAVHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVANKVNVPLQ  134

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            D +VRND  CG+TIGPILAS +G+R +D G  QL+MHS+RE+     +      FK F++
Sbjct  135  DLMVRNDSPCGTTIGPILASRLGLRVLDLGSPQLAMHSIREMACTTGVLQTLTLFKGFFE  194

Query  437  TFSSVDRKLNVD  402
             F S+   L VD
Sbjct  195  LFPSLSHNLLVD  206



>gb|EWC43491.1| aspartyl aminopeptidase [Drechslerella stenobrocha 248]
Length=501

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 97/131 (74%), Gaps = 0/131 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+  K+E HHRPE+ KG VIK NA+ RYAT+     L +E AR+  +P Q
Sbjct  371  SADMAHSVHPNYPAKYESHHRPEMNKGTVIKINANARYATNSPGIVLVQECARVAGVPLQ  430

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
             FVVRND  CGSTIGP+L++ +G+RT+D G AQLSMHS+RE  G +D++ A K FKAF+Q
Sbjct  431  LFVVRNDSSCGSTIGPMLSAQMGMRTLDLGNAQLSMHSIRETGGAQDVEHAIKLFKAFFQ  490

Query  437  TFSSVDRKLNV  405
             +++++  + V
Sbjct  491  RYTALEPTIFV  501



>gb|KFQ24176.1| Aspartyl aminopeptidase, partial [Merops nubicus]
Length=227

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ DKHEE+HRP   KG VIK N++QRYA++ VT  + +++A    +P Q
Sbjct  96   SADMAHAVHPNYVDKHEENHRPAFHKGPVIKVNSNQRYASTAVTEAVIRDIATRVGVPLQ  155

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F+VRND  CG+TIGPILAS +G+R +D G  QL+MHS+RE+C    +  +   FK F++
Sbjct  156  EFMVRNDTPCGTTIGPILASRLGLRVLDIGCPQLAMHSIREMCCTSGVLQSITLFKGFFE  215

Query  437  TFSSVDRKLNVD  402
               +V   L VD
Sbjct  216  LLPAVSSSLVVD  227



>ref|XP_001837079.1| aspartyl aminopeptidase [Coprinopsis cinerea okayama7#130]
 gb|EAU84696.1| aspartyl aminopeptidase [Coprinopsis cinerea okayama7#130]
Length=475

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADM H +HPN+T KHEE HRP +  G+VIK NA QRYAT  V+SF+ K++A       Q
Sbjct  345  SADMGHAIHPNYTSKHEEKHRPYMNGGIVIKTNAKQRYATDAVSSFIVKQLAERRGGKVQ  404

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F VRNDM CGST+GP+L S +G+RTVD G   LSMHS+RE  G  D+  A   F AF++
Sbjct  405  EFEVRNDMPCGSTVGPML-SKLGVRTVDVGNPMLSMHSIRETAGSHDVQSAIDLFHAFFE  463

Query  437  TFSSVDRKLNVD  402
             FS +D+ LNVD
Sbjct  464  GFSKLDQGLNVD  475



>ref|XP_008947935.1| PREDICTED: aspartyl aminopeptidase, partial [Merops nubicus]
Length=239

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ DKHEE+HRP   KG VIK N++QRYA++ VT  + +++A    +P Q
Sbjct  108  SADMAHAVHPNYVDKHEENHRPAFHKGPVIKVNSNQRYASTAVTEAVIRDIATRVGVPLQ  167

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F+VRND  CG+TIGPILAS +G+R +D G  QL+MHS+RE+C    +  +   FK F++
Sbjct  168  EFMVRNDTPCGTTIGPILASRLGLRVLDIGCPQLAMHSIREMCCTSGVLQSITLFKGFFE  227

Query  437  TFSSVDRKLNVD  402
               +V   L VD
Sbjct  228  LLPAVSSSLVVD  239



>ref|XP_006683342.1| hypothetical protein BATDEDRAFT_18145 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76038.1| hypothetical protein BATDEDRAFT_18145 [Batrachochytrium dendrobatidis 
JAM81]
Length=472

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 99/135 (73%), Gaps = 6/135 (4%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHN----  630
            SADMAH +HPN+ +KHE++HRP +  G+VIK NA+QRYAT+ +++ + +EVA++      
Sbjct  335  SADMAHALHPNYFEKHEDNHRPLINSGVVIKQNANQRYATTAISTLVLREVAKLAGKEGS  394

Query  629  --LPTQDFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKH  456
              +  Q+FVVRND  CGSTIGP+L++ +G+RTVD G  Q SMHS+RE CG ED+  A   
Sbjct  395  GGVALQEFVVRNDSPCGSTIGPMLSASLGVRTVDVGNPQWSMHSIRETCGVEDVQHAVNL  454

Query  455  FKAFYQTFSSVDRKL  411
            FK+F+  F++VD ++
Sbjct  455  FKSFFDHFAAVDARI  469



>ref|XP_009033025.1| hypothetical protein AURANDRAFT_20254 [Aureococcus anophagefferens]
 gb|EGB11910.1| hypothetical protein AURANDRAFT_20254 [Aureococcus anophagefferens]
Length=494

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            S+DMAHGVHPN+ ++H+  H P+LQ GLVIKHNA+QRYAT+ V + + +E A   ++PTQ
Sbjct  343  SSDMAHGVHPNYAERHDPKHGPKLQGGLVIKHNANQRYATNAVGAVMVREFAARADVPTQ  402

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            DF V+ D GCG+TIGPI A+  G+RTVD G  QLSMHS RE+ G +D+    K  KA Y+
Sbjct  403  DFAVKADSGCGTTIGPITAALTGMRTVDVGPPQLSMHSCREMMGSDDVFYTIKLCKAAYE  462

Query  437  TFSSVDRKLNVD  402
             F+ V + ++VD
Sbjct  463  HFADVTKAVDVD  474



>ref|XP_010181866.1| PREDICTED: aspartyl aminopeptidase [Mesitornis unicolor]
Length=365

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 0/132 (0%)
 Frame = -1

Query  797  SADMAHGVHPNFTDKHEEHHRPELQKGLVIKHNASQRYATSGVTSFLFKEVARIHNLPTQ  618
            SADMAH VHPN+ DKHEE+HRP   KG VIK N++QRYA++ VT  + +++A    +P Q
Sbjct  234  SADMAHAVHPNYVDKHEENHRPAFHKGPVIKVNSNQRYASTAVTEAVIRDIAARVGVPLQ  293

Query  617  DFVVRNDMGCGSTIGPILASGVGIRTVDCGIAQLSMHSVREICGKEDIDIAYKHFKAFYQ  438
            +F+VRND  CG+TIGPILAS +G+R +D G  QL+MHS+RE+C    +  +   FKAF++
Sbjct  294  EFMVRNDTPCGTTIGPILASRLGLRVLDIGCPQLAMHSIREMCCTSGVLQSITLFKAFFE  353

Query  437  TFSSVDRKLNVD  402
               +V   L VD
Sbjct  354  LLPTVSSSLVVD  365



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566999573790