BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF039L02

Length=847
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB17031.1|  hypothetical protein B456_002G261700                    317   7e-103   Gossypium raimondii
gb|KJB17033.1|  hypothetical protein B456_002G261700                    318   3e-102   Gossypium raimondii
gb|KJB17030.1|  hypothetical protein B456_002G261700                    318   1e-101   Gossypium raimondii
gb|KHG08972.1|  GDP-mannose-dependent alpha-mannosyltransferase         318   1e-101   Gossypium arboreum [tree cotton]
ref|XP_011094980.1|  PREDICTED: uncharacterized protein LOC105174543    316   9e-101   Sesamum indicum [beniseed]
gb|KDO53240.1|  hypothetical protein CISIN_1g009759mg                   306   6e-100   Citrus sinensis [apfelsine]
emb|CDP06508.1|  unnamed protein product                                311   7e-100   Coffea canephora [robusta coffee]
ref|XP_008442461.1|  PREDICTED: uncharacterized protein LOC103486318    312   4e-99    Cucumis melo [Oriental melon]
ref|XP_006363049.1|  PREDICTED: uncharacterized protein LOC102604925    311   4e-99    Solanum tuberosum [potatoes]
gb|KDO53238.1|  hypothetical protein CISIN_1g009759mg                   307   5e-99    Citrus sinensis [apfelsine]
ref|XP_011077579.1|  PREDICTED: uncharacterized protein LOC105161555    311   6e-99    Sesamum indicum [beniseed]
gb|KDO53239.1|  hypothetical protein CISIN_1g009759mg                   306   1e-98    Citrus sinensis [apfelsine]
ref|XP_010031046.1|  PREDICTED: uncharacterized protein LOC104420932    305   4e-98    Eucalyptus grandis [rose gum]
ref|XP_004137727.1|  PREDICTED: GDP-mannose-dependent alpha-manno...    308   8e-98    Cucumis sativus [cucumbers]
emb|CBI30420.3|  unnamed protein product                                306   9e-98    Vitis vinifera
gb|KCW88121.1|  hypothetical protein EUGRSUZ_A00516                     305   2e-97    Eucalyptus grandis [rose gum]
ref|XP_006429312.1|  hypothetical protein CICLE_v10011473mg             308   2e-97    Citrus clementina [clementine]
ref|XP_002278868.2|  PREDICTED: uncharacterized protein LOC100259616    306   6e-97    Vitis vinifera
emb|CAN62120.1|  hypothetical protein VITISV_037025                     305   7e-97    Vitis vinifera
ref|XP_011019147.1|  PREDICTED: uncharacterized protein LOC105121959    305   2e-96    Populus euphratica
gb|KDP24481.1|  hypothetical protein JCGZ_25045                         302   2e-96    Jatropha curcas
gb|KJB76911.1|  hypothetical protein B456_012G112200                    295   2e-96    Gossypium raimondii
ref|XP_006480973.1|  PREDICTED: uncharacterized protein LOC102615235    305   3e-96    Citrus sinensis [apfelsine]
ref|XP_007026774.1|  Sulfoquinovosyldiacylglycerol 2                    304   5e-96    
ref|XP_002309122.2|  hypothetical protein POPTR_0006s09880g             303   7e-96    
ref|XP_003552228.1|  PREDICTED: uncharacterized protein LOC100807...    303   9e-96    Glycine max [soybeans]
gb|KHN24299.1|  GDP-mannose-dependent alpha-mannosyltransferase         300   1e-95    Glycine soja [wild soybean]
ref|XP_006602643.1|  PREDICTED: uncharacterized protein LOC100807...    303   1e-95    Glycine max [soybeans]
gb|KJB17032.1|  hypothetical protein B456_002G261700                    302   1e-95    Gossypium raimondii
ref|XP_004246336.1|  PREDICTED: uncharacterized protein LOC101252422    302   2e-95    Solanum lycopersicum
ref|XP_009587153.1|  PREDICTED: uncharacterized protein LOC104084897    302   2e-95    Nicotiana tomentosiformis
ref|XP_007140380.1|  hypothetical protein PHAVU_008G106900g             302   2e-95    Phaseolus vulgaris [French bean]
ref|XP_009787548.1|  PREDICTED: uncharacterized protein LOC104235470    302   2e-95    Nicotiana sylvestris
ref|XP_009593273.1|  PREDICTED: uncharacterized protein LOC104089...    296   9e-95    
ref|XP_010678109.1|  PREDICTED: uncharacterized protein LOC104893676    300   1e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009781169.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    300   1e-94    Nicotiana sylvestris
gb|KHN46311.1|  GDP-mannose-dependent alpha-mannosyltransferase         297   2e-94    Glycine soja [wild soybean]
ref|XP_010101801.1|  GDP-mannose-dependent alpha-mannosyltransferase    293   3e-94    
ref|XP_010256624.1|  PREDICTED: uncharacterized protein LOC104596978    299   4e-94    Nelumbo nucifera [Indian lotus]
ref|XP_003516943.1|  PREDICTED: uncharacterized protein LOC100780899    299   4e-94    Glycine max [soybeans]
gb|KJB76912.1|  hypothetical protein B456_012G112200                    295   5e-94    Gossypium raimondii
ref|XP_004249580.1|  PREDICTED: uncharacterized protein LOC101249508    298   9e-94    Solanum lycopersicum
gb|AES79437.2|  group 1 family glycosyltransferase                      298   9e-94    Medicago truncatula
gb|KHG00375.1|  mgtA                                                    290   2e-93    Gossypium arboreum [tree cotton]
ref|XP_006338993.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    297   2e-93    Solanum tuberosum [potatoes]
ref|XP_008388188.1|  PREDICTED: uncharacterized protein LOC103450599    297   2e-93    
gb|KHG00374.1|  mgtA                                                    288   2e-93    Gossypium arboreum [tree cotton]
ref|XP_009593272.1|  PREDICTED: uncharacterized protein LOC104089...    296   2e-93    Nicotiana tomentosiformis
ref|XP_003623219.1|  Phosphatidylinositol N-acetylglucosaminyltra...    297   3e-93    
ref|XP_004302644.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    295   7e-93    Fragaria vesca subsp. vesca
ref|XP_010909645.1|  PREDICTED: uncharacterized protein LOC105035694    296   1e-92    Elaeis guineensis
gb|KHN22725.1|  GDP-mannose-dependent alpha-mannosyltransferase         286   2e-92    Glycine soja [wild soybean]
ref|XP_011047421.1|  PREDICTED: uncharacterized protein LOC105141...    290   2e-92    Populus euphratica
ref|XP_002531354.1|  glycosyltransferase, putative                      292   3e-92    
gb|EPS57405.1|  hypothetical protein M569_17413                         285   4e-92    Genlisea aurea
ref|XP_007205049.1|  hypothetical protein PRUPE_ppa004263mg             294   5e-92    Prunus persica
ref|XP_002323560.1|  SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein     291   5e-92    
ref|XP_009358856.1|  PREDICTED: uncharacterized protein LOC103949460    293   8e-92    Pyrus x bretschneideri [bai li]
ref|XP_011047420.1|  PREDICTED: uncharacterized protein LOC105141...    290   9e-92    Populus euphratica
gb|KHN31576.1|  GDP-mannose-dependent alpha-mannosyltransferase         290   1e-91    Glycine soja [wild soybean]
ref|XP_008370134.1|  PREDICTED: uncharacterized protein LOC103433646    290   1e-91    
gb|EYU26645.1|  hypothetical protein MIMGU_mgv1a004620mg                293   1e-91    Erythranthe guttata [common monkey flower]
ref|XP_008239560.1|  PREDICTED: uncharacterized protein LOC103338145    293   1e-91    Prunus mume [ume]
ref|XP_006583630.1|  PREDICTED: uncharacterized protein LOC100804237    287   2e-91    
ref|XP_009370203.1|  PREDICTED: uncharacterized protein LOC103959579    292   2e-91    Pyrus x bretschneideri [bai li]
ref|XP_011047417.1|  PREDICTED: uncharacterized protein LOC105141...    289   2e-91    Populus euphratica
ref|XP_008800789.1|  PREDICTED: uncharacterized protein LOC103715059    291   4e-91    Phoenix dactylifera
ref|XP_003520926.1|  PREDICTED: uncharacterized protein LOC100803792    291   5e-91    Glycine max [soybeans]
ref|XP_007133940.1|  hypothetical protein PHAVU_010G005100g             291   6e-91    Phaseolus vulgaris [French bean]
ref|XP_004506782.1|  PREDICTED: GDP-mannose-dependent alpha-manno...    290   1e-90    Cicer arietinum [garbanzo]
gb|EEC81364.1|  hypothetical protein OsI_24561                          280   1e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_010558362.1|  PREDICTED: uncharacterized protein LOC104827042    290   2e-90    Tarenaya hassleriana [spider flower]
gb|KEH28856.1|  group 1 family glycosyltransferase                      285   3e-90    Medicago truncatula
gb|EYU41861.1|  hypothetical protein MIMGU_mgv1a004551mg                288   6e-90    Erythranthe guttata [common monkey flower]
ref|XP_010553086.1|  PREDICTED: uncharacterized protein LOC104823284    287   2e-89    Tarenaya hassleriana [spider flower]
gb|ABA55726.1|  sulfoquinovosyldiacylglycerol synthase type 2           287   2e-89    Vigna unguiculata
ref|XP_003604630.1|  Glycogen synthase                                  285   7e-89    Medicago truncatula
emb|CDY40313.1|  BnaA10g27550D                                          276   8e-89    Brassica napus [oilseed rape]
gb|ACN35476.1|  unknown                                                 275   5e-88    Zea mays [maize]
ref|XP_009407545.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    283   5e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004987290.1|  PREDICTED: uncharacterized protein LOC101765158    282   6e-88    Setaria italica
dbj|BAJ85864.1|  predicted protein                                      282   6e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002459190.1|  hypothetical protein SORBIDRAFT_02g000240          281   1e-87    Sorghum bicolor [broomcorn]
ref|XP_003561543.1|  PREDICTED: uncharacterized protein LOC100842...    281   1e-87    Brachypodium distachyon [annual false brome]
ref|NP_001130956.1|  uncharacterized protein LOC100192061 precursor     275   2e-87    
ref|XP_010228495.1|  PREDICTED: uncharacterized protein LOC100842...    281   2e-87    Brachypodium distachyon [annual false brome]
dbj|BAD31817.1|  putative sulfolipid synthase                           280   3e-87    Oryza sativa Japonica Group [Japonica rice]
emb|CAB69850.1|  putative protein                                       279   6e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AAK76635.1|  unknown protein                                         278   6e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006657378.1|  PREDICTED: uncharacterized protein LOC102710508    278   1e-86    
gb|EMT15547.1|  Putative glycosyltransferase                            278   2e-86    
ref|NP_568085.2|  sulfoquinovosyldiacylglycerol 2                       278   3e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130666.1|  PREDICTED: uncharacterized protein LOC103855432    278   4e-86    Brassica rapa
emb|CDY11210.1|  BnaA03g00460D                                          278   7e-86    Brassica napus [oilseed rape]
emb|CDX97820.1|  BnaC04g41190D                                          275   1e-85    
ref|XP_006287534.1|  hypothetical protein CARUB_v10000742mg             277   1e-85    Capsella rubella
emb|CDX80782.1|  BnaC03g00360D                                          274   2e-85    
ref|XP_002870938.1|  predicted protein                                  276   2e-85    Arabidopsis lyrata subsp. lyrata
ref|XP_008650829.1|  PREDICTED: uncharacterized protein LOC100192...    275   4e-85    Zea mays [maize]
ref|XP_008650830.1|  PREDICTED: uncharacterized protein LOC100192...    275   4e-85    
ref|XP_010490595.1|  PREDICTED: uncharacterized protein LOC104768346    275   7e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010452011.1|  PREDICTED: uncharacterized protein LOC104734184    275   1e-84    Camelina sativa [gold-of-pleasure]
ref|XP_006398643.1|  hypothetical protein EUTSA_v10013276mg             274   2e-84    Eutrema salsugineum [saltwater cress]
ref|XP_009122830.1|  PREDICTED: uncharacterized protein LOC103847496    274   2e-84    Brassica rapa
emb|CDY40312.1|  BnaA10g27560D                                          273   3e-84    Brassica napus [oilseed rape]
gb|KFK44566.1|  hypothetical protein AALP_AA1G274200                    273   4e-84    Arabis alpina [alpine rockcress]
ref|XP_009409491.1|  PREDICTED: phosphatidylinositol N-acetylgluc...    270   1e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010424824.1|  PREDICTED: uncharacterized protein LOC104709996    275   2e-83    
emb|CDY10486.1|  BnaCnng03870D                                          267   4e-83    Brassica napus [oilseed rape]
gb|AFW80016.1|  hypothetical protein ZEAMMB73_479455                    261   6e-82    
gb|ACN26074.1|  unknown                                                 255   3e-81    Zea mays [maize]
ref|XP_002457385.1|  hypothetical protein SORBIDRAFT_03g006480          262   8e-81    Sorghum bicolor [broomcorn]
ref|NP_001144658.1|  uncharacterized protein LOC100277683               261   2e-80    Zea mays [maize]
ref|NP_001041991.1|  Os01g0142300                                       261   2e-80    
ref|XP_004968167.1|  PREDICTED: uncharacterized protein LOC101764078    261   3e-80    
gb|EAY72486.1|  hypothetical protein OsI_00342                          260   6e-80    Oryza sativa Indica Group [Indian rice]
gb|EPS57661.1|  hypothetical protein M569_17157                         251   9e-80    Genlisea aurea
ref|XP_006643739.1|  PREDICTED: uncharacterized protein LOC102711739    255   5e-78    Oryza brachyantha
ref|XP_003568443.1|  PREDICTED: uncharacterized protein LOC100832140    251   1e-76    Brachypodium distachyon [annual false brome]
gb|EEE66415.1|  hypothetical protein OsJ_22761                          251   3e-76    Oryza sativa Japonica Group [Japonica rice]
gb|EMS60261.1|  GDP-mannose-dependent alpha-mannosyltransferase         244   2e-72    Triticum urartu
emb|CDM81044.1|  unnamed protein product                                240   3e-72    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002468134.1|  hypothetical protein SORBIDRAFT_01g040150          238   7e-72    Sorghum bicolor [broomcorn]
ref|XP_008653982.1|  PREDICTED: uncharacterized protein LOC103634168    238   9e-72    Zea mays [maize]
gb|EMT15719.1|  Putative glycosyltransferase                            237   2e-71    
ref|NP_001150015.1|  glycosyl transferase, group 1 family protein       237   2e-71    Zea mays [maize]
gb|ACG31912.1|  glycosyl transferase, group 1 family protein            237   3e-71    Zea mays [maize]
gb|ACN34235.1|  unknown                                                 237   3e-71    Zea mays [maize]
ref|XP_003558286.1|  PREDICTED: uncharacterized protein LOC100846446    236   6e-71    Brachypodium distachyon [annual false brome]
ref|XP_004984689.1|  PREDICTED: uncharacterized protein LOC101779471    236   7e-71    Setaria italica
ref|XP_006649799.1|  PREDICTED: uncharacterized protein LOC102700221    230   9e-69    Oryza brachyantha
gb|EAY89357.1|  hypothetical protein OsI_10861                          229   2e-68    Oryza sativa Indica Group [Indian rice]
ref|NP_001049645.1|  Os03g0265100                                       229   2e-68    
dbj|BAJ94304.1|  predicted protein                                      228   2e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT15626.1|  Lipopolysaccharide core biosynthesis glycosyltran...    229   7e-68    
dbj|BAJ91585.1|  predicted protein                                      228   1e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002968644.1|  UDP-sulfoquinovose: alpha-diacylglycerol-sul...    228   5e-67    Selaginella moellendorffii
ref|XP_001756850.1|  predicted protein                                  221   2e-64    
ref|XP_001766232.1|  predicted protein                                  214   3e-62    
gb|EMS55944.1|  GDP-mannose-dependent alpha-mannosyltransferase         214   1e-61    Triticum urartu
gb|AFA36602.1|  putative sulfolipid synthase                            162   2e-45    Lolium perenne [perennial ryegrass]
gb|KIZ07633.1|  sulfoquinovosyltransferase                              159   6e-43    Monoraphidium neglectum
ref|XP_005843576.1|  hypothetical protein CHLNCDRAFT_33086              160   4e-42    Chlorella variabilis
tpg|DAA44536.1|  TPA: hypothetical protein ZEAMMB73_879639              155   4e-40    
ref|XP_001689662.1|  sulfolipid synthase                                154   7e-40    Chlamydomonas reinhardtii
ref|XP_002953985.1|  hypothetical protein VOLCADRAFT_82536              151   3e-38    Volvox carteri f. nagariensis
ref|XP_005705641.1|  UDP-sulfoquinovose:DAG sulfoquinovosyltransf...    149   7e-38    Galdieria sulphuraria
emb|CBJ27894.1|  UDP-sulfoquinovose: diacylglycerol alpha-sulfoqu...    144   3e-37    Ectocarpus siliculosus
ref|XP_005538341.1|  sulfoquinovosyldiacylglycerol biosynthesis p...    147   5e-37    Cyanidioschyzon merolae strain 10D
ref|XP_005715110.1|  unnamed protein product                            147   6e-37    Chondrus crispus [carageen]
ref|XP_002185276.1|  glycosyl transferase, group 1                      146   2e-36    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005644605.1|  UDP-Glycosyltransferase/glycogen phosphorylase     144   1e-35    Coccomyxa subellipsoidea C-169
ref|XP_005706721.1|  sulfoquinovosyltransferase                         142   4e-35    Galdieria sulphuraria
ref|WP_023066667.1|  glycosyl transferases group 1 family protein       135   2e-33    Lyngbya aestuarii
ref|WP_013178429.1|  glycosyl transferase family 1                      135   3e-33    Truepera radiovictrix
gb|EWM27152.1|  gdp-mannose-dependent alpha-mannosyltransferase         136   4e-33    Nannochloropsis gaditana
ref|WP_015225187.1|  group 1 glycosyl transferase                       134   9e-33    Halothece sp. PCC 7418
ref|WP_012629991.1|  glycosyl transferase                               134   9e-33    Cyanothece sp. PCC 7425
ref|WP_019157421.1|  hypothetical protein                               134   9e-33    Brevibacterium senegalense
ref|WP_009786934.1|  glycosyl transferase                               134   1e-32    Lyngbya sp. PCC 8106
ref|WP_015220908.1|  group 1 glycosyl transferase                       133   2e-32    Cyanobacterium aponinum
ref|WP_015175196.1|  glycosyl transferase group 1                       133   2e-32    Oscillatoria nigro-viridis
ref|WP_017719528.1|  glycosyl transferase                               133   2e-32    Oscillatoria sp. PCC 10802
ref|WP_008314395.1|  glycosyltransferase                                133   2e-32    Leptolyngbya sp. PCC 6406
ref|WP_012596832.1|  glycosyl transferase                               133   3e-32    Cyanothece sp. PCC 8801
ref|WP_015784192.1|  glycosyl transferase                               132   3e-32    Cyanothece sp. PCC 8802
ref|WP_011056273.1|  glycosyl transferase                               132   4e-32    Thermosynechococcus elongatus
ref|WP_015184883.1|  glycosyltransferase                                132   5e-32    Microcoleus sp. PCC 7113
ref|WP_019501737.1|  hypothetical protein                               132   5e-32    Pseudanabaena sp. PCC 6802
gb|KIZ02980.1|  sulfoquinovosyltransferase                              132   5e-32    Monoraphidium neglectum
ref|WP_011243256.1|  MULTISPECIES: glycosyl transferase                 131   1e-31    Synechococcus
ref|WP_015956855.1|  glycosyl transferase                               131   1e-31    Cyanothece sp. PCC 7424
ref|WP_010145366.1|  glycosyl transferase family 1                      131   1e-31    Citricoccus sp. CH26A
gb|AGF71936.1|  glycogen synthase                                       130   1e-31    Corynebacterium halotolerans YIM 70093 = DSM 44683
ref|WP_036477227.1|  glycosyl transferase                               130   2e-31    Myxosarcina sp. GI1
ref|WP_024125070.1|  sulfoquinovosyldiacylglycerol biosynthesis p...    130   2e-31    Thermosynechococcus sp. NK55a
ref|WP_027004308.1|  glycosyl transferase                               130   2e-31    Corynebacterium halotolerans
ref|WP_012164458.1|  glycosyl transferase                               130   2e-31    Acaryochloris marina
ref|WP_006457040.1|  glycosyl transferase                               130   2e-31    Synechococcus sp. PCC 7335
ref|WP_006513788.1|  glycosyltransferase                                130   2e-31    Leptolyngbya sp. PCC 7375
ref|WP_011610261.1|  glycosyl transferase                               130   3e-31    Trichodesmium erythraeum
ref|WP_006101106.1|  glycosyl transferase                               130   3e-31    Coleofasciculus chthonoplastes
ref|WP_015223063.1|  group 1 glycosyl transferase                       130   3e-31    
ref|XP_001699258.1|  sulfolipid synthase                                130   3e-31    Chlamydomonas reinhardtii
ref|WP_039726013.1|  MULTISPECIES: glycosyl transferase                 129   5e-31    Lyngbya confervoides
ref|WP_017288576.1|  glycosyl transferase                               129   6e-31    Leptolyngbya boryana
ref|WP_036913154.1|  MULTISPECIES: glycosyl transferase                 129   6e-31    Prochlorococcus
ref|WP_006633738.1|  glycosyl transferase                               129   7e-31    Microcoleus vaginatus
ref|WP_040657553.1|  glycosyl transferase                               129   9e-31    
ref|WP_011316987.1|  glycosyl transferase                               128   1e-30    Trichormus variabilis
ref|WP_022608621.1|  glycosyltransferase                                128   1e-30    Rubidibacter lacunae
ref|WP_017292828.1|  glycosyl transferase                               128   1e-30    Geminocystis herdmanii
ref|WP_015170725.1|  group 1 glycosyl transferase                       128   2e-30    Geitlerinema sp. PCC 7407
ref|WP_006910279.1|  glycosyl transferase                               128   2e-30    Cyanobium sp. PCC 7001
ref|WP_031283693.1|  glycosyl transferase                               128   2e-30    
ref|WP_035923791.1|  glycosyl transferase                               127   2e-30    
ref|WP_015230997.1|  glycosyltransferase                                127   2e-30    Dactylococcopsis salina
ref|WP_006196765.1|  glycosyl transferase                               127   3e-30    Nodularia spumigena
ref|WP_007356158.1|  MULTISPECIES: glycosyl transferase                 127   3e-30    Kamptonema
ref|WP_025943510.1|  glycosyl transferase                               127   3e-30    
ref|WP_010467672.1|  glycosyl transferase                               127   4e-30    Acaryochloris sp. CCMEE 5410
ref|WP_025976056.1|  glycosyl transferase                               125   4e-30    
ref|WP_010312701.1|  glycosyl transferase                               127   5e-30    Synechococcus sp. CB0101
ref|WP_011824740.1|  glycosyl transferase                               126   5e-30    
ref|WP_041384827.1|  glycosyl transferase                               126   6e-30    Prochlorococcus marinus
ref|WP_019494764.1|  glycosyl transferase                               126   6e-30    Calothrix sp. PCC 7103
ref|WP_040944064.1|  glycosyl transferase                               123   6e-30    
ref|WP_025939760.1|  glycosyl transferase                               126   8e-30    
ref|WP_040937982.1|  glycosyl transferase                               122   9e-30    
ref|WP_015133176.1|  group 1 glycosyl transferase                       125   1e-29    Leptolyngbya sp. PCC 7376
emb|CAE20224.1|  SqdX                                                   126   1e-29    Prochlorococcus marinus str. MIT 9313
ref|WP_028091028.1|  glycosyl transferase                               125   1e-29    Dolichospermum circinale
ref|WP_015113812.1|  group 1 glycosyl transferase                       125   1e-29    Nostoc sp. PCC 7107
ref|WP_028085475.1|  glycosyl transferase                               125   1e-29    Dolichospermum circinale
ref|WP_017655891.1|  glycosyl transferase                               125   2e-29    Fortiea contorta
ref|WP_023072791.1|  group 1 glycosyl transferase                       125   2e-29    Leptolyngbya sp. Heron Island J
ref|WP_011824631.1|  glycosyl transferase                               125   2e-29    Prochlorococcus marinus
gb|KGF85728.1|  Glycosyltransferase                                     125   2e-29    Prochlorococcus marinus str. GP2
ref|WP_010147154.1|  glycosyl transferase group 1 protein               123   2e-29    
ref|WP_032525173.1|  glycosyl transferase                               125   2e-29    Prochlorococcus marinus
ref|WP_038654761.1|  glycosyl transferase                               125   2e-29    Prochlorococcus sp. MIT 0801
ref|WP_025928974.1|  glycosyl transferase                               124   2e-29    
ref|WP_017713210.1|  glycosyl transferase                               124   3e-29    Prochlorothrix hollandica
ref|WP_036905889.1|  glycosyl transferase                               124   3e-29    Prochlorococcus marinus
ref|WP_025947052.1|  glycosyl transferase                               124   3e-29    
ref|WP_017662025.1|  glycosyl transferase                               124   3e-29    Geitlerinema sp. PCC 7105
ref|WP_025927153.1|  glycosyl transferase                               124   3e-29    
ref|WP_025974177.1|  glycosyl transferase                               124   3e-29    
ref|WP_011295609.1|  glycosyl transferase                               124   3e-29    Prochlorococcus marinus
ref|WP_029421832.1|  glycosyl transferase                               124   3e-29    Alicyclobacillus macrosporangiidus
ref|WP_025927759.1|  MULTISPECIES: glycosyl transferase                 124   3e-29    
ref|WP_025967336.1|  glycosyl transferase                               124   4e-29    
ref|WP_025965084.1|  glycosyl transferase                               124   4e-29    
ref|WP_025913940.1|  MULTISPECIES: glycosyl transferase                 124   4e-29    
ref|WP_025882496.1|  glycosyl transferase                               124   4e-29    
ref|WP_025925654.1|  MULTISPECIES: glycosyl transferase                 124   4e-29    
ref|WP_036899853.1|  glycosyl transferase                               124   4e-29    
ref|WP_025945509.1|  glycosyl transferase                               124   4e-29    
ref|WP_025893675.1|  glycosyl transferase                               124   4e-29    
ref|WP_025971371.1|  glycosyl transferase                               124   4e-29    
ref|WP_025980084.1|  MULTISPECIES: glycosyl transferase                 124   4e-29    Prochlorococcus marinus
ref|WP_025947613.1|  glycosyl transferase                               124   4e-29    
ref|WP_025923704.1|  glycosyl transferase                               124   5e-29    
ref|WP_008180177.1|  glycosyl transferase                               124   5e-29    Moorea producens
gb|ABO18479.1|  SqdX                                                    124   5e-29    Prochlorococcus marinus str. MIT 9301
ref|WP_029150485.1|  glycosyl transferase                               124   5e-29    Microbacterium indicum
ref|WP_025938801.1|  glycosyl transferase                               124   5e-29    
ref|WP_010996422.1|  glycosyl transferase                               124   5e-29    Nostocaceae
ref|WP_042156569.1|  glycosyl transferase                               124   5e-29    Planktothrix agardhii
ref|WP_019474951.1|  glycosyl transferase                               124   5e-29    
ref|WP_012409446.1|  glycosyl transferase                               124   5e-29    Nostoc punctiforme
ref|WP_025968880.1|  glycosyl transferase                               124   6e-29    
ref|WP_011819276.1|  glycosyl transferase                               123   6e-29    Prochlorococcus marinus
ref|WP_010549462.1|  glycosyl transferase                               123   6e-29    Brachybacterium paraconglomeratum
ref|WP_042851210.1|  glycosyl transferase                               123   7e-29    Prochlorococcus sp. MIT 0604
ref|WP_006527890.1|  glycosyltransferase                                123   8e-29    Gloeocapsa sp. PCC 73106
ref|WP_025958086.1|  glycosyl transferase                               122   1e-28    
ref|WP_025921690.1|  glycosyl transferase                               123   1e-28    
ref|WP_026793415.1|  MULTISPECIES: glycosyl transferase                 123   1e-28    Planktothrix
ref|XP_002295162.1|  predicted protein                                  122   1e-28    Thalassiosira pseudonana CCMP1335
ref|WP_011133293.1|  glycosyl transferase                               122   1e-28    Prochlorococcus marinus
ref|WP_032526403.1|  glycosyl transferase                               122   1e-28    Prochlorococcus marinus
ref|WP_025937741.1|  glycosyl transferase                               122   1e-28    Prochlorococcus marinus
ref|WP_011433965.1|  glycosyl transferase                               122   1e-28    Synechococcus sp. JA-2-3B'a(2-13)
gb|ABE11344.1|  SqdX                                                    122   1e-28    uncultured Prochlorococcus marinus clone HOT0M-10E12
ref|WP_032522712.1|  glycosyl transferase                               122   1e-28    Prochlorococcus marinus
ref|WP_019476471.1|  glycosyl transferase                               122   1e-28    
ref|WP_025961606.1|  glycosyl transferase                               122   1e-28    
ref|WP_036533451.1|  glycosyl transferase                               122   1e-28    Neosynechococcus sphagnicola
ref|WP_011377300.1|  glycosyl transferase                               122   1e-28    Prochlorococcus marinus
gb|KGG03241.1|  Glycosyltransferase                                     122   1e-28    Prochlorococcus marinus str. MIT 9321
ref|WP_025934143.1|  MULTISPECIES: glycosyl transferase                 122   1e-28    
ref|WP_032517996.1|  glycosyl transferase                               122   2e-28    Prochlorococcus marinus
ref|WP_032516163.1|  glycosyl transferase                               122   2e-28    Prochlorococcus marinus
ref|WP_015136558.1|  glycosyltransferase                                122   2e-28    Nostoc sp. PCC 7524
ref|WP_017297313.1|  glycosyl transferase                               122   2e-28    Nodosilinea nodulosa
ref|WP_044106990.1|  glycosyl transferase                               122   2e-28    cyanobacterium endosymbiont of Epithemia turgida
ref|XP_009035363.1|  hypothetical protein AURANDRAFT_2613               122   2e-28    Aureococcus anophagefferens
ref|WP_024289317.1|  glycosyl transferase                               122   2e-28    Microbacterium sp. KROCY2
ref|WP_035156195.1|  glycosyl transferase                               122   2e-28    
gb|KGF92154.1|  Glycosyltransferase                                     122   2e-28    
ref|WP_026962708.1|  glycosyl transferase                               122   2e-28    
ref|WP_025965969.1|  glycosyl transferase                               122   2e-28    
ref|WP_025967691.1|  glycosyl transferase                               122   3e-28    
ref|WP_032513539.1|  glycosyl transferase                               122   3e-28    
ref|XP_001421416.1|  predicted protein                                  122   3e-28    
ref|WP_025956304.1|  glycosyl transferase                               122   3e-28    
ref|WP_025915258.1|  glycosyl transferase                               122   3e-28    
ref|WP_025781484.1|  glycosyl transferase                               122   3e-28    
ref|WP_015202192.1|  group 1 glycosyl transferase                       121   3e-28    
ref|WP_038681464.1|  glycosyl transferase                               121   3e-28    
ref|WP_039713912.1|  glycosyl transferase                               121   3e-28    
ref|WP_025922712.1|  MULTISPECIES: glycosyl transferase                 121   4e-28    
ref|WP_025935527.1|  glycosyl transferase                               121   4e-28    
ref|WP_025936122.1|  MULTISPECIES: glycosyl transferase                 121   5e-28    
ref|WP_037218313.1|  glycosyl transferase                               121   5e-28    
emb|CDN11933.1|  Glycosyltransferase                                    121   5e-28    
ref|WP_009768435.1|  glycosyltransferase                                121   5e-28    
ref|WP_040937362.1|  glycosyl transferase                               121   5e-28    
ref|WP_006215756.1|  Glycosyltransferase                                121   5e-28    
ref|WP_039753013.1|  glycosyl transferase                               121   5e-28    
ref|WP_013985336.1|  glycosyl transferase family 1                      120   5e-28    
ref|WP_006308960.1|  glycosyl transferase                               120   5e-28    
ref|WP_015156349.1|  group 1 glycosyl transferase                       120   6e-28    
ref|WP_016953042.1|  glycosyl transferase                               120   6e-28    
ref|WP_025891213.1|  glycosyl transferase                               120   6e-28    
ref|WP_002806204.1|  glycosyl transferase                               120   8e-28    
ref|WP_013192302.1|  glycosyl transferase                               120   8e-28    
ref|WP_011429929.1|  glycosyl transferase                               120   1e-27    
ref|WP_036919584.1|  MULTISPECIES: glycosyl transferase                 120   1e-27    
ref|WP_039202474.1|  glycosyl transferase                               120   1e-27    
ref|WP_017823218.1|  glycosyl transferase                               120   1e-27    
ref|WP_015083608.1|  group 1 glycosyl transferase                       120   1e-27    
gb|EHR37854.1|  hypothetical protein HMPREF9708_00483                   119   1e-27    
ref|WP_025923959.1|  glycosyl transferase                               119   2e-27    
ref|WP_015165224.1|  group 1 glycosyl transferase                       119   2e-27    
ref|XP_011396666.1|  GDP-mannose-dependent alpha-mannosyltransferase    119   2e-27    
ref|WP_012008540.1|  glycosyl transferase                               119   2e-27    
ref|WP_015208499.1|  glycosyltransferase                                119   3e-27    
ref|WP_006617169.1|  glycosyl transferase                               119   3e-27    
ref|WP_008050780.1|  glycosyl transferase                               119   3e-27    
ref|WP_036833280.1|  glycosyl transferase                               118   3e-27    
ref|WP_018021886.1|  hypothetical protein                               118   4e-27    
ref|WP_027403809.1|  glycosyl transferase                               118   4e-27    
ref|WP_006669182.1|  glycosyl transferase                               118   4e-27    
ref|WP_036900899.1|  glycosyl transferase                               118   4e-27    
ref|WP_010313930.1|  glycosyl transferase                               118   5e-27    
ref|WP_015614135.1|  glycosyltransferase                                118   5e-27    
ref|WP_026700800.1|  hypothetical protein                               118   5e-27    
ref|WP_012196344.1|  glycosyl transferase                               118   5e-27    
ref|WP_006625687.1|  glycosyl transferase                               118   5e-27    
ref|YP_002049079.1|  SqdX                                               118   5e-27    
ref|WP_015215962.1|  glycosyl transferase group 1                       118   6e-27    
ref|XP_003083256.1|  sulfolipid synthase (ISS)                          119   6e-27    
ref|WP_015940902.1|  glycosyl transferase family 1                      117   8e-27    
ref|WP_010650574.1|  glycosyl transferase                               117   8e-27    
ref|WP_026974775.1|  glycosyl transferase                               117   8e-27    
ref|WP_011125976.1|  MULTISPECIES: glycosyl transferase                 117   9e-27    
ref|WP_019477192.1|  glycosyl transferase                               117   1e-26    
ref|WP_035833307.1|  glycosyl transferase                               117   1e-26    
emb|CEG01736.1|  Glycosyl transferase, family 1                         120   1e-26    
ref|XP_007514956.1|  SqdX                                               120   1e-26    
ref|WP_038374036.1|  glycosyl transferase                               117   2e-26    
ref|WP_036922652.1|  glycosyl transferase                               117   2e-26    
ref|XP_003057606.1|  glycosyltransferase family 4 protein               119   2e-26    
ref|WP_028782924.1|  glycosyl transferase                               116   2e-26    
ref|WP_020934264.1|  glycogen synthase                                  116   2e-26    
ref|WP_011821147.1|  glycosyl transferase                               116   2e-26    
ref|WP_040447986.1|  glycosyl transferase                               116   2e-26    
ref|WP_017328405.1|  glycosyl transferase                               116   2e-26    
ref|WP_009628051.1|  glycosyl transferase group 1                       116   3e-26    
ref|WP_028457565.1|  glycosyl transferase family 1                      116   3e-26    
ref|WP_005884691.1|  glycosyl transferase family 1                      116   3e-26    
ref|WP_029636073.1|  glycosyl transferase [                             116   3e-26    
ref|WP_015200905.1|  group 1 glycosyl transferase                       115   3e-26    
ref|WP_043694049.1|  glycosyl transferase                               115   3e-26    
ref|WP_011934471.1|  glycosyl transferase                               115   3e-26    
ref|WP_031458015.1|  glycosyl transferase family 1                      115   3e-26    
ref|WP_015124487.1|  glycosyltransferase                                115   4e-26    
ref|WP_006172769.1|  glycosyl transferase                               115   4e-26    
ref|WP_009633426.1|  glycosyltransferase                                115   6e-26    
ref|WP_008276523.1|  glycosyl transferase                               115   7e-26    
ref|WP_038542489.1|  glycosyl transferase                               115   7e-26    
ref|WP_011618042.1|  glycosyl transferase                               115   7e-26    
ref|WP_011126929.1|  glycosyl transferase                               115   7e-26    
ref|WP_006042635.1|  glycosyl transferase                               115   8e-26    
ref|WP_010187536.1|  glycosyl transferase family 1                      115   8e-26    
ref|WP_011931986.1|  glycosyl transferase                               114   8e-26    
ref|WP_015168332.1|  glycosyltransferase                                114   1e-25    
gb|EJY55851.1|  glycosyl transferase group 1                            114   1e-25    
ref|WP_015109858.1|  glycosyltransferase                                114   1e-25    
ref|WP_036822268.1|  glycosyl transferase                               114   1e-25    
ref|WP_012257396.1|  MULTISPECIES: glycosyl transferase family 1        114   1e-25    
ref|WP_040289408.1|  glycosyl transferase                               114   1e-25    
ref|WP_026799308.1|  glycosyl transferase                               114   2e-25    
ref|WP_007099486.1|  glycosyl transferase                               114   2e-25    
ref|WP_014827721.1|  glycosyl transferase                               113   2e-25    
ref|WP_038014997.1|  glycosyl transferase                               113   2e-25    
ref|WP_026963964.1|  glycosyl transferase                               113   2e-25    
gb|EHA59149.1|  glycosyl transferase group 1                            113   2e-25    
ref|WP_035544456.1|  glycosyl transferase                               113   2e-25    
ref|WP_028953281.1|  glycosyl transferase                               113   3e-25    
ref|WP_019507997.1|  glycosyl transferase                               113   3e-25    
ref|WP_005390180.1|  glycosyl transferase family 1                      113   3e-25    
ref|WP_010529716.1|  glycosyl transferase                               113   3e-25    
ref|WP_017314735.1|  glycosyl transferase                               113   3e-25    
gb|KIY98280.1|  sulfoquinovosyltransferase                              114   3e-25    
ref|WP_041840032.1|  glycosyl transferase                               113   3e-25    
ref|WP_015152019.1|  glycosyltransferase                                112   4e-25    
ref|WP_026799309.1|  glycosyl transferase                               112   4e-25    
gb|ACO31913.1|  glycosyl transferase, group 1 family                    113   4e-25    
ref|WP_007101086.1|  glycosyl transferase                               112   4e-25    
ref|WP_031547642.1|  glycosyl transferase                               112   5e-25    
ref|WP_009344130.1|  glycosyl transferase                               112   5e-25    
ref|WP_028125677.1|  glycosyl transferase                               112   5e-25    
ref|WP_005393867.1|  glycosyl transferase family 1                      112   5e-25    
ref|WP_040105286.1|  glycosyl transferase                               112   5e-25    
ref|WP_003846375.1|  glycosyl transferase family 1                      112   5e-25    
ref|XP_009034698.1|  hypothetical protein AURANDRAFT_52616              112   5e-25    
ref|WP_036841630.1|  glycosyl transferase                               112   6e-25    
ref|WP_026961708.1|  glycosyl transferase                               112   6e-25    
gb|AHF62481.1|  SqdX                                                    112   6e-25    
ref|WP_036004685.1|  glycosyl transferase                               112   7e-25    
ref|WP_015118690.1|  glycosyltransferase                                112   7e-25    
ref|WP_007308077.1|  glycosyl transferase                               111   9e-25    
ref|WP_018297528.1|  hypothetical protein                               111   9e-25    
ref|WP_035426801.1|  glycosyl transferase                               111   1e-24    
ref|WP_037329124.1|  glycosyl transferase                               111   1e-24    
ref|WP_039812190.1|  glycosyl transferase                               111   1e-24    
ref|WP_028822531.1|  glycosyl transferase                               111   1e-24    
ref|WP_026936851.1|  glycosyl transferase                               111   1e-24    
dbj|GAK39076.1|  hypothetical protein TCA2_1564                         111   2e-24    
ref|WP_018396637.1|  glycosyl transferase                               111   2e-24    
ref|WP_015195528.1|  glycosyl transferase group 1                       111   2e-24    
gb|KIE08753.1|  glycosyl transferase                                    110   2e-24    
ref|WP_003464026.1|  group 1 glycosyltransferase                        111   2e-24    
ref|WP_038560761.1|  glycosyl transferase                               111   2e-24    
ref|WP_011564279.1|  group 1 glycosyl transferase                       110   2e-24    
ref|WP_035371326.1|  glycosyl transferase family 1                      110   2e-24    
ref|WP_026787523.1|  glycosyl transferase                               110   2e-24    
ref|WP_038551862.1|  glycosyl transferase                               110   2e-24    
ref|WP_030007647.1|  glycosyl transferase                               110   2e-24    
ref|WP_011363092.1|  glycosyl transferase                               110   2e-24    
ref|WP_026797347.1|  glycosyl transferase                               110   2e-24    
ref|WP_012308070.1|  glycosyl transferase                               110   2e-24    
ref|WP_024544755.1|  glycosyl transferase                               110   3e-24    
ref|WP_006275757.1|  glycosyl transferase                               110   3e-24    
ref|WP_012810695.1|  glycosyl transferase                               110   3e-24    
ref|WP_024750270.1|  MULTISPECIES: glycosyl transferase                 110   3e-24    
ref|WP_017744576.1|  glycosyl transferase                               110   3e-24    
ref|WP_017303625.1|  glycosyl transferase                               110   4e-24    
ref|WP_009788501.1|  glycosyl transferase                               110   4e-24    
ref|WP_011358891.1|  glycosyl transferase                               110   4e-24    
gb|ACB50919.1|  probable sulfolipid sulfoquinovosyldiacylglycerol...    110   4e-24    
ref|WP_022925163.1|  glycosyl transferase family 1                      110   4e-24    
ref|WP_035505073.1|  MULTISPECIES: glycosyl transferase                 110   4e-24    
ref|WP_012953900.1|  glycosyl transferase                               109   4e-24    
ref|WP_016456164.1|  hypothetical protein                               109   5e-24    
ref|WP_029089213.1|  glycosyl transferase                               109   6e-24    
ref|WP_035991630.1|  glycosyl transferase                               109   6e-24    
gb|EFR31771.1|  glycosyltransferase, group 1 family protein             109   6e-24    
ref|WP_040466638.1|  glycosyl transferase                               109   7e-24    
ref|WP_040054255.1|  glycosyl transferase                               109   7e-24    
ref|WP_024110873.1|  glycosyltransferase, group 1 family protein        108   8e-24    
ref|XP_002501927.1|  glycosyltransferase family 4 protein               111   9e-24    
gb|AEJ43202.1|  glycosyl transferase group 1                            108   9e-24    
ref|WP_041695102.1|  glycosyl transferase                               108   9e-24    
ref|WP_008340519.1|  glycosyl transferase                               108   9e-24    
ref|WP_041036120.1|  glycosyl transferase                               108   1e-23    
ref|WP_008638153.1|  group 1 glycosyltransferase                        108   1e-23    
ref|WP_011957064.1|  glycosyl transferase family 1                      108   1e-23    
ref|WP_036779033.1|  glycosyl transferase                               108   1e-23    
ref|WP_015142815.1|  glycosyltransferase                                108   1e-23    
ref|XP_005834049.1|  hypothetical protein GUITHDRAFT_45198              108   1e-23    
ref|WP_035388034.1|  glycosyl transferase                               108   1e-23    
ref|WP_016669929.1|  hypothetical protein                               108   2e-23    
ref|WP_025387872.1|  glycosyl transferase                               107   2e-23    
ref|WP_022792548.1|  glycosyl transferase                               107   2e-23    
ref|WP_019478276.1|  glycosyl transferase                               107   2e-23    
ref|WP_022862824.1|  glycosyl transferase family 1                      107   3e-23    
ref|WP_005530085.1|  glycosyl transferase family 1                      107   3e-23    
ref|WP_008587692.1|  glycosyl transferase                               107   3e-23    
ref|WP_013323818.1|  glycosyl transferase                               107   3e-23    
ref|WP_017547727.1|  hypothetical protein                               107   4e-23    
ref|WP_006509265.1|  glycosyltransferase                                107   4e-23    
ref|WP_044304974.1|  glycosyl transferase                               107   4e-23    
ref|WP_027366503.1|  glycosyl transferase                               109   4e-23    
ref|WP_036623311.1|  glycosyl transferase                               107   4e-23    
ref|WP_006822730.1|  glycosyl transferase family 1                      107   4e-23    
ref|WP_027254623.1|  glycosyl transferase                               107   4e-23    
ref|WP_002749281.1|  glycosyl transferases group 1 family protein       106   5e-23    
emb|CCH68234.1|  Glycosyltransferase                                    106   5e-23    
gb|KIJ83524.1|  glycosyl transferase                                    106   5e-23    
ref|WP_012121618.1|  glycosyl transferase family 1                      106   5e-23    
ref|WP_026701316.1|  glycosyl transferase                               106   6e-23    
ref|XP_009492483.1|  hypothetical protein H696_00361                    105   6e-23    
ref|WP_032574249.1|  glycosyl transferase                               102   6e-23    
ref|WP_002765335.1|  glycosyl transferase                               106   6e-23    
ref|WP_044161229.1|  glycosyl transferase                               106   6e-23    
ref|WP_002787970.1|  glycosyl transferase                               106   7e-23    
ref|WP_002752604.1|  glycosyl transferase                               106   7e-23    
ref|WP_016515815.1|  GDP-mannose-dependent alpha-mannosyltransferase    106   7e-23    
ref|WP_008196868.1|  glycosyl transferase                               106   7e-23    
ref|WP_002782662.1|  SqdX protein                                       106   7e-23    
dbj|GAL95034.1|  glycosyl transferase group 1                           106   7e-23    
ref|WP_002775633.1|  glycosyl transferase                               106   7e-23    
ref|WP_002758085.1|  glycosyl transferase                               106   7e-23    
ref|WP_004163138.1|  glycosyl transferase                               106   8e-23    
gb|AAW57084.1|  probable sulfolipid sulfoquinovosyldiacylglycerol...    105   1e-22    
ref|WP_028962733.1|  glycosyl transferase family 1                      105   1e-22    
gb|EJK62906.1|  hypothetical protein THAOC_16464                        106   1e-22    
dbj|GAE95332.1|  glycosyltransferase                                    105   1e-22    
ref|WP_015158023.1|  glycosyltransferase                                105   1e-22    
ref|WP_018932548.1|  hypothetical protein                               105   1e-22    
ref|WP_034663927.1|  glycosyl transferase                               105   2e-22    
ref|WP_020376632.1|  hypothetical protein                               104   2e-22    
gb|AFY33983.1|  glycosyl transferase group 1                            105   2e-22    
ref|WP_014068185.1|  glycosyl transferase family 1                      105   2e-22    
ref|WP_042341390.1|  glycosyl transferase                               104   2e-22    
ref|WP_020006731.1|  hypothetical protein                               104   2e-22    



>gb|KJB17031.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
 gb|KJB17035.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=372

 Score =   317 bits (812),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYRE+LE+LFSGMP VFTGTLQGEELS+AYASGD
Sbjct  180  VEKSLDFLKSVMDRLPEARIAFIGDGPYREDLEKLFSGMPVVFTGTLQGEELSQAYASGD  239

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGG+PDIIP DQ+GK  +LFNPGDLDDCLSK
Sbjct  240  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPADQEGKTGFLFNPGDLDDCLSK  299

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL+++++RET+GKAARQEMEKYDWRAATK IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  300  LKPLLQNKEMRETIGKAARQEMEKYDWRAATKKIRNEQYNAAIWFWRKKRAQLLRPLQWL  359

Query  307  FKRVFQPPQIEYR  269
             KRVF  P+I +R
Sbjct  360  AKRVFPSPKISHR  372



>gb|KJB17033.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=470

 Score =   318 bits (815),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYRE+LE+LFSGMP VFTGTLQGEELS+AYASGD
Sbjct  278  VEKSLDFLKSVMDRLPEARIAFIGDGPYREDLEKLFSGMPVVFTGTLQGEELSQAYASGD  337

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGG+PDIIP DQ+GK  +LFNPGDLDDCLSK
Sbjct  338  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPADQEGKTGFLFNPGDLDDCLSK  397

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL+++++RET+GKAARQEMEKYDWRAATK IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  398  LKPLLQNKEMRETIGKAARQEMEKYDWRAATKKIRNEQYNAAIWFWRKKRAQLLRPLQWL  457

Query  307  FKRVFQPPQIEYR  269
             KRVF  P+I +R
Sbjct  458  AKRVFPSPKISHR  470



>gb|KJB17030.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=516

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYRE+LE+LFSGMP VFTGTLQGEELS+AYASGD
Sbjct  324  VEKSLDFLKSVMDRLPEARIAFIGDGPYREDLEKLFSGMPVVFTGTLQGEELSQAYASGD  383

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGG+PDIIP DQ+GK  +LFNPGDLDDCLSK
Sbjct  384  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPADQEGKTGFLFNPGDLDDCLSK  443

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL+++++RET+GKAARQEMEKYDWRAATK IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  444  LKPLLQNKEMRETIGKAARQEMEKYDWRAATKKIRNEQYNAAIWFWRKKRAQLLRPLQWL  503

Query  307  FKRVFQPPQIEYR  269
             KRVF  P+I +R
Sbjct  504  AKRVFPSPKISHR  516



>gb|KHG08972.1| GDP-mannose-dependent alpha-mannosyltransferase [Gossypium arboreum]
Length=516

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYRE+LE+LFSGMP VFTG LQGEELS+AYASGD
Sbjct  324  VEKSLDFLKSVMDRLPEARIAFIGDGPYREDLEKLFSGMPVVFTGMLQGEELSQAYASGD  383

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +FVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP DQ+GK  +LFNPGDLDDCL+K
Sbjct  384  IFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPADQEGKTGFLFNPGDLDDCLTK  443

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            LGPLL+++++RET+GKAARQEMEKYDWRAATK IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  444  LGPLLQNKEMRETIGKAARQEMEKYDWRAATKKIRNEQYNAAIWFWRKKRAQLLRPLQWL  503

Query  307  FKRVFQPPQIEYR  269
             KRVF  P+I YR
Sbjct  504  AKRVFPSPKISYR  516



>ref|XP_011094980.1| PREDICTED: uncharacterized protein LOC105174543 [Sesamum indicum]
Length=526

 Score =   316 bits (810),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMD LPEARIAFIGDGPYREELE++FSGMPAVFTG LQGEELS+AYASGD
Sbjct  335  VEKSLDFLKRVMDGLPEARIAFIGDGPYREELEKMFSGMPAVFTGMLQGEELSQAYASGD  394

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIP+DQ GK  YLFNPGDLDDCLSK
Sbjct  395  VFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEDQQGKTGYLFNPGDLDDCLSK  454

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+GKAAR EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQ LRPFQWL
Sbjct  455  LKPLLHNQELRETIGKAARVEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQFLRPFQWL  514

Query  307  FKRVFQPPQIE  275
            F+RVF+ P IE
Sbjct  515  FRRVFRAPAIE  525



>gb|KDO53240.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=294

 Score =   306 bits (785),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLPEARIAFIGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  102  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEKMFTGMPAVFTGMLLGEELSQAYASGD  161

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV  RAGGIPDIIP+DQDGKI YLFNPGDLDDCLSK
Sbjct  162  VFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPEDQDGKIGYLFNPGDLDDCLSK  221

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMG+AARQEMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  222  LEPLLYNQELRETMGQAARQEMEKYDWRAATRTIRNEQYNAAIWFWRKKRAQLLRPIQWL  281

Query  307  FKRVFQPPQIEY  272
             KR+F   ++ Y
Sbjct  282  AKRIFPSAEVNY  293



>emb|CDP06508.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   311 bits (797),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EKSLDFLKR+MD+LPEARIAFIGDGPYREELE +F GMPAVF G L GEELS+AYASGDV
Sbjct  243  EKSLDFLKRIMDKLPEARIAFIGDGPYREELENMFRGMPAVFMGMLHGEELSQAYASGDV  302

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+MPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIP+DQ GKI YLFNPGD+DDCLSKL
Sbjct  303  FIMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEDQQGKIGYLFNPGDVDDCLSKL  362

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
             PLL D +LRET+G AAR EMEK+DWRAAT+ IRNEQYNAAIWFWRKKRAQLLRPFQWLF
Sbjct  363  KPLLHDLELRETIGNAARLEMEKFDWRAATRKIRNEQYNAAIWFWRKKRAQLLRPFQWLF  422

Query  304  KRVFQPPQIEYR  269
            KR+FQ P+++YR
Sbjct  423  KRIFQAPEVDYR  434



>ref|XP_008442461.1| PREDICTED: uncharacterized protein LOC103486318 [Cucumis melo]
Length=514

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKR+MDRLPEARIA +GDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  322  VEKSLDFLKRIMDRLPEARIAIVGDGPYREELEKIFTGMPAVFTGMLSGEELSQAYASGD  381

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPV+ ARAGG+PDIIP +QDGKI YL+ PGD+DDCLSK
Sbjct  382  VFVMPSESETLGLVVLEAMSSGIPVIGARAGGVPDIIPPEQDGKIGYLYTPGDIDDCLSK  441

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +R+LRETMGKAAR+EMEKYDW+AAT+ IRNEQYNAAIWFWRKKRAQ LRPFQWL
Sbjct  442  LKPLLENRELRETMGKAAREEMEKYDWKAATRTIRNEQYNAAIWFWRKKRAQFLRPFQWL  501

Query  307  FKRVFQPPQIEYR  269
            FKR+F  P++ Y+
Sbjct  502  FKRIFPSPEVSYQ  514



>ref|XP_006363049.1| PREDICTED: uncharacterized protein LOC102604925 [Solanum tuberosum]
Length=506

 Score =   311 bits (798),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGPYREELE++F GMPAVFTGTL GEELS+AYASGD
Sbjct  314  VEKSLDFLKRVMDRLPGARIAFIGDGPYREELEKMFQGMPAVFTGTLLGEELSQAYASGD  373

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLGLVVLEAMSSG+PVVAARAGG+PDIIPDDQ GKI YLF PGDLDDC+SK
Sbjct  374  VFLMPSESETLGLVVLEAMSSGLPVVAARAGGVPDIIPDDQQGKIGYLFTPGDLDDCMSK  433

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLLRD +LRETMGKAAR EMEKYDW+AAT+ IRNEQY+AAIWFWRK++AQ LRPFQWL
Sbjct  434  LVPLLRDTELRETMGKAARVEMEKYDWKAATRTIRNEQYSAAIWFWRKQKAQFLRPFQWL  493

Query  307  FKRVFQPPQIEYR  269
            F+R+F  P++EYR
Sbjct  494  FQRIFAAPKVEYR  506



>gb|KDO53238.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=377

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLPEARIAFIGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  185  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEKMFTGMPAVFTGMLLGEELSQAYASGD  244

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV  RAGGIPDIIP+DQDGKI YLFNPGDLDDCLSK
Sbjct  245  VFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPEDQDGKIGYLFNPGDLDDCLSK  304

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMG+AARQEMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  305  LEPLLYNQELRETMGQAARQEMEKYDWRAATRTIRNEQYNAAIWFWRKKRAQLLRPIQWL  364

Query  307  FKRVFQPPQIEY  272
             KR+F   ++ Y
Sbjct  365  AKRIFPSAEVNY  376



>ref|XP_011077579.1| PREDICTED: uncharacterized protein LOC105161555 [Sesamum indicum]
Length=520

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 165/187 (88%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMD+LPEARIAFIGDGPYREELE++FSGMPAVFTG LQGEELS+AYASGD
Sbjct  327  VEKSLDFLKRVMDKLPEARIAFIGDGPYREELEQMFSGMPAVFTGMLQGEELSQAYASGD  386

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIP+DQ GK  YLFNPGDLDDCLSK
Sbjct  387  VFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEDQQGKTGYLFNPGDLDDCLSK  446

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D  LRET+GKAAR EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQ L P QWL
Sbjct  447  LKPLLHDSVLRETIGKAARVEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQFLGPLQWL  506

Query  307  FKRVFQP  287
            F+RVFQP
Sbjct  507  FRRVFQP  513



>gb|KDO53239.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=385

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLPEARIAFIGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  193  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEKMFTGMPAVFTGMLLGEELSQAYASGD  252

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV  RAGGIPDIIP+DQDGKI YLFNPGDLDDCLSK
Sbjct  253  VFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPEDQDGKIGYLFNPGDLDDCLSK  312

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMG+AARQEMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  313  LEPLLYNQELRETMGQAARQEMEKYDWRAATRTIRNEQYNAAIWFWRKKRAQLLRPIQWL  372

Query  307  FKRVFQPPQIEY  272
             KR+F   ++ Y
Sbjct  373  AKRIFPSAEVNY  384



>ref|XP_010031046.1| PREDICTED: uncharacterized protein LOC104420932 [Eucalyptus grandis]
Length=377

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLP ARIAFIGDGPYREELE +F+GMPAVFTG LQGEELS+AYASGD
Sbjct  185  VEKSLDFLKSVMDRLPNARIAFIGDGPYREELERMFTGMPAVFTGMLQGEELSQAYASGD  244

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLGLVVLEAMSSGIPVVAARAGG+PDIIP +QDGK S+LF+PGDLDDC+SK
Sbjct  245  VFMMPSESETLGLVVLEAMSSGIPVVAARAGGVPDIIPPEQDGKTSFLFSPGDLDDCMSK  304

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL++ +LRET+GKAAR+EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  305  LEPLLQNSELRETIGKAAREEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQLLRPIQWL  364

Query  307  FKRVFQPPQIEYR  269
             KR F  P+  YR
Sbjct  365  AKRFFPSPEATYR  377



>ref|XP_004137727.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cucumis sativus]
 ref|XP_004156597.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cucumis sativus]
 gb|KGN58788.1| hypothetical protein Csa_3G732460 [Cucumis sativus]
Length=515

 Score =   308 bits (790),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKR+MDRLPEARIA +GDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  323  VEKSLDFLKRIMDRLPEARIAIVGDGPYREELEKIFTGMPAVFTGMLSGEELSQAYASGD  382

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPV+ ARAGG+PDIIP +QDGKI YL+ PGD+DDCLSK
Sbjct  383  VFVMPSESETLGLVVLEAMSSGIPVIGARAGGVPDIIPPEQDGKIGYLYTPGDVDDCLSK  442

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +R+LRETMGKAAR+EMEKYDW+AAT+ IRNEQYNAAIWFWRKKRAQ LRPFQWL
Sbjct  443  LKPLLENRELRETMGKAAREEMEKYDWKAATRTIRNEQYNAAIWFWRKKRAQFLRPFQWL  502

Query  307  FKRVFQPPQIEYR  269
            FKR+F   ++ Y+
Sbjct  503  FKRIFPSSEVSYQ  515



>emb|CBI30420.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   306 bits (783),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLPEARIAFIGDGPYREELE++FSGMPAVFTG LQGEELS+AYASGD
Sbjct  244  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEKMFSGMPAVFTGMLQGEELSQAYASGD  303

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVV ARAGGIPDIIP D +GK  +L+NPGD++DCLSK
Sbjct  304  VFVMPSESETLGLVVLEAMSSGVPVVGARAGGIPDIIPRDDEGKTGFLYNPGDIEDCLSK  363

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL   +LRET+GKAAR+EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  364  LEPLLHSHELRETIGKAAREEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQLLRPLQWL  423

Query  307  FKRVFQPPQIEYR  269
             +  F+ P+I YR
Sbjct  424  TRLFFRTPEINYR  436



>gb|KCW88121.1| hypothetical protein EUGRSUZ_A00516 [Eucalyptus grandis]
Length=422

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLP ARIAFIGDGPYREELE +F+GMPAVFTG LQGEELS+AYASGD
Sbjct  230  VEKSLDFLKSVMDRLPNARIAFIGDGPYREELERMFTGMPAVFTGMLQGEELSQAYASGD  289

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLGLVVLEAMSSGIPVVAARAGG+PDIIP +QDGK S+LF+PGDLDDC+SK
Sbjct  290  VFMMPSESETLGLVVLEAMSSGIPVVAARAGGVPDIIPPEQDGKTSFLFSPGDLDDCMSK  349

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL++ +LRET+GKAAR+EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  350  LEPLLQNSELRETIGKAAREEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQLLRPIQWL  409

Query  307  FKRVFQPPQIEYR  269
             KR F  P+  YR
Sbjct  410  AKRFFPSPEATYR  422



>ref|XP_006429312.1| hypothetical protein CICLE_v10011473mg [Citrus clementina]
 gb|ESR42552.1| hypothetical protein CICLE_v10011473mg [Citrus clementina]
 gb|KDO53237.1| hypothetical protein CISIN_1g009759mg [Citrus sinensis]
Length=526

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLPEARIAFIGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  334  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEKMFTGMPAVFTGMLLGEELSQAYASGD  393

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV  RAGGIPDIIP+DQDGKI YLFNPGDLDDCLSK
Sbjct  394  VFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPEDQDGKIGYLFNPGDLDDCLSK  453

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMG+AARQEMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  454  LEPLLYNQELRETMGQAARQEMEKYDWRAATRTIRNEQYNAAIWFWRKKRAQLLRPIQWL  513

Query  307  FKRVFQPPQIEY  272
             KR+F   ++ Y
Sbjct  514  AKRIFPSAEVNY  525



>ref|XP_002278868.2| PREDICTED: uncharacterized protein LOC100259616 [Vitis vinifera]
Length=519

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLPEARIAFIGDGPYREELE++FSGMPAVFTG LQGEELS+AYASGD
Sbjct  327  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEKMFSGMPAVFTGMLQGEELSQAYASGD  386

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVV ARAGGIPDIIP D +GK  +L+NPGD++DCLSK
Sbjct  387  VFVMPSESETLGLVVLEAMSSGVPVVGARAGGIPDIIPRDDEGKTGFLYNPGDIEDCLSK  446

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL   +LRET+GKAAR+EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  447  LEPLLHSHELRETIGKAAREEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQLLRPLQWL  506

Query  307  FKRVFQPPQIEYR  269
             +  F+ P+I YR
Sbjct  507  TRLFFRTPEINYR  519



>emb|CAN62120.1| hypothetical protein VITISV_037025 [Vitis vinifera]
Length=497

 Score =   305 bits (782),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLPEARIAFIGDGPYREELE++FSGMPAVFTG LQGEELS+AYASGD
Sbjct  305  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEKMFSGMPAVFTGMLQGEELSQAYASGD  364

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVV ARAGGIPDIIP D +GK  +L+NPGD++DCLSK
Sbjct  365  VFVMPSESETLGLVVLEAMSSGVPVVGARAGGIPDIIPRDDEGKTGFLYNPGDIEDCLSK  424

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL   +LRET+GKAAR+EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  425  LEPLLHSHELRETIGKAAREEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQLLRPLQWL  484

Query  307  FKRVFQPPQIEYR  269
             +  F+ P+I YR
Sbjct  485  TRLFFRTPEINYR  497



>ref|XP_011019147.1| PREDICTED: uncharacterized protein LOC105121959 [Populus euphratica]
Length=520

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGPYREELE++F+G+PAVFTG L GEELS+AYASGD
Sbjct  331  VEKSLDFLKRVMDRLPGARIAFIGDGPYREELEKMFTGIPAVFTGMLGGEELSQAYASGD  390

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIP +QDGK  +LFNPGDLDDCLSK
Sbjct  391  VFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIPPEQDGKTGFLFNPGDLDDCLSK  450

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMGKAAR +MEKYDW+AATK IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  451  LEPLLDNQELRETMGKAARHDMEKYDWKAATKKIRNEQYNAAIWFWRKKRAQLLRPIQWL  510

Query  307  FKRVFQPPQI  278
             KR+F  PQ+
Sbjct  511  VKRLFPSPQV  520



>gb|KDP24481.1| hypothetical protein JCGZ_25045 [Jatropha curcas]
Length=437

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP+ARIAFIGDGPYREELE++FSGMPAVFTG L GEELS+AYASGD
Sbjct  245  VEKSLDFLKRVMDRLPDARIAFIGDGPYREELEKMFSGMPAVFTGMLGGEELSQAYASGD  304

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP +QDGKI +L+ PGD+DDCL K
Sbjct  305  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPPEQDGKIGFLYTPGDIDDCLGK  364

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL +++LRETMGKAARQEMEKYDWRAAT+ IRNE YNAAIWFWRKKRAQLLRP QWL
Sbjct  365  LESLLNNQELRETMGKAARQEMEKYDWRAATRKIRNENYNAAIWFWRKKRAQLLRPIQWL  424

Query  307  FKRVFQPPQIEYR  269
             KR+F  P++ YR
Sbjct  425  VKRIFPSPEVNYR  437



>gb|KJB76911.1| hypothetical protein B456_012G112200 [Gossypium raimondii]
Length=244

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYREELE+LF+GMPAVFTG  QGEELS AYASGD
Sbjct  52   VEKSLDFLKSVMDRLPEARIAFIGDGPYREELEKLFTGMPAVFTGMFQGEELSEAYASGD  111

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP +Q+GK  +LF PGD++DC+SK
Sbjct  112  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAEQEGKTGFLFTPGDIEDCMSK  171

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL++++LRET+GKAAR+EMEKYDW+AATK IRNEQY AAIWFWRKKRA+ L P QWL
Sbjct  172  LVPLLQNKELRETIGKAAREEMEKYDWKAATKTIRNEQYEAAIWFWRKKRAEALGPLQWL  231

Query  307  FKRVFQPPQIEYR  269
             KR+F  P I +R
Sbjct  232  TKRLFPSPAINFR  244



>ref|XP_006480973.1| PREDICTED: uncharacterized protein LOC102615235 [Citrus sinensis]
Length=526

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  334  VEKSLDFLKRVMDRLPGARIAFIGDGPYREELEKMFTGMPAVFTGMLLGEELSQAYASGD  393

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV  RAGGIPDIIP+DQDGKI YLFNPGDLDDCLSK
Sbjct  394  VFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPEDQDGKIGYLFNPGDLDDCLSK  453

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMG+AARQEMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  454  LEPLLYNQELRETMGQAARQEMEKYDWRAATRTIRNEQYNAAIWFWRKKRAQLLRPIQWL  513

Query  307  FKRVFQPPQIEY  272
             KR+F   ++ Y
Sbjct  514  AKRIFPSAEVNY  525



>ref|XP_007026774.1| Sulfoquinovosyldiacylglycerol 2 [Theobroma cacao]
 gb|EOY07276.1| Sulfoquinovosyldiacylglycerol 2 [Theobroma cacao]
Length=518

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLP+ARIAFIGDGPYREELE++F+GMPAVFTG LQGEELS+AYASGD
Sbjct  326  VEKSLDFLKSVMDRLPDARIAFIGDGPYREELEKMFTGMPAVFTGMLQGEELSQAYASGD  385

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVV ARAGGIPDIIP +Q+GK  +LFNPGD+DDCLSK
Sbjct  386  VFVMPSESETLGLVVLEAMSSGVPVVGARAGGIPDIIPAEQEGKTGFLFNPGDVDDCLSK  445

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LLR+++LRET+GKAAR+EMEKYDW+AATK IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  446  LEALLRNKELRETIGKAAREEMEKYDWKAATKKIRNEQYNAAIWFWRKKRAQLLRPLQWL  505

Query  307  FKRVFQPPQIEYR  269
             +R+F   ++ YR
Sbjct  506  ARRLFPSQEVNYR  518



>ref|XP_002309122.2| hypothetical protein POPTR_0006s09880g [Populus trichocarpa]
 gb|EEE92645.2| hypothetical protein POPTR_0006s09880g [Populus trichocarpa]
Length=520

 Score =   303 bits (777),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGPYREELE++F+G+PAVFTG L GEELS+AYASGD
Sbjct  331  VEKSLDFLKRVMDRLPGARIAFIGDGPYREELEKMFTGIPAVFTGMLGGEELSQAYASGD  390

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIP +QDGK  +LFNPGDLDDCLSK
Sbjct  391  VFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIPPEQDGKTGFLFNPGDLDDCLSK  450

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMGKAAR +MEKYDW+AATK IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  451  LEPLLDNQELRETMGKAARHDMEKYDWKAATKKIRNEQYNAAIWFWRKKRAQLLRPIQWL  510

Query  307  FKRVFQPPQI  278
             KR+F  P++
Sbjct  511  VKRLFPSPEV  520



>ref|XP_003552228.1| PREDICTED: uncharacterized protein LOC100807850 isoform X1 [Glycine 
max]
Length=515

 Score =   303 bits (776),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKR+MDRLP+ARIAF+GDGPYREELE++F GMPAVFTG L GEELS+AYASGD
Sbjct  323  VEKSLDFLKRLMDRLPDARIAFVGDGPYREELEKMFEGMPAVFTGMLGGEELSQAYASGD  382

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSGIPVVAARAGGIPDIIP DQDGK SYL++PGDL+DCLSK
Sbjct  383  VFVMPSESETLGFVVLEAMSSGIPVVAARAGGIPDIIPADQDGKTSYLYDPGDLEDCLSK  442

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMGKAAR+EMEKYDW+AAT+ IRNEQYNAAIWFWRKKRAQLLRPFQ L
Sbjct  443  LRPLLHNKELRETMGKAAREEMEKYDWKAATRKIRNEQYNAAIWFWRKKRAQLLRPFQRL  502

Query  307  FKRVFQPPQIEYR  269
             K  F  PQ+ YR
Sbjct  503  AKHFFPSPQVNYR  515



>gb|KHN24299.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=437

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKR+MDRLP+ARIAF+GDGPYREELE++F GMPAVFTG L GEELS+AYASGD
Sbjct  245  VEKSLDFLKRLMDRLPDARIAFVGDGPYREELEKMFEGMPAVFTGMLGGEELSQAYASGD  304

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSGIPVVAARAGGIPDIIP DQDGK SYL++P DL+DCLSK
Sbjct  305  VFVMPSESETLGFVVLEAMSSGIPVVAARAGGIPDIIPADQDGKTSYLYDPRDLEDCLSK  364

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMGKAAR+EMEKYDW+AAT+ IRNEQYNAAIWFWRKKRAQLLRPFQ L
Sbjct  365  LRPLLHNKELRETMGKAAREEMEKYDWKAATRKIRNEQYNAAIWFWRKKRAQLLRPFQRL  424

Query  307  FKRVFQPPQIEYR  269
             KR F  PQ+ YR
Sbjct  425  AKRFFPSPQVNYR  437



>ref|XP_006602643.1| PREDICTED: uncharacterized protein LOC100807850 isoform X2 [Glycine 
max]
Length=543

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKR+MDRLP+ARIAF+GDGPYREELE++F GMPAVFTG L GEELS+AYASGD
Sbjct  351  VEKSLDFLKRLMDRLPDARIAFVGDGPYREELEKMFEGMPAVFTGMLGGEELSQAYASGD  410

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSGIPVVAARAGGIPDIIP DQDGK SYL++PGDL+DCLSK
Sbjct  411  VFVMPSESETLGFVVLEAMSSGIPVVAARAGGIPDIIPADQDGKTSYLYDPGDLEDCLSK  470

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMGKAAR+EMEKYDW+AAT+ IRNEQYNAAIWFWRKKRAQLLRPFQ L
Sbjct  471  LRPLLHNKELRETMGKAAREEMEKYDWKAATRKIRNEQYNAAIWFWRKKRAQLLRPFQRL  530

Query  307  FKRVFQPPQIEYR  269
             K  F  PQ+ YR
Sbjct  531  AKHFFPSPQVNYR  543



>gb|KJB17032.1| hypothetical protein B456_002G261700 [Gossypium raimondii]
Length=490

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  817  VMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDVFVMPSESET  638
            VMDRLPEARIAFIGDGPYRE+LE+LFSGMP VFTGTLQGEELS+AYASGDVFVMPSESET
Sbjct  308  VMDRLPEARIAFIGDGPYREDLEKLFSGMPVVFTGTLQGEELSQAYASGDVFVMPSESET  367

Query  637  LGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKLGPLLRDRDL  458
            LGLVVLEAMSSGIPVV ARAGG+PDIIP DQ+GK  +LFNPGDLDDCLSKL PLL+++++
Sbjct  368  LGLVVLEAMSSGIPVVGARAGGVPDIIPADQEGKTGFLFNPGDLDDCLSKLKPLLQNKEM  427

Query  457  RETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLFKRVFQPPQI  278
            RET+GKAARQEMEKYDWRAATK IRNEQYNAAIWFWRKKRAQLLRP QWL KRVF  P+I
Sbjct  428  RETIGKAARQEMEKYDWRAATKKIRNEQYNAAIWFWRKKRAQLLRPLQWLAKRVFPSPKI  487

Query  277  EYR  269
             +R
Sbjct  488  SHR  490



>ref|XP_004246336.1| PREDICTED: uncharacterized protein LOC101252422 [Solanum lycopersicum]
Length=506

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGPYREELE++F GMPAVFTGTL GEELS+AYASGD
Sbjct  314  VEKSLDFLKRVMDRLPGARIAFIGDGPYREELEKMFQGMPAVFTGTLLGEELSQAYASGD  373

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLGLVVLEAMSSG+PVVAARAGG+PDIIPDDQ GKI YLF PGDLDDC+SK
Sbjct  374  VFLMPSESETLGLVVLEAMSSGLPVVAARAGGVPDIIPDDQQGKIGYLFTPGDLDDCMSK  433

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLLRD +LRETMGKAAR EMEKYDW+AAT+ IRNEQY+AAIWF RK++AQ LRPFQWL
Sbjct  434  LVPLLRDIELRETMGKAARIEMEKYDWKAATRTIRNEQYSAAIWFCRKQKAQFLRPFQWL  493

Query  307  FKRVFQPPQIEYR  269
            F+R+F  P+++ R
Sbjct  494  FQRIFAAPEVDCR  506



>ref|XP_009587153.1| PREDICTED: uncharacterized protein LOC104084897 [Nicotiana tomentosiformis]
Length=509

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP+ARIAFIGDGPYREELE++F GMPAVFTG L GEELS+AYASGD
Sbjct  317  VEKSLDFLKRVMDRLPDARIAFIGDGPYREELEKMFHGMPAVFTGMLLGEELSQAYASGD  376

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLGLVVLEAMSSG+PVVAARAGG+PDIIPDDQ GKI YLFNPGDLDDC+SK
Sbjct  377  VFLMPSESETLGLVVLEAMSSGLPVVAARAGGVPDIIPDDQQGKIGYLFNPGDLDDCMSK  436

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLLRD +LRETMGK AR EMEKYDW+AAT+ IRNEQY+AAIWFW+K+R   LRPFQW+
Sbjct  437  LVPLLRDAELRETMGKTARIEMEKYDWKAATRTIRNEQYSAAIWFWKKQRTVFLRPFQWM  496

Query  307  FKRVFQPPQIEYR  269
            F+ +F  P+++YR
Sbjct  497  FRCIFAAPEVDYR  509



>ref|XP_007140380.1| hypothetical protein PHAVU_008G106900g [Phaseolus vulgaris]
 gb|ESW12374.1| hypothetical protein PHAVU_008G106900g [Phaseolus vulgaris]
Length=504

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKR+MDRLP+ARIAF+GDGPYREELE++F GMPAVFTG L GEELS+AYASGD
Sbjct  314  VEKSLDFLKRLMDRLPDARIAFVGDGPYREELEKMFEGMPAVFTGMLGGEELSQAYASGD  373

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIP DQDGK SYL+NPGDL+DCLSK
Sbjct  374  VFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIPADQDGKTSYLYNPGDLEDCLSK  433

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL+++ LRETM KAAR+EMEKYDW+AAT+ IRNEQYNAAIWFWRKKRAQLLRPFQWL
Sbjct  434  LRPLLQNKVLRETMAKAAREEMEKYDWKAATQKIRNEQYNAAIWFWRKKRAQLLRPFQWL  493

Query  307  FKRVFQPPQIE  275
             KR    PQ+ 
Sbjct  494  SKRFSPSPQVN  504



>ref|XP_009787548.1| PREDICTED: uncharacterized protein LOC104235470 [Nicotiana sylvestris]
Length=506

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLPEARIAFIGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  315  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEKMFAGMPAVFTGMLLGEELSQAYASGD  374

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +FVMPSESETLG VVLEAMSSG+PVVAARAGGIPDIIPDDQ GK  +LFNPGDLDDCLSK
Sbjct  375  IFVMPSESETLGFVVLEAMSSGLPVVAARAGGIPDIIPDDQQGKTGFLFNPGDLDDCLSK  434

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D +LR T+G+AAR EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRPFQWL
Sbjct  435  LKPLLHDAELRGTIGQAARVEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQLLRPFQWL  494

Query  307  FKRVFQPPQI  278
            FK   Q P++
Sbjct  495  FKFRVQAPEV  504



>ref|XP_009593273.1| PREDICTED: uncharacterized protein LOC104089958 isoform X2 [Nicotiana 
tomentosiformis]
Length=376

 Score =   296 bits (758),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFL+RVMDRLPEARIAFIGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  185  VEKSLDFLRRVMDRLPEARIAFIGDGPYREELEKMFAGMPAVFTGMLLGEELSQAYASGD  244

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +FVMPSESETLG VVLEAMSSG+PVVAARAGGIPDIIPDDQ GK  +LFNPGDLDDCL+K
Sbjct  245  IFVMPSESETLGFVVLEAMSSGLPVVAARAGGIPDIIPDDQQGKTGFLFNPGDLDDCLNK  304

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D +LR T+G+AAR EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRPFQWL
Sbjct  305  LKPLLHDAELRGTIGQAARVEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQLLRPFQWL  364

Query  307  FKRVFQPPQI  278
             K   Q P++
Sbjct  365  LKFRVQAPEV  374



>ref|XP_010678109.1| PREDICTED: uncharacterized protein LOC104893676 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMD LPEARIAFIGDGPYREELE++F GMPAVFTG LQGEELS+AYAS D
Sbjct  311  VEKSLDFLKRVMDELPEARIAFIGDGPYREELEKIFEGMPAVFTGMLQGEELSQAYASAD  370

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVVA RAGGIPDI+P+DQ+GK  +L++PGDL DCLSK
Sbjct  371  VFVMPSESETLGLVVLEAMSSGIPVVAVRAGGIPDIVPEDQEGKTGFLYSPGDLGDCLSK  430

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D +LRET+GKAARQEMEKYDWRAATK+IRNEQYNAAIWFWRKKR QLLRP QWL
Sbjct  431  LRPLLHDSELRETIGKAARQEMEKYDWRAATKVIRNEQYNAAIWFWRKKRTQLLRPVQWL  490

Query  307  FKRVFQPPQIEYR  269
                 + P++ YR
Sbjct  491  VNFFVKSPEVSYR  503



>ref|XP_009781169.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Nicotiana sylvestris]
Length=508

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP+ RIAFIGDGPYREELE++F GMPAVFTG L GEELS+AYASGD
Sbjct  316  VEKSLDFLKRVMDRLPDVRIAFIGDGPYREELEKMFQGMPAVFTGMLLGEELSQAYASGD  375

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLGLVVLEAMSSG+PVVAARAGG+PDIIPDDQ GKI YLFNPGDLDDC+SK
Sbjct  376  VFLMPSESETLGLVVLEAMSSGLPVVAARAGGVPDIIPDDQQGKIGYLFNPGDLDDCMSK  435

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D +LRETMGK AR EMEKYDW+AAT+ IRNEQY+AAIWFW+K+RA  LRPFQW+
Sbjct  436  LVPLLHDAELRETMGKTARVEMEKYDWKAATRTIRNEQYSAAIWFWKKQRAVFLRPFQWM  495

Query  307  FKRVFQPPQIEYR  269
            F+ +F  P+++YR
Sbjct  496  FRCIFAVPEVDYR  508



>gb|KHN46311.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=441

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK +MDRLPEARIAFIGDGPYREELE++F GMPAVFTG L GEELS+AYASGD
Sbjct  248  VEKSLDFLKSLMDRLPEARIAFIGDGPYREELEKMFEGMPAVFTGMLGGEELSQAYASGD  307

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP+DQDGKI YL+ PGDL+DCLSK
Sbjct  308  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPEDQDGKIGYLYTPGDLEDCLSK  367

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D++LRETMG+AAR EMEKYDWRAAT+ IRNE YNAAIWFWRKKRAQLLRPFQWL
Sbjct  368  LKPLLDDKELRETMGEAARLEMEKYDWRAATQKIRNENYNAAIWFWRKKRAQLLRPFQWL  427

Query  307  FKRVFQPPQIE  275
             +R+F  P  E
Sbjct  428  AQRIFHSPDPE  438



>ref|XP_010101801.1| GDP-mannose-dependent alpha-mannosyltransferase [Morus notabilis]
 gb|EXB89938.1| GDP-mannose-dependent alpha-mannosyltransferase [Morus notabilis]
Length=337

 Score =   293 bits (751),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 176/194 (91%), Gaps = 1/194 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK +MD+LPEARIAFIGDGPYRE+LE++FSGMPAVFTG L GEELS+AYASGD
Sbjct  144  VEKSLDFLKSIMDKLPEARIAFIGDGPYREDLEKMFSGMPAVFTGMLGGEELSQAYASGD  203

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIP DQ+GK S+L+NPGD+DDCLSK
Sbjct  204  VFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPADQEGKTSFLYNPGDVDDCLSK  263

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRE +GKAAR+EMEKYDW+AAT+ IRNEQYNAAIWFWRKKRAQ L P QWL
Sbjct  264  LQPLLHNQELREAIGKAAREEMEKYDWKAATRKIRNEQYNAAIWFWRKKRAQFLGPVQWL  323

Query  307  FKRVFQP-PQIEYR  269
             K +F P P++  R
Sbjct  324  IKCIFPPSPEVNCR  337



>ref|XP_010256624.1| PREDICTED: uncharacterized protein LOC104596978 [Nelumbo nucifera]
Length=509

 Score =   299 bits (765),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKR+MDRLP+ RIAFIGDGPYREELE++FSGMPAVFTGTLQGEELS+AYASGD
Sbjct  317  VEKSLDFLKRIMDRLPDVRIAFIGDGPYREELEKMFSGMPAVFTGTLQGEELSQAYASGD  376

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SGIPVVAARAGGIPDIIP D++GK  +L+NP D++DCLSK
Sbjct  377  VFVMPSESETLGLVVLEAMASGIPVVAARAGGIPDIIPTDKEGKTGFLYNPRDIEDCLSK  436

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LR+T+G+AAR+E EKY WRAAT+ IRNEQYNAAIWFWRKKRAQLLRPF WL
Sbjct  437  LEPLLSNQELRKTIGRAAREETEKYGWRAATRKIRNEQYNAAIWFWRKKRAQLLRPFHWL  496

Query  307  FKRVFQPPQIEY  272
             +R+F+ P++ +
Sbjct  497  IRRIFRSPEVNH  508



>ref|XP_003516943.1| PREDICTED: uncharacterized protein LOC100780899 [Glycine max]
Length=523

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK +MDRLPEARIAFIGDGPYREELE++F GMPAVFTG L GEELS+AYASGD
Sbjct  330  VEKSLDFLKSLMDRLPEARIAFIGDGPYREELEKMFEGMPAVFTGMLGGEELSQAYASGD  389

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGG+PDIIP+DQDGKI YL+ PGDL+DCLSK
Sbjct  390  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPEDQDGKIGYLYTPGDLEDCLSK  449

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D++LRETMG+AAR EMEKYDWRAAT+ IRNE YNAAIWFWRKKRAQLLRPFQWL
Sbjct  450  LKPLLDDKELRETMGEAARLEMEKYDWRAATQKIRNENYNAAIWFWRKKRAQLLRPFQWL  509

Query  307  FKRVFQPPQIE  275
             +R+FQ P  E
Sbjct  510  AQRIFQSPDPE  520



>gb|KJB76912.1| hypothetical protein B456_012G112200 [Gossypium raimondii]
Length=403

 Score =   295 bits (756),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYREELE+LF+GMPAVFTG  QGEELS AYASGD
Sbjct  211  VEKSLDFLKSVMDRLPEARIAFIGDGPYREELEKLFTGMPAVFTGMFQGEELSEAYASGD  270

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP +Q+GK  +LF PGD++DC+SK
Sbjct  271  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAEQEGKTGFLFTPGDIEDCMSK  330

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL++++LRET+GKAAR+EMEKYDW+AATK IRNEQY AAIWFWRKKRA+ L P QWL
Sbjct  331  LVPLLQNKELRETIGKAAREEMEKYDWKAATKTIRNEQYEAAIWFWRKKRAEALGPLQWL  390

Query  307  FKRVFQPPQIEYR  269
             KR+F  P I +R
Sbjct  391  TKRLFPSPAINFR  403



>ref|XP_004249580.1| PREDICTED: uncharacterized protein LOC101249508 [Solanum lycopersicum]
Length=504

 Score =   298 bits (762),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEK+LDFLKR+MDRLPEARIAFIGDGPYREELE++FSGMP VFTG L GEELS+AYASGD
Sbjct  314  VEKNLDFLKRLMDRLPEARIAFIGDGPYREELEKMFSGMPVVFTGMLLGEELSQAYASGD  373

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +FVMPSESETLG VVLEAMSSG+PV+AARAGGIPDIIPDD  GK  YL+NPGD+DDCLSK
Sbjct  374  IFVMPSESETLGFVVLEAMSSGLPVLAARAGGIPDIIPDDHQGKTGYLYNPGDIDDCLSK  433

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL + +LRET+G+AAR EMEK+DWRAAT+ IRNEQYNAAIWFWRKKRAQL RPFQWL
Sbjct  434  LEPLLYNAELRETIGRAARTEMEKFDWRAATRKIRNEQYNAAIWFWRKKRAQLSRPFQWL  493

Query  307  FKRVFQPPQI  278
            FKR  Q P++
Sbjct  494  FKRRLQAPEV  503



>gb|AES79437.2| group 1 family glycosyltransferase [Medicago truncatula]
Length=515

 Score =   298 bits (763),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL F+K VMD+LPEAR+AFIGDGPYREELE +F GMPAVFTG L GE LS+AYASGD
Sbjct  323  VEKSLGFIKGVMDKLPEARVAFIGDGPYREELENMFEGMPAVFTGMLGGEVLSQAYASGD  382

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLG VVLEAMSSGIPVVAARAGGIPDIIP DQ+GK  YL+NPGDL+DCLSK
Sbjct  383  VFIMPSESETLGFVVLEAMSSGIPVVAARAGGIPDIIPADQEGKTGYLYNPGDLEDCLSK  442

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D++LRET+GKAAR EMEK+DW+AAT+ +RNEQYNAAIWFWRKKRA LLRP QW+
Sbjct  443  LKPLLFDKELRETIGKAARNEMEKFDWKAATRKVRNEQYNAAIWFWRKKRAILLRPLQWI  502

Query  307  FKRVFQPPQIEYR  269
             KRVF PPQ+ YR
Sbjct  503  SKRVFPPPQVNYR  515



>gb|KHG00375.1| mgtA [Gossypium arboreum]
Length=275

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYREELE+LF GMPAVFTG LQGEELS AYASGD
Sbjct  83   VEKSLDFLKSVMDRLPEARIAFIGDGPYREELEKLFRGMPAVFTGMLQGEELSEAYASGD  142

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP +Q+GK  +LF PGD +DC+ K
Sbjct  143  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAEQEGKTGFLFTPGDTEDCMRK  202

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+GKAAR+EME YDW+AATK IRNEQY AAIWFWRKKRA+ L P QWL
Sbjct  203  LVPLLENKELRETIGKAAREEMENYDWKAATKTIRNEQYEAAIWFWRKKRAEALGPLQWL  262

Query  307  FKRVFQPPQIEYR  269
             +R+F  P I +R
Sbjct  263  TERLFPSPAINFR  275



>ref|XP_006338993.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Solanum tuberosum]
Length=503

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEK+LDFLKR+MDRLPEARIAFIGDGPYREELE++FSGMP VFTG L GEELS+AYASGD
Sbjct  313  VEKNLDFLKRLMDRLPEARIAFIGDGPYREELEKMFSGMPVVFTGMLLGEELSQAYASGD  372

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +FVMPSESETLG VVLEAMSSG+PV+AARAGGIPDIIPDDQ GK  YL+NPGD+DDCLSK
Sbjct  373  IFVMPSESETLGFVVLEAMSSGLPVLAARAGGIPDIIPDDQQGKTGYLYNPGDIDDCLSK  432

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL + +LRET+G+AAR EMEK+DWRAAT+ IRNEQYNAAIWFWRKKRAQL RPFQWL
Sbjct  433  LEPLLYNAELRETIGRAARTEMEKFDWRAATRKIRNEQYNAAIWFWRKKRAQLSRPFQWL  492

Query  307  FKRVFQPPQI  278
            FKR  Q P++
Sbjct  493  FKRRLQAPKV  502



>ref|XP_008388188.1| PREDICTED: uncharacterized protein LOC103450599 [Malus domestica]
Length=514

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 175/195 (90%), Gaps = 2/195 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYRE+LE+LF GMPAVFTG L GEELS+AYASGD
Sbjct  320  VEKSLDFLKSVMDRLPEARIAFIGDGPYREDLEKLFDGMPAVFTGMLGGEELSQAYASGD  379

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP DQ+GK  +L++  DLDDCLSK
Sbjct  380  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPXDQEGKTGFLYDYNDLDDCLSK  439

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL ++DLRET+GKAAR+EMEKYDW+AAT++IRNEQYNAAIWFWRKKRAQ LRP QW 
Sbjct  440  LQPLLENKDLRETIGKAAREEMEKYDWKAATRVIRNEQYNAAIWFWRKKRAQFLRPLQWF  499

Query  307  FKRVFQP--PQIEYR  269
             KR+F P  P I+YR
Sbjct  500  MKRIFPPTTPAIKYR  514



>gb|KHG00374.1| mgtA [Gossypium arboreum]
Length=244

 Score =   288 bits (736),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 169/193 (88%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYREELE+LF GMPAVFTG LQGEELS AYASGD
Sbjct  52   VEKSLDFLKSVMDRLPEARIAFIGDGPYREELEKLFRGMPAVFTGMLQGEELSEAYASGD  111

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP +Q+GK  +LF PGD +DC+ K
Sbjct  112  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPAEQEGKTGFLFTPGDTEDCMRK  171

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+GKAAR+EME YDW+AATK IRNEQY AAIWFWRKKRA+ L P QWL
Sbjct  172  LVPLLENKELRETIGKAAREEMENYDWKAATKTIRNEQYEAAIWFWRKKRAEALGPLQWL  231

Query  307  FKRVFQPPQIEYR  269
             +R+F  P I +R
Sbjct  232  TERLFPSPAINFR  244



>ref|XP_009593272.1| PREDICTED: uncharacterized protein LOC104089958 isoform X1 [Nicotiana 
tomentosiformis]
Length=505

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFL+RVMDRLPEARIAFIGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  314  VEKSLDFLRRVMDRLPEARIAFIGDGPYREELEKMFAGMPAVFTGMLLGEELSQAYASGD  373

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +FVMPSESETLG VVLEAMSSG+PVVAARAGGIPDIIPDDQ GK  +LFNPGDLDDCL+K
Sbjct  374  IFVMPSESETLGFVVLEAMSSGLPVVAARAGGIPDIIPDDQQGKTGFLFNPGDLDDCLNK  433

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D +LR T+G+AAR EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLLRPFQWL
Sbjct  434  LKPLLHDAELRGTIGQAARVEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQLLRPFQWL  493

Query  307  FKRVFQPPQI  278
             K   Q P++
Sbjct  494  LKFRVQAPEV  503



>ref|XP_003623219.1| Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit 
[Medicago truncatula]
Length=539

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL F+K VMD+LPEAR+AFIGDGPYREELE +F GMPAVFTG L GE LS+AYASGD
Sbjct  347  VEKSLGFIKGVMDKLPEARVAFIGDGPYREELENMFEGMPAVFTGMLGGEVLSQAYASGD  406

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLG VVLEAMSSGIPVVAARAGGIPDIIP DQ+GK  YL+NPGDL+DCLSK
Sbjct  407  VFIMPSESETLGFVVLEAMSSGIPVVAARAGGIPDIIPADQEGKTGYLYNPGDLEDCLSK  466

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D++LRET+GKAAR EMEK+DW+AAT+ +RNEQYNAAIWFWRKKRA LLRP QW+
Sbjct  467  LKPLLFDKELRETIGKAARNEMEKFDWKAATRKVRNEQYNAAIWFWRKKRAILLRPLQWI  526

Query  307  FKRVFQPPQIEYR  269
             KRVF PPQ+ YR
Sbjct  527  SKRVFPPPQVNYR  539



>ref|XP_004302644.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit [Fragaria vesca subsp. vesca]
Length=505

 Score =   295 bits (756),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 178/195 (91%), Gaps = 2/195 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYR ELEELFSGMPAVFTG L GEELS+AYASGD
Sbjct  311  VEKSLDFLKSVMDRLPEARIAFIGDGPYRAELEELFSGMPAVFTGMLGGEELSQAYASGD  370

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLGLVVLEAM+SGIPVVAARAGGIPDIIPDDQ+GK  +L+N  DLDDCLSK
Sbjct  371  VFLMPSESETLGLVVLEAMASGIPVVAARAGGIPDIIPDDQEGKTGFLYNYNDLDDCLSK  430

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+GKAAR+E EK+DW+AAT++IRNEQYNAAIWFWR++RAQ LRP QWL
Sbjct  431  LQPLLENKELRETIGKAARKETEKFDWKAATRVIRNEQYNAAIWFWRRRRAQFLRPLQWL  490

Query  307  FKRVF--QPPQIEYR  269
             KR+F   PP+I+YR
Sbjct  491  MKRIFPQTPPEIKYR  505



>ref|XP_010909645.1| PREDICTED: uncharacterized protein LOC105035694 [Elaeis guineensis]
Length=544

 Score =   296 bits (757),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGPYR ELE++FSGMP VFTG LQGEELS+AYASGD
Sbjct  352  VEKSLDFLKRVMDRLPGARIAFIGDGPYRAELEKMFSGMPVVFTGMLQGEELSQAYASGD  411

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +FVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIP+DQ+GK S+LF PGDLDDC++K
Sbjct  412  IFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPDIIPEDQEGKTSFLFTPGDLDDCVNK  471

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL  ++ RE MG+AAR+EMEKYDW+AAT+ IRNEQYNAAIWFWRKKRAQLLRP QWL
Sbjct  472  IERLLSCKEFREAMGRAAREEMEKYDWKAATRKIRNEQYNAAIWFWRKKRAQLLRPIQWL  531

Query  307  FKRVFQPPQIEY  272
             +R F+ PQ+ Y
Sbjct  532  VRRFFRSPQVNY  543



>gb|KHN22725.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=266

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 171/191 (90%), Gaps = 4/191 (2%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKR    LP+ARIAF+GDGPYREELE++F GMPAVFTG L GEELS+AYASGD
Sbjct  80   VEKSLDFLKR----LPDARIAFVGDGPYREELEKMFEGMPAVFTGMLVGEELSQAYASGD  135

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVVAA AGGIPDIIP DQDGK SYL+NPGD +DCLSK
Sbjct  136  VFVMPSESETLGLVVLEAMSSGIPVVAACAGGIPDIIPVDQDGKTSYLYNPGDFEDCLSK  195

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMGKAAR+EMEKYDW+ AT+ IRNEQYNAAIWFWRKKRAQLLRPFQWL
Sbjct  196  LRPLLLNKELRETMGKAAREEMEKYDWKEATRKIRNEQYNAAIWFWRKKRAQLLRPFQWL  255

Query  307  FKRVFQPPQIE  275
             KR F  PQ+ 
Sbjct  256  AKRFFPSPQVN  266



>ref|XP_011047421.1| PREDICTED: uncharacterized protein LOC105141768 isoform X3 [Populus 
euphratica]
Length=374

 Score =   290 bits (743),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIA IGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  185  VEKSLDFLKRVMDRLPGARIAIIGDGPYREELEKMFTGMPAVFTGMLGGEELSQAYASGD  244

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV  RAGGIPDIIP + DGK  +LFNPGDLDDCLSK
Sbjct  245  VFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPPELDGKTGFLFNPGDLDDCLSK  304

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+GKAARQ+MEKYDW+AATK IRNEQY+AAIWFWR+ RAQLLRP QWL
Sbjct  305  LKPLLDNQELRETIGKAARQDMEKYDWKAATKKIRNEQYSAAIWFWRENRAQLLRPIQWL  364

Query  307  FKRVF  293
              R+F
Sbjct  365  VSRLF  369



>ref|XP_002531354.1| glycosyltransferase, putative [Ricinus communis]
 gb|EEF31038.1| glycosyltransferase, putative [Ricinus communis]
Length=452

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGPYREELEE+FSGMPAVFTG L GEELS+AYASGD
Sbjct  245  VEKSLDFLKRVMDRLPGARIAFIGDGPYREELEEMFSGMPAVFTGMLGGEELSQAYASGD  304

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP +Q+GK  +LFNPGDLDDCL K
Sbjct  305  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPPEQEGKTGFLFNPGDLDDCLGK  364

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL + +LR+TMGKAAR+EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQ LRP QWL
Sbjct  365  LEPLLNNCELRKTMGKAAREEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQFLRPIQWL  424



>gb|EPS57405.1| hypothetical protein M569_17413, partial [Genlisea aurea]
Length=238

 Score =   285 bits (728),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VM  LPEARIAFIGDGPYR ELE++FSGM AVFTG LQGEELS+AYASGD
Sbjct  49   VEKSLDFLKGVMTSLPEARIAFIGDGPYRPELEQMFSGMAAVFTGMLQGEELSQAYASGD  108

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIPD+Q GK  YLFNPGDLDDCL K
Sbjct  109  VFIMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPDEQQGKTGYLFNPGDLDDCLGK  168

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLLRDR+LRE +G+ AR E+EKYDW+AAT+ IR+E YNAAIWFWR+K+A+ LRPFQWL
Sbjct  169  LRPLLRDRELREAIGREARAEVEKYDWKAATRKIRDENYNAAIWFWRRKKAEFLRPFQWL  228

Query  307  FKRVFQPPQI  278
            F++ F  P I
Sbjct  229  FRQFFHVPAI  238



>ref|XP_007205049.1| hypothetical protein PRUPE_ppa004263mg [Prunus persica]
 gb|EMJ06248.1| hypothetical protein PRUPE_ppa004263mg [Prunus persica]
Length=519

 Score =   294 bits (752),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 176/195 (90%), Gaps = 2/195 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYRE+LE+LFSGMPAVFTG L GEELS+AYASGD
Sbjct  325  VEKSLDFLKSVMDRLPEARIAFIGDGPYREDLEKLFSGMPAVFTGMLGGEELSQAYASGD  384

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP DQ+GK  +L++ GD+DDCL K
Sbjct  385  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPLDQEGKTGFLYDYGDVDDCLRK  444

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+G+AAR+EMEKYDW+AAT++IRNEQYNAAIWFWRKKRAQ LRP QW 
Sbjct  445  LQPLLENKELRETIGQAAREEMEKYDWKAATRVIRNEQYNAAIWFWRKKRAQFLRPLQWF  504

Query  307  FKRVF--QPPQIEYR  269
             KR+F   PP+I+ R
Sbjct  505  MKRIFPPSPPEIKCR  519



>ref|XP_002323560.1| SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein [Populus trichocarpa]
 gb|EEF05321.1| SULFOQUINOVOSYLDIACYLGLYCEROL 2 family protein [Populus trichocarpa]
Length=429

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIA IGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  240  VEKSLDFLKRVMDRLPGARIAIIGDGPYREELEKMFTGMPAVFTGMLGGEELSQAYASGD  299

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP + DGK  +LFNPGDLDDCLSK
Sbjct  300  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPPELDGKTGFLFNPGDLDDCLSK  359

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+GKAARQ+ EKYDW+AATK IRNEQY+AAIWFWR+ RAQL RP QWL
Sbjct  360  LEPLLDNQELRETIGKAARQDTEKYDWKAATKKIRNEQYSAAIWFWRENRAQLFRPIQWL  419

Query  307  FKRVFQPPQI  278
             KR+F  P++
Sbjct  420  VKRLFPIPEV  429



>ref|XP_009358856.1| PREDICTED: uncharacterized protein LOC103949460 [Pyrus x bretschneideri]
Length=514

 Score =   293 bits (750),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 158/195 (81%), Positives = 173/195 (89%), Gaps = 2/195 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLP ARIAFIGDGPYRE+LE+LF GMPAVFTG L GEELS+AYASGD
Sbjct  320  VEKSLDFLKSVMDRLPGARIAFIGDGPYREDLEKLFDGMPAVFTGMLGGEELSQAYASGD  379

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP DQ+GK  +L++  DLDDCLSK
Sbjct  380  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPADQEGKTGFLYDYNDLDDCLSK  439

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D+ LRET+GKAAR+EMEKYDW+AAT++IRNEQYNAAIWFWRKKRAQ LRP QW 
Sbjct  440  LQPLLEDKYLRETIGKAAREEMEKYDWKAATRVIRNEQYNAAIWFWRKKRAQFLRPLQWF  499

Query  307  FKRVFQP--PQIEYR  269
             KR+F P  P I+YR
Sbjct  500  MKRIFPPTTPAIKYR  514



>ref|XP_011047420.1| PREDICTED: uncharacterized protein LOC105141768 isoform X2 [Populus 
euphratica]
Length=424

 Score =   290 bits (742),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIA IGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  235  VEKSLDFLKRVMDRLPGARIAIIGDGPYREELEKMFTGMPAVFTGMLGGEELSQAYASGD  294

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV  RAGGIPDIIP + DGK  +LFNPGDLDDCLSK
Sbjct  295  VFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPPELDGKTGFLFNPGDLDDCLSK  354

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+GKAARQ+MEKYDW+AATK IRNEQY+AAIWFWR+ RAQLLRP QWL
Sbjct  355  LKPLLDNQELRETIGKAARQDMEKYDWKAATKKIRNEQYSAAIWFWRENRAQLLRPIQWL  414

Query  307  FKRVF  293
              R+F
Sbjct  415  VSRLF  419



>gb|KHN31576.1| GDP-mannose-dependent alpha-mannosyltransferase [Glycine soja]
Length=441

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK +MDRLPEARIAFIGDGPYREELE++F GMPAVFTG L GEELS AYASGD
Sbjct  248  VEKSLDFLKSLMDRLPEARIAFIGDGPYREELEKMFEGMPAVFTGMLGGEELSEAYASGD  307

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGG+PDIIP+DQDGKI YL+ PGDL+DCLSK
Sbjct  308  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPEDQDGKIGYLYTPGDLEDCLSK  367

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D++LRETMG+AAR EMEKYDWRAAT+ IRNE Y AAIWFWRKKRAQLLRPFQWL
Sbjct  368  LKPLLDDKELRETMGEAARLEMEKYDWRAATRKIRNENYKAAIWFWRKKRAQLLRPFQWL  427

Query  307  FKRVFQPPQIE  275
             + +F  P  E
Sbjct  428  AQPIFPSPDPE  438



>ref|XP_008370134.1| PREDICTED: uncharacterized protein LOC103433646, partial [Malus 
domestica]
Length=422

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 175/195 (90%), Gaps = 2/195 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYRE+LE+LF GMPAVFTG L GEELS+AYASGD
Sbjct  228  VEKSLDFLKSVMDRLPEARIAFIGDGPYREDLEKLFEGMPAVFTGMLGGEELSQAYASGD  287

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP DQ+GK  +L++  DLDDCLSK
Sbjct  288  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPADQEGKTGFLYDYNDLDDCLSK  347

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+G+AAR+EMEKYDW+AAT++IRNEQY+ AIWFWRKKRAQ LRP QW 
Sbjct  348  LQPLLENKELRETIGRAAREEMEKYDWKAATRVIRNEQYSDAIWFWRKKRAQFLRPLQWF  407

Query  307  FKRVFQP--PQIEYR  269
             KR+F P  P+I+YR
Sbjct  408  MKRIFPPTTPEIKYR  422



>gb|EYU26645.1| hypothetical protein MIMGU_mgv1a004620mg [Erythranthe guttata]
Length=518

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLPEARIAFIGDGPYREELE+LFSGMPAVFTGTLQGEELS+AYASGD
Sbjct  325  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEKLFSGMPAVFTGTLQGEELSQAYASGD  384

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIP++Q GK  YLFNP D+DDCLSK
Sbjct  385  VFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEEQQGKTGYLFNPEDIDDCLSK  444

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +R+LRET+GKAAR EMEKYDWRAAT+ IRNEQY  AI FWRK+R + L+PFQWL
Sbjct  445  LKPLLYERELRETIGKAARVEMEKYDWRAATRKIRNEQYRDAILFWRKQREEFLKPFQWL  504

Query  307  FKR  299
             +R
Sbjct  505  IQR  507



>ref|XP_008239560.1| PREDICTED: uncharacterized protein LOC103338145 [Prunus mume]
Length=519

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 175/195 (90%), Gaps = 2/195 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIA IGDGPYRE+LE+LFSGMPAVFTG L GEELS+AYASGD
Sbjct  325  VEKSLDFLKSVMDRLPEARIALIGDGPYREDLEKLFSGMPAVFTGMLGGEELSQAYASGD  384

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP DQ+GK  +L++ GD+DDCL K
Sbjct  385  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPADQEGKTGFLYDYGDVDDCLRK  444

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+GKAAR+EMEKYDW+AAT++IRNEQYNAAIWFWRKKRAQ LRP QW 
Sbjct  445  LQPLLENKELRETIGKAAREEMEKYDWKAATRVIRNEQYNAAIWFWRKKRAQFLRPLQWF  504

Query  307  FKRVF--QPPQIEYR  269
             KR+F   PP+I+ R
Sbjct  505  MKRIFPPSPPEIKCR  519



>ref|XP_006583630.1| PREDICTED: uncharacterized protein LOC100804237 [Glycine max]
Length=366

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 171/191 (90%), Gaps = 4/191 (2%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKR    LP+ARIAF+GDGPYREELE++F GMPAVFTG L GEELS+AYASGD
Sbjct  180  VEKSLDFLKR----LPDARIAFVGDGPYREELEKMFEGMPAVFTGMLVGEELSQAYASGD  235

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVVAA AGGIPDIIP DQDGK SYL+NPGD +DCLSK
Sbjct  236  VFVMPSESETLGLVVLEAMSSGIPVVAACAGGIPDIIPVDQDGKTSYLYNPGDFEDCLSK  295

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRETMGKAAR+EMEKYDW+ AT+ IRNEQYNAAIWFWRKKRAQLLRPFQWL
Sbjct  296  LRPLLLNKELRETMGKAAREEMEKYDWKEATRKIRNEQYNAAIWFWRKKRAQLLRPFQWL  355

Query  307  FKRVFQPPQIE  275
             KR F  PQ+ 
Sbjct  356  AKRFFPSPQVN  366



>ref|XP_009370203.1| PREDICTED: uncharacterized protein LOC103959579 [Pyrus x bretschneideri]
Length=512

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 174/195 (89%), Gaps = 2/195 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIAFIGDGPYRE+LE+LF GMPAVFTG L GEELS+AYASGD
Sbjct  318  VEKSLDFLKSVMDRLPEARIAFIGDGPYREDLEKLFEGMPAVFTGMLGGEELSQAYASGD  377

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP DQ+GK  +L+N  DLDDCLSK
Sbjct  378  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPADQEGKTGFLYNYNDLDDCLSK  437

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+GKAAR+EMEKYDW+AAT++IRNEQY+ AIWFWRKKRAQ LRP QW 
Sbjct  438  LQPLLENKELRETIGKAAREEMEKYDWKAATRVIRNEQYSDAIWFWRKKRAQFLRPLQWF  497

Query  307  FKRVFQP--PQIEYR  269
             K +F P  P+I+YR
Sbjct  498  MKLIFPPTTPEIKYR  512



>ref|XP_011047417.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
 ref|XP_011047418.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
 ref|XP_011047419.1| PREDICTED: uncharacterized protein LOC105141768 isoform X1 [Populus 
euphratica]
Length=429

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIA IGDGPYREELE++F+GMPAVFTG L GEELS+AYASGD
Sbjct  240  VEKSLDFLKRVMDRLPGARIAIIGDGPYREELEKMFTGMPAVFTGMLGGEELSQAYASGD  299

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV  RAGGIPDIIP + DGK  +LFNPGDLDDCLSK
Sbjct  300  VFVMPSESETLGLVVLEAMSSGIPVVGVRAGGIPDIIPPELDGKTGFLFNPGDLDDCLSK  359

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL +++LRET+GKAARQ+MEKYDW+AATK IRNEQY+AAIWFWR+ RAQLLRP QWL
Sbjct  360  LKPLLDNQELRETIGKAARQDMEKYDWKAATKKIRNEQYSAAIWFWRENRAQLLRPIQWL  419

Query  307  FKRVF  293
              R+F
Sbjct  420  VSRLF  424



>ref|XP_008800789.1| PREDICTED: uncharacterized protein LOC103715059 [Phoenix dactylifera]
Length=503

 Score =   291 bits (744),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRL  ARIAFIGDGPYR ELE+LFSGMPAVFTG LQGEELS+AYASGD
Sbjct  311  VEKSLDFLKGVMDRLSGARIAFIGDGPYRPELEQLFSGMPAVFTGMLQGEELSQAYASGD  370

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +FVMPSESETLGLVVLEAMSSGIPVVAARAGGIP+II +DQ+GK S+LF PGDLDDC++K
Sbjct  371  IFVMPSESETLGLVVLEAMSSGIPVVAARAGGIPEIIAEDQEGKTSFLFTPGDLDDCVNK  430

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL  ++ RE MG+ AR+EMEKYDW+AAT+ IRNE YNAAIWFWRKKRAQLLRP QWL
Sbjct  431  IESLLSCKEFREAMGRTAREEMEKYDWKAATRKIRNEHYNAAIWFWRKKRAQLLRPIQWL  490

Query  307  FKRVFQPPQIEY  272
             +R F+ PQ+ Y
Sbjct  491  VRRFFRSPQVNY  502



>ref|XP_003520926.1| PREDICTED: uncharacterized protein LOC100803792 [Glycine max]
Length=517

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK +MDRLPEARIAFIGDGPYREELE++F GMPAVFTG L GEELS AYASGD
Sbjct  324  VEKSLDFLKSLMDRLPEARIAFIGDGPYREELEKMFEGMPAVFTGMLGGEELSEAYASGD  383

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGG+PDIIP+DQDGKI YL+ PGDL+DCLSK
Sbjct  384  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGVPDIIPEDQDGKIGYLYTPGDLEDCLSK  443

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D++LRETMG+AAR EMEKYDWRAAT+ IRNE Y AAIWFWRKKRAQLLRPFQWL
Sbjct  444  LKPLLDDKELRETMGEAARLEMEKYDWRAATRKIRNENYKAAIWFWRKKRAQLLRPFQWL  503

Query  307  FKRVFQPPQIE  275
             + +F  P  E
Sbjct  504  AQPIFPSPDPE  514



>ref|XP_007133940.1| hypothetical protein PHAVU_010G005100g [Phaseolus vulgaris]
 gb|ESW05934.1| hypothetical protein PHAVU_010G005100g [Phaseolus vulgaris]
Length=529

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK +MDRLPEARIAFIGDGPYRE+LE+LF GMPA+FTG L GEELS+AYASGD
Sbjct  332  VEKSLDFLKSLMDRLPEARIAFIGDGPYREDLEKLFEGMPAIFTGMLGGEELSQAYASGD  391

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP+DQDGKI +L+ PGDL+DCLSK
Sbjct  392  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPEDQDGKIGFLYTPGDLEDCLSK  451

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D++LRETMG AAR EMEKYDWRAAT+ IRNE YNAAIWFW KKRAQLLRPFQWL
Sbjct  452  LKPLLEDKELRETMGIAARLEMEKYDWRAATRKIRNENYNAAIWFWNKKRAQLLRPFQWL  511

Query  307  FKRVF  293
             +R+F
Sbjct  512  AQRIF  516



>ref|XP_004506782.1| PREDICTED: GDP-mannose-dependent alpha-mannosyltransferase-like 
[Cicer arietinum]
Length=512

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDR+PEARIAFIGDGPYREELE++F GMPAVFTG L GEELS+AYASGD
Sbjct  322  VEKSLDFLKSVMDRIPEARIAFIGDGPYREELEKMFEGMPAVFTGMLGGEELSQAYASGD  381

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSGIPVV ARAGGIPDIIP+DQDGKI YL+ P DL+DCLSK
Sbjct  382  VFVMPSESETLGQVVLEAMSSGIPVVGARAGGIPDIIPEDQDGKIGYLYTPRDLEDCLSK  441

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D++LRETMGK AR EMEKYDWRAAT+ IRNE YNAAIWFWRKK+AQ+L PFQWL
Sbjct  442  LIPLLHDKELRETMGKTARLEMEKYDWRAATRTIRNENYNAAIWFWRKKKAQVLLPFQWL  501

Query  307  FKRVFQPPQI  278
             KR+F  P++
Sbjct  502  AKRIFPSPEV  511



>gb|EEC81364.1| hypothetical protein OsI_24561 [Oryza sativa Indica Group]
Length=219

 Score =   280 bits (716),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP +RIAF+GDGP+R EL+ +F+GMPAVFTGTLQGEELS+AYASGD
Sbjct  23   VEKSLDFLKRVMDRLPGSRIAFVGDGPFRAELQLMFTGMPAVFTGTLQGEELSQAYASGD  82

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVVAARAGGIPDIIP+DQ+GK S+L+ PGD+DDC+SK
Sbjct  83   VFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPEDQEGKTSFLYTPGDVDDCVSK  142

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LRETM KAAR+EMEK+DWRAAT+ IRNEQY+AAIWFWRKKRAQLLRP QW+
Sbjct  143  IERLLTCEELRETMRKAARKEMEKFDWRAATRKIRNEQYSAAIWFWRKKRAQLLRPIQWV  202

Query  307  FKRVFQP  287
             +R+F+P
Sbjct  203  SRRLFRP  209



>ref|XP_010558362.1| PREDICTED: uncharacterized protein LOC104827042 [Tarenaya hassleriana]
Length=518

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK +MDRLP ARIAFIGDGPYREELE++F+GMPAVFTG LQGEELS+AYASGD
Sbjct  327  VEKSLDFLKSIMDRLPNARIAFIGDGPYREELEKMFAGMPAVFTGMLQGEELSQAYASGD  386

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIP++Q+GK  +LFNPGD++DCLSK
Sbjct  387  VFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEEQEGKTGFLFNPGDVEDCLSK  446

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL D + RET+GKAAR+EMEKYDWRAAT+ IRNEQY+AAIWFWRKKR+QLL PF WL
Sbjct  447  VRQLLDDPEKRETIGKAAREEMEKYDWRAATRKIRNEQYSAAIWFWRKKRSQLLGPFHWL  506

Query  307  FKRVFQPPQIE  275
              R+F  P+++
Sbjct  507  VNRLFPSPEVD  517



>gb|KEH28856.1| group 1 family glycosyltransferase [Medicago truncatula]
Length=375

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIA +GDGPYREELE+L  GMP VFTG L GEELS+AYASGD
Sbjct  185  VEKSLDFLKSVMDRLPEARIAIVGDGPYREELEKLLEGMPVVFTGMLSGEELSQAYASGD  244

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLG VV EA+SSGIPVV ARAGGIPDII +DQDGKI YL+ PGDLDDCLSK
Sbjct  245  VFIMPSESETLGQVVSEALSSGIPVVGARAGGIPDIITEDQDGKIGYLYTPGDLDDCLSK  304

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D +LRETMGKAAR EMEKYDWR AT+ IRNE YN AIWFWRKK+AQLL PFQWL
Sbjct  305  LKPLLHDIELRETMGKAARIEMEKYDWREATRTIRNENYNTAIWFWRKKKAQLLLPFQWL  364

Query  307  FKRVFQPPQI  278
             K +F  P++
Sbjct  365  TKHIFPSPEV  374



>gb|EYU41861.1| hypothetical protein MIMGU_mgv1a004551mg [Erythranthe guttata]
Length=521

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 170/193 (88%), Gaps = 2/193 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMD+LPEARIAFIGDGP+R ELE++FSGM AVFTGTL GEELS+AYASGD
Sbjct  328  VEKSLDFLKGVMDKLPEARIAFIGDGPFRGELEQMFSGMNAVFTGTLHGEELSQAYASGD  387

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +FVMPSESETLG VVLEAMSSG+ VVAARAGGIPDIIP+D +GK  +L+NPGDLDDCLSK
Sbjct  388  IFVMPSESETLGFVVLEAMSSGLAVVAARAGGIPDIIPEDHEGKTGFLYNPGDLDDCLSK  447

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D++LRE +G+ AR EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQ  RPFQW 
Sbjct  448  LKPLLHDQELREVIGREARVEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQFFRPFQWW  507

Query  307  FKRVFQ--PPQIE  275
            F+RV    PP IE
Sbjct  508  FRRVVHAPPPAIE  520



>ref|XP_010553086.1| PREDICTED: uncharacterized protein LOC104823284 [Tarenaya hassleriana]
Length=518

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK +MDRLPEARIAFIGDGPYREELE++F+ MPAVFTG LQGEELS+AYASGD
Sbjct  327  VEKSLDFLKGIMDRLPEARIAFIGDGPYREELEKMFADMPAVFTGMLQGEELSQAYASGD  386

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIP++Q+GK  +LFNPGD++DC+SK
Sbjct  387  VFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEEQEGKTGFLFNPGDVEDCVSK  446

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL + + RE +GKAAR+EMEKYDWRAAT+ IRNEQY+AAIWFWRKKRAQLLRP  WL
Sbjct  447  LKALLDEPEKREIVGKAAREEMEKYDWRAATRKIRNEQYSAAIWFWRKKRAQLLRPIHWL  506

Query  307  FKRVFQPPQIE  275
             KR+F  P++ 
Sbjct  507  VKRLFPAPEVN  517



>gb|ABA55726.1| sulfoquinovosyldiacylglycerol synthase type 2 [Vigna unguiculata]
Length=523

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFL+ +MD LPEARIAFIGDGP RE+LE+LF GMPAVFTG L GEELS+AYASGD
Sbjct  326  VEKSLDFLRSLMDSLPEARIAFIGDGPSREDLEKLFEGMPAVFTGMLGGEELSQAYASGD  385

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSGIPVV ARAGGIPDIIP+DQDGKI +L+ PGDL+DCLSK
Sbjct  386  VFVMPSESETLGLVVLEAMSSGIPVVGARAGGIPDIIPEDQDGKIGFLYTPGDLEDCLSK  445

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D+DLRETMG AAR EMEKYDWRAAT+ IRNE YNAAIWFW KKRAQLLRPFQWL
Sbjct  446  LKPLLDDKDLRETMGIAARLEMEKYDWRAATRKIRNENYNAAIWFWNKKRAQLLRPFQWL  505

Query  307  FKRVF  293
             KR+F
Sbjct  506  AKRIF  510



>ref|XP_003604630.1| Glycogen synthase [Medicago truncatula]
 gb|AES86827.1| group 1 family glycosyltransferase [Medicago truncatula]
Length=510

 Score =   285 bits (729),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLPEARIA +GDGPYREELE+L  GMP VFTG L GEELS+AYASGD
Sbjct  320  VEKSLDFLKSVMDRLPEARIAIVGDGPYREELEKLLEGMPVVFTGMLSGEELSQAYASGD  379

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLG VV EA+SSGIPVV ARAGGIPDII +DQDGKI YL+ PGDLDDCLSK
Sbjct  380  VFIMPSESETLGQVVSEALSSGIPVVGARAGGIPDIITEDQDGKIGYLYTPGDLDDCLSK  439

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PLL D +LRETMGKAAR EMEKYDWR AT+ IRNE YN AIWFWRKK+AQLL PFQWL
Sbjct  440  LKPLLHDIELRETMGKAARIEMEKYDWREATRTIRNENYNTAIWFWRKKKAQLLLPFQWL  499

Query  307  FKRVFQPPQI  278
             K +F  P++
Sbjct  500  TKHIFPSPEV  509



>emb|CDY40313.1| BnaA10g27550D [Brassica napus]
Length=234

 Score =   276 bits (705),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 171/192 (89%), Gaps = 1/192 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPYRE+LE+LF+GMPAVFTG LQGEELSRAYASGD
Sbjct  42   VEKSLELLKSVMDKLPEARIAFIGDGPYREDLEKLFAGMPAVFTGMLQGEELSRAYASGD  101

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP+DQ+GK  +LF+PGD++DC++K
Sbjct  102  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEDQEGKTGFLFSPGDVEDCVTK  161

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL D + R+ +GKAAR+E EKYDWRAAT  IRNEQY+AAIWFWRKK+AQ+L P  WL
Sbjct  162  VRSLLNDSETRDIIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKAQVLGPLNWL  221

Query  307  FKRVFQ-PPQIE  275
             KR+F  PPQ+ 
Sbjct  222  VKRLFPVPPQVN  233



>gb|ACN35476.1| unknown [Zea mays]
 tpg|DAA59314.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=278

 Score =   275 bits (704),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGP+R ELE++FSGMP VFTGTLQGEELS+AYASGD
Sbjct  80   VEKSLDFLKRVMDRLPGARIAFIGDGPFRAELEQMFSGMPVVFTGTLQGEELSQAYASGD  139

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVV ARAGGIPDIIP+DQ+G+ S+L+ PGD+DDC+ K
Sbjct  140  VFVMPSESETLGFVVLEAMSSGVPVVGARAGGIPDIIPEDQEGRTSFLYTPGDVDDCVGK  199

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LRE MG+AAR+EMEK+DWRAAT+ IRNEQY+AAIWFWRKKRAQ+LRP QW+
Sbjct  200  IKRLLSSEELREAMGRAARKEMEKFDWRAATRKIRNEQYSAAIWFWRKKRAQVLRPLQWV  259

Query  307  FK  302
             +
Sbjct  260  LR  261



>ref|XP_009407545.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   283 bits (724),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLK VMDRLP  RIAF+GDGPYR ELE++FSGMP VFTG LQG ELS+AYASGD
Sbjct  315  VEKSLDFLKSVMDRLPGVRIAFVGDGPYRPELEKMFSGMPVVFTGMLQGVELSQAYASGD  374

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLG VVLEAMSSG+PVVAARAGGIPDIIP++Q+GK S+LF PGDLDDC+SK
Sbjct  375  VFMMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPEEQEGKTSFLFAPGDLDDCMSK  434

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL  R+ RE MGKAAR+EMEKYDWRAAT+ IRNEQYNAAIWFWRKKRAQLL P Q L
Sbjct  435  IERLLSCREFREAMGKAAREEMEKYDWRAATRKIRNEQYNAAIWFWRKKRAQLLGPLQRL  494

Query  307  FKRVFQPPQIEY  272
             +R F+ PQI Y
Sbjct  495  VRRFFKSPQINY  506



>ref|XP_004987290.1| PREDICTED: uncharacterized protein LOC101765158 [Setaria italica]
Length=486

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP +RIAFIGDGP+R ELE++FSGMPAVFTGTLQGEELS+AYASGD
Sbjct  289  VEKSLDFLKRVMDRLPGSRIAFIGDGPFRAELEQMFSGMPAVFTGTLQGEELSQAYASGD  348

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVV ARAGGIPDIIP+DQ+GK S+L+ PGD+DDC+SK
Sbjct  349  VFVMPSESETLGFVVLEAMSSGVPVVGARAGGIPDIIPEDQEGKTSFLYTPGDVDDCVSK  408

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LRETMG+AAR+EMEK+DWRAAT+ IRNEQY+AAIWFWRKKRAQLLRP QW+
Sbjct  409  IERLLSCEELRETMGRAARKEMEKFDWRAATRKIRNEQYSAAIWFWRKKRAQLLRPVQWV  468

Query  307  FKRVFQP  287
             +++ +P
Sbjct  469  VRKLVRP  475



>dbj|BAJ85864.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=499

 Score =   282 bits (722),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDF KRVMDRLP ARIAFIGDGP+R ELEE+FSGMPAVFTGTLQGEELS+AYASGD
Sbjct  301  VEKSLDFHKRVMDRLPGARIAFIGDGPFRPELEEMFSGMPAVFTGTLQGEELSQAYASGD  360

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVVAARAGGIPDIIP+DQ+GK S+L+ PGD+DDC+ K
Sbjct  361  VFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPEDQEGKTSFLYTPGDVDDCVGK  420

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LRETMGKAAR+EMEK+ W+AAT+ IRNEQY+AAIWFWRKKR+QLLRP QW+
Sbjct  421  VERLLSCEELRETMGKAARKEMEKFGWKAATRKIRNEQYSAAIWFWRKKRSQLLRPLQWV  480

Query  307  FKRVFQ  290
            F+R+F+
Sbjct  481  FRRLFR  486



>ref|XP_002459190.1| hypothetical protein SORBIDRAFT_02g000240 [Sorghum bicolor]
 gb|EER95711.1| hypothetical protein SORBIDRAFT_02g000240 [Sorghum bicolor]
Length=500

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGP+R ELE++FSGMPAVFTGTLQGEELS+AYASGD
Sbjct  300  VEKSLDFLKRVMDRLPGARIAFIGDGPFRAELEQMFSGMPAVFTGTLQGEELSQAYASGD  359

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSGIPVV ARAGGIPDIIP+DQ+GK S+L+ PGD+DDC+ K
Sbjct  360  VFVMPSESETLGFVVLEAMSSGIPVVGARAGGIPDIIPEDQEGKTSFLYTPGDVDDCVGK  419

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +G LL   +LRE MG+AAR+EMEK+DWRAAT+ IRNEQY+AAIWFWRKKRAQLLRP QW 
Sbjct  420  IGQLLSSEELREAMGRAARKEMEKFDWRAATRKIRNEQYSAAIWFWRKKRAQLLRPLQWA  479

Query  307  FK  302
             +
Sbjct  480  LR  481



>ref|XP_003561543.1| PREDICTED: uncharacterized protein LOC100842407 isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDF KRVMDRLP +RIAFIGDGP+R  LEE+FSGMPAVFTGTLQGEELS+AYASGD
Sbjct  290  VEKSLDFHKRVMDRLPGSRIAFIGDGPFRPVLEEMFSGMPAVFTGTLQGEELSQAYASGD  349

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVVAARAGGIPDIIP+DQ+GK S+L+ PGD+DDC+ K
Sbjct  350  VFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPEDQEGKTSFLYTPGDVDDCVGK  409

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LR+TMGKAAR+EMEK+DW+AAT+ IRNEQY+AAIWFWRKKR+QLLRP QWL
Sbjct  410  VERLLSSEELRQTMGKAARKEMEKFDWKAATRKIRNEQYSAAIWFWRKKRSQLLRPVQWL  469

Query  307  FKRVFQP  287
            F+ +F+P
Sbjct  470  FRGLFRP  476



>ref|NP_001130956.1| uncharacterized protein LOC100192061 precursor [Zea mays]
 gb|ACF79360.1| unknown [Zea mays]
 tpg|DAA59315.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=317

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGP+R ELE++FSGMP VFTGTLQGEELS+AYASGD
Sbjct  119  VEKSLDFLKRVMDRLPGARIAFIGDGPFRAELEQMFSGMPVVFTGTLQGEELSQAYASGD  178

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVV ARAGGIPDIIP+DQ+G+ S+L+ PGD+DDC+ K
Sbjct  179  VFVMPSESETLGFVVLEAMSSGVPVVGARAGGIPDIIPEDQEGRTSFLYTPGDVDDCVGK  238

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LRE MG+AAR+EMEK+DWRAAT+ IRNEQY+AAIWFWRKKRAQ+LRP QW+
Sbjct  239  IKRLLSSEELREAMGRAARKEMEKFDWRAATRKIRNEQYSAAIWFWRKKRAQVLRPLQWV  298

Query  307  FK  302
             +
Sbjct  299  LR  300



>ref|XP_010228495.1| PREDICTED: uncharacterized protein LOC100842407 isoform X1 [Brachypodium 
distachyon]
Length=507

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDF KRVMDRLP +RIAFIGDGP+R  LEE+FSGMPAVFTGTLQGEELS+AYASGD
Sbjct  315  VEKSLDFHKRVMDRLPGSRIAFIGDGPFRPVLEEMFSGMPAVFTGTLQGEELSQAYASGD  374

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVVAARAGGIPDIIP+DQ+GK S+L+ PGD+DDC+ K
Sbjct  375  VFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPEDQEGKTSFLYTPGDVDDCVGK  434

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LR+TMGKAAR+EMEK+DW+AAT+ IRNEQY+AAIWFWRKKR+QLLRP QWL
Sbjct  435  VERLLSSEELRQTMGKAARKEMEKFDWKAATRKIRNEQYSAAIWFWRKKRSQLLRPVQWL  494

Query  307  FKRVFQP  287
            F+ +F+P
Sbjct  495  FRGLFRP  501



>dbj|BAD31817.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 dbj|BAE79759.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 dbj|BAG89787.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP +RIAF+GDGP+R EL+ +F+GMPAVFTGTLQGEELS+AYASGD
Sbjct  283  VEKSLDFLKRVMDRLPGSRIAFVGDGPFRAELQLMFTGMPAVFTGTLQGEELSQAYASGD  342

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVVAARAGGIPDIIP+DQ+GK S+L+ PGD+DDC+SK
Sbjct  343  VFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPEDQEGKTSFLYTPGDVDDCVSK  402

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LRETM KAAR+EMEK+DWRAAT+ IRNEQY+AAIWFWRKKRAQLLRP QW+
Sbjct  403  IERLLTCEELRETMRKAARKEMEKFDWRAATRKIRNEQYSAAIWFWRKKRAQLLRPIQWV  462

Query  307  FKRVFQP  287
             +R+F+P
Sbjct  463  SRRLFRP  469



>emb|CAB69850.1| putative protein [Arabidopsis thaliana]
Length=470

 Score =   279 bits (714),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPY+E+LE+LF+GMPAVFTGTLQG+ELS+AYASGD
Sbjct  279  VEKSLELLKSVMDKLPEARIAFIGDGPYKEDLEKLFTGMPAVFTGTLQGDELSQAYASGD  338

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIP+DQ+GK  +LFNPGD++DC++K
Sbjct  339  VFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTK  398

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL DR+ RE +GKAAR+E EKYDWRAAT  IRNEQY+AAIWFWRKK+  +L P  WL
Sbjct  399  LRTLLHDRETREIIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKVHVLGPINWL  458

Query  307  FKRVFQPPQ  281
             KR+F  P+
Sbjct  459  IKRLFPVPE  467



>gb|AAK76635.1| unknown protein [Arabidopsis thaliana]
Length=434

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPY+E+LE+LF+GMPAVFTGTLQG+ELS+AYASGD
Sbjct  243  VEKSLELLKSVMDKLPEARIAFIGDGPYKEDLEKLFTGMPAVFTGTLQGDELSQAYASGD  302

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIP+DQ+GK  +LFNPGD++DC++K
Sbjct  303  VFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTK  362

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL DR+ RE +GKAAR+E EKYDWRAAT  IRNEQY+AAIWFWRKK+  +L P  WL
Sbjct  363  LRTLLHDRETREIIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKVHVLGPINWL  422

Query  307  FKRVFQPPQ  281
             KR+F  P+
Sbjct  423  IKRLFPVPE  431



>ref|XP_006657378.1| PREDICTED: uncharacterized protein LOC102710508 [Oryza brachyantha]
Length=471

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP +RIAF+GDGP+R ELE +F+GMP VFTGTLQGEELS+AYASGD
Sbjct  275  VEKSLDFLKRVMDRLPGSRIAFVGDGPFRAELELMFTGMPVVFTGTLQGEELSQAYASGD  334

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVVAARAGGIPDIIP+DQ+GK S+L+ PGD+DDC+SK
Sbjct  335  VFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPEDQEGKTSFLYTPGDVDDCVSK  394

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LRETM KAAR+EMEK+DWRAAT+ IRNEQY AAIWFWRKKRAQ+LRP QW+
Sbjct  395  IERLLTCEELRETMRKAARKEMEKFDWRAATRKIRNEQYTAAIWFWRKKRAQVLRPIQWV  454

Query  307  FKRVFQP  287
             +R+F+P
Sbjct  455  ARRLFRP  461



>gb|EMT15547.1| Putative glycosyltransferase [Aegilops tauschii]
Length=509

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDF KRVMDRLP +RIAFIGDGP+R ELEE+FSGMPAVFTGTLQGEELS+AYASGD
Sbjct  311  VEKSLDFHKRVMDRLPGSRIAFIGDGPFRPELEEMFSGMPAVFTGTLQGEELSQAYASGD  370

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVVAARAGGIPDIIP+DQ+GK S+L+ PGD+DDC+ K
Sbjct  371  VFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPEDQEGKTSFLYIPGDVDDCVGK  430

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LRETMGKAAR+EMEK+ W+AAT+ IRNEQY AAIWFWRKKR+QLLRP QW+
Sbjct  431  VELLLSCEELRETMGKAARKEMEKFGWKAATRKIRNEQYTAAIWFWRKKRSQLLRPLQWV  490

Query  307  FKRVFQ  290
            F+R+F+
Sbjct  491  FRRLFR  496



>ref|NP_568085.2| sulfoquinovosyldiacylglycerol 2 [Arabidopsis thaliana]
 gb|AAM18913.1|AF454354_1 sulfolipid synthase [Arabidopsis thaliana]
 gb|AAO64198.1| unknown protein [Arabidopsis thaliana]
 gb|AED90311.1| sulfoquinovosyldiacylglycerol 2 [Arabidopsis thaliana]
 gb|AHL38652.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=510

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPY+E+LE+LF+GMPAVFTGTLQG+ELS+AYASGD
Sbjct  319  VEKSLELLKSVMDKLPEARIAFIGDGPYKEDLEKLFTGMPAVFTGTLQGDELSQAYASGD  378

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIP+DQ+GK  +LFNPGD++DC++K
Sbjct  379  VFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTK  438

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL DR+ RE +GKAAR+E EKYDWRAAT  IRNEQY+AAIWFWRKK+  +L P  WL
Sbjct  439  LRTLLHDRETREIIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKVHVLGPINWL  498

Query  307  FKRVFQPPQ  281
             KR+F  P+
Sbjct  499  IKRLFPVPE  507



>ref|XP_009130666.1| PREDICTED: uncharacterized protein LOC103855432 [Brassica rapa]
Length=525

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 171/192 (89%), Gaps = 1/192 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPYRE+LE+LF+GMPAVFTG LQGEELS+AYASGD
Sbjct  333  VEKSLELLKSVMDKLPEARIAFIGDGPYREDLEKLFAGMPAVFTGMLQGEELSQAYASGD  392

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP++Q+GK  +LFNPGD++DC++K
Sbjct  393  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEEQEGKTGFLFNPGDVEDCVTK  452

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL D++ RE +GKAAR+E EKYDWRAAT  IRNEQY AAIWFWRKK+AQ+L P  WL
Sbjct  453  LRTLLHDKETREIIGKAAREETEKYDWRAATTKIRNEQYGAAIWFWRKKKAQVLGPINWL  512

Query  307  FKRVFQ-PPQIE  275
             KR+F  PP++ 
Sbjct  513  VKRLFPVPPEVN  524



>emb|CDY11210.1| BnaA03g00460D [Brassica napus]
Length=534

 Score =   278 bits (711),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 171/192 (89%), Gaps = 1/192 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPYRE+LE+LF+GMPAVFTG LQGEELS+AYASGD
Sbjct  342  VEKSLELLKSVMDKLPEARIAFIGDGPYREDLEKLFAGMPAVFTGMLQGEELSQAYASGD  401

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP++Q+GK  +LFNPGD++DC++K
Sbjct  402  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEEQEGKTGFLFNPGDVEDCVTK  461

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL D++ RE +GKAAR+E EKYDWRAAT  IRNEQY AAIWFWRKK+AQ+L P  WL
Sbjct  462  LRTLLHDKETREIIGKAAREETEKYDWRAATTKIRNEQYGAAIWFWRKKKAQVLGPINWL  521

Query  307  FKRVFQ-PPQIE  275
             KR+F  PP++ 
Sbjct  522  VKRLFPVPPEVN  533



>emb|CDX97820.1| BnaC04g41190D [Brassica napus]
Length=441

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 170/192 (89%), Gaps = 1/192 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPYRE+LE+LF+GMPAVFTG LQGEELSRAYASGD
Sbjct  246  VEKSLELLKSVMDKLPEARIAFIGDGPYREDLEKLFAGMPAVFTGMLQGEELSRAYASGD  305

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP++Q+GK  +LFNPGD++DC++K
Sbjct  306  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEEQEGKTGFLFNPGDVEDCVTK  365

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL D + R+ +GKAAR+E EKYDWRAAT  IRNEQY AAIWFWR+K+A+LL P  WL
Sbjct  366  LRTLLEDSETRDIIGKAAREETEKYDWRAATTKIRNEQYGAAIWFWRRKKAELLGPLNWL  425

Query  307  FKRVFQ-PPQIE  275
             KR+F  PP++ 
Sbjct  426  VKRLFPVPPEVN  437



>ref|XP_006287534.1| hypothetical protein CARUB_v10000742mg [Capsella rubella]
 gb|EOA20432.1| hypothetical protein CARUB_v10000742mg [Capsella rubella]
Length=514

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPY+E+LE+LF+GMPAVFTG LQG+ELS+AYASGD
Sbjct  323  VEKSLELLKSVMDKLPEARIAFIGDGPYKEDLEKLFTGMPAVFTGMLQGDELSQAYASGD  382

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP+DQ+GK  +LFNPGD++DC++K
Sbjct  383  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTK  442

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL D ++RE +GKAAR+E EKYDWRAAT  IRNEQY+AAIWFWRKK+ Q+L P  WL
Sbjct  443  LRTLLHDSEIREVIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKVQVLGPINWL  502

Query  307  FKRVFQPPQIE  275
             KR+F  P++ 
Sbjct  503  IKRLFPVPEVN  513



>emb|CDX80782.1| BnaC03g00360D [Brassica napus]
Length=426

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 170/191 (89%), Gaps = 1/191 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPYRE+LE+LF+GMPAVFTG LQGEELS+AYASGD
Sbjct  231  VEKSLELLKSVMDKLPEARIAFIGDGPYREDLEKLFTGMPAVFTGMLQGEELSQAYASGD  290

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP++Q+GK  +LFNPGD++DC++K
Sbjct  291  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEEQEGKTGFLFNPGDVEDCVTK  350

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL D + R+ +GKAAR+E EKYDWRAAT  IRNEQY AAIWFWR+K+A+LL P  WL
Sbjct  351  LRTLLEDSETRDIIGKAAREETEKYDWRAATTKIRNEQYGAAIWFWRRKKAELLGPLNWL  410

Query  307  FKRVFQ-PPQI  278
             KR+F  PP++
Sbjct  411  VKRLFPVPPEV  421



>ref|XP_002870938.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47197.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPY+E+LE+LF+GMPAVFTG LQG+ELS+AYASGD
Sbjct  327  VEKSLELLKSVMDKLPEARIAFIGDGPYKEDLEKLFTGMPAVFTGMLQGDELSQAYASGD  386

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP+DQ+GK  +LFNPGD++DC++K
Sbjct  387  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTK  446

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL DR+ RE +GKAAR+E EKYDWRAAT  IRNEQY+AAIWFWRKK+  +L P  WL
Sbjct  447  LRTLLHDRETREIIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKVHVLGPINWL  506

Query  307  FKRVFQPPQIE  275
             KR+F  P++ 
Sbjct  507  IKRLFPVPEVN  517



>ref|XP_008650829.1| PREDICTED: uncharacterized protein LOC100192061 isoform X1 [Zea 
mays]
Length=498

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGP+R ELE++FSGMP VFTGTLQGEELS+AYASGD
Sbjct  300  VEKSLDFLKRVMDRLPGARIAFIGDGPFRAELEQMFSGMPVVFTGTLQGEELSQAYASGD  359

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVV ARAGGIPDIIP+DQ+G+ S+L+ PGD+DDC+ K
Sbjct  360  VFVMPSESETLGFVVLEAMSSGVPVVGARAGGIPDIIPEDQEGRTSFLYTPGDVDDCVGK  419

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LRE MG+AAR+EMEK+DWRAAT+ IRNEQY+AAIWFWRKKRAQ+LRP QW+
Sbjct  420  IKRLLSSEELREAMGRAARKEMEKFDWRAATRKIRNEQYSAAIWFWRKKRAQVLRPLQWV  479

Query  307  FK  302
             +
Sbjct  480  LR  481



>ref|XP_008650830.1| PREDICTED: uncharacterized protein LOC100192061 isoform X2 [Zea 
mays]
 gb|ACN35313.1| unknown [Zea mays]
 tpg|DAA59317.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=497

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP ARIAFIGDGP+R ELE++FSGMP VFTGTLQGEELS+AYASGD
Sbjct  299  VEKSLDFLKRVMDRLPGARIAFIGDGPFRAELEQMFSGMPVVFTGTLQGEELSQAYASGD  358

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVV ARAGGIPDIIP+DQ+G+ S+L+ PGD+DDC+ K
Sbjct  359  VFVMPSESETLGFVVLEAMSSGVPVVGARAGGIPDIIPEDQEGRTSFLYTPGDVDDCVGK  418

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LRE MG+AAR+EMEK+DWRAAT+ IRNEQY+AAIWFWRKKRAQ+LRP QW+
Sbjct  419  IKRLLSSEELREAMGRAARKEMEKFDWRAATRKIRNEQYSAAIWFWRKKRAQVLRPLQWV  478

Query  307  FK  302
             +
Sbjct  479  LR  480



>ref|XP_010490595.1| PREDICTED: uncharacterized protein LOC104768346 [Camelina sativa]
Length=511

 Score =   275 bits (703),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPY+E+LE+LF+GMPAVFTG LQG+ELS+AYASGD
Sbjct  320  VEKSLELLKSVMDKLPEARIAFIGDGPYKEDLEKLFTGMPAVFTGMLQGDELSQAYASGD  379

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP+DQ+GK  +LFNPGD++DC++K
Sbjct  380  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTK  439

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL D + RE +GKAAR+E EKYDWRAAT  IRNEQY+AAIWFWRKK+ Q+L P  WL
Sbjct  440  LRNLLHDSETREIIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKVQVLGPINWL  499

Query  307  FKRVFQPPQIE  275
             KR+F  P++ 
Sbjct  500  VKRLFPVPEVN  510



>ref|XP_010452011.1| PREDICTED: uncharacterized protein LOC104734184 [Camelina sativa]
Length=517

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPY+E+LE+LF+GMPAVFTG LQG+ELS+AYASGD
Sbjct  326  VEKSLELLKSVMDKLPEARIAFIGDGPYKEDLEKLFTGMPAVFTGMLQGDELSQAYASGD  385

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP+DQ+GK  +LFNPGD++DC++K
Sbjct  386  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTK  445

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL D + RE +GKAAR+E EKYDWRAAT  IRNEQY+AAIWFWRKK+ Q+L P  WL
Sbjct  446  LRNLLHDSETREIIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKVQVLGPINWL  505

Query  307  FKRVFQPPQIE  275
             KR+F  P++ 
Sbjct  506  VKRLFPVPEVN  516



>ref|XP_006398643.1| hypothetical protein EUTSA_v10013276mg [Eutrema salsugineum]
 gb|ESQ40096.1| hypothetical protein EUTSA_v10013276mg [Eutrema salsugineum]
Length=516

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPY+E+LE+LF+GMPAVFTG LQG+ELS+AYASGD
Sbjct  325  VEKSLELLKSVMDKLPEARIAFIGDGPYKEDLEKLFTGMPAVFTGMLQGDELSQAYASGD  384

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP+DQ+GK  +LFNPGD++DC++K
Sbjct  385  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTK  444

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL D + RE +GKAAR+E EKYDWRAAT  IRNEQY+AAIWFWRKK+A++L P  WL
Sbjct  445  LRTLLHDSEKREIIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKAEVLGPVHWL  504

Query  307  FKRVFQPPQIE  275
             KR+F  P++ 
Sbjct  505  VKRLFPVPEVN  515



>ref|XP_009122830.1| PREDICTED: uncharacterized protein LOC103847496 [Brassica rapa]
Length=539

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 171/192 (89%), Gaps = 1/192 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPYRE+LE+LF+GMPAVFTG LQGEELS+AYASGD
Sbjct  347  VEKSLELLKSVMDKLPEARIAFIGDGPYREDLEKLFAGMPAVFTGMLQGEELSQAYASGD  406

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP+DQ+GK  +LF+PGD++DC++K
Sbjct  407  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEDQEGKTGFLFSPGDVEDCVTK  466

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL D + R+ +GKAAR+E EKYDWRAAT  IRNEQY+AAIWFWRKK+AQ+L P  WL
Sbjct  467  VRSLLNDSETRDIIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKAQVLGPLNWL  526

Query  307  FKRVFQ-PPQIE  275
             KR+F  PPQ+ 
Sbjct  527  VKRLFPVPPQVN  538



>emb|CDY40312.1| BnaA10g27560D [Brassica napus]
Length=514

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPYRE+LE+LF+GMPAVFTG LQGEELSRAYASGD
Sbjct  324  VEKSLELLKSVMDKLPEARIAFIGDGPYREDLEKLFAGMPAVFTGMLQGEELSRAYASGD  383

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP+DQ+GK  +LF+PGD++DC++K
Sbjct  384  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEDQEGKTGFLFSPGDVEDCVTK  443

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL D + R+ +GKAAR+E EKYDWRAAT  IRNEQY AAIWFWRKK+AQ+L P  WL
Sbjct  444  VRSLLNDSETRDIIGKAAREETEKYDWRAATTKIRNEQYGAAIWFWRKKKAQVLGPLNWL  503

Query  307  FKRVFQPPQ  281
             KR+F  P 
Sbjct  504  VKRLFPVPS  512



>gb|KFK44566.1| hypothetical protein AALP_AA1G274200 [Arabis alpina]
Length=507

 Score =   273 bits (697),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPYRE+LE+LF+GMPAVFTGTL GEELS+AYASGD
Sbjct  316  VEKSLELLKSVMDKLPEARIAFIGDGPYREDLEKLFTGMPAVFTGTLLGEELSQAYASGD  375

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP++Q+GK  +LFNPGD++DC++K
Sbjct  376  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEEQEGKTGFLFNPGDIEDCVTK  435

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL D + RE +GKAAR+E EKYDWRAAT  IRNEQY+ AIWFWR+K+ Q+L P  WL
Sbjct  436  LRTLLHDIETRELIGKAAREETEKYDWRAATTKIRNEQYSEAIWFWRQKKVQVLGPINWL  495

Query  307  FKRVFQPPQIE  275
             KR+F  P++ 
Sbjct  496  VKRLFPVPEVN  506



>ref|XP_009409491.1| PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase 
GPI3 subunit [Musa acuminata subsp. malaccensis]
Length=438

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVM+RLP  RIA +GDGPYR ELE++F+GMPAVFTG LQGEELS+AYASGD
Sbjct  246  VEKSLDFLKRVMERLPGVRIAVVGDGPYRPELEKMFTGMPAVFTGMLQGEELSKAYASGD  305

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF+MPSESETLG VVLEAMSSGIPVVAARAGGIPDIIP++ +G+ S+LF PGDLDDCL+K
Sbjct  306  VFLMPSESETLGQVVLEAMSSGIPVVAARAGGIPDIIPEEHEGRTSFLFTPGDLDDCLNK  365

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   D R+ MG+AAR+EMEK+DWRAAT++IR+E YNAAIWFWRK+RAQLL P QW+
Sbjct  366  IKHLLACDDFRDAMGRAAREEMEKHDWRAATRIIRDENYNAAIWFWRKERAQLLGPIQWM  425

Query  307  FKRVFQPPQ  281
            F+ +   P+
Sbjct  426  FRWMLCSPE  434



>ref|XP_010424824.1| PREDICTED: uncharacterized protein LOC104709996 [Camelina sativa]
Length=666

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSL+ LK VMD+LPEARIAFIGDGPY+E+LE+LF+GMPAVFTG LQG+ELS+AYASGD
Sbjct  475  VEKSLELLKSVMDKLPEARIAFIGDGPYKEDLEKLFTGMPAVFTGMLQGDELSQAYASGD  534

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP+DQ+GK  +LFNPGD++DC++K
Sbjct  535  VFVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEDQEGKTGFLFNPGDVEDCVTK  594

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  LL D + RE +GKAAR+E EKYDWRAAT  IRNEQY+AAIWFWRKK+ Q+L P  WL
Sbjct  595  LKNLLHDSETREIIGKAAREETEKYDWRAATTKIRNEQYSAAIWFWRKKKVQVLGPINWL  654

Query  307  FKRVFQPPQIE  275
             KR+F  P++ 
Sbjct  655  VKRLFPVPEVN  665



>emb|CDY10486.1| BnaCnng03870D [Brassica napus]
Length=417

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            +KSL+ LK VMD+LPEARIAFIGDGPYRE+LE+LF+GMPAVFTG LQGEELS+AYASGDV
Sbjct  228  KKSLELLKSVMDKLPEARIAFIGDGPYREDLEKLFAGMPAVFTGMLQGEELSQAYASGDV  287

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESETLGLVVLEAM+SG+PVVAARAGGIPDIIP+DQ+GK  +LF+PGD++DC++K+
Sbjct  288  FVMPSESETLGLVVLEAMASGLPVVAARAGGIPDIIPEDQEGKTGFLFSPGDVEDCVTKV  347

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              LL D + R+ +GKAAR+E EKYDWRAAT  IRNEQY AAIWFWRKK+AQ+L P  WL 
Sbjct  348  RSLLNDSETRDIIGKAAREETEKYDWRAATTKIRNEQYGAAIWFWRKKKAQVLGPLNWLV  407

Query  304  KRVFQPPQ  281
            KR+F  P 
Sbjct  408  KRLFPVPS  415



>gb|AFW80016.1| hypothetical protein ZEAMMB73_479455 [Zea mays]
Length=297

 Score =   261 bits (666),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EKSLDFLK VM+RLP  RIAFIGDGPYR ELE++F GMPAVFTG +QGEELS+AYASGDV
Sbjct  103  EKSLDFLKMVMERLPGVRIAFIGDGPYRGELEKMFEGMPAVFTGMMQGEELSQAYASGDV  162

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+MPSESETLG VVLE+MSSG+PVVAARAGGIPDIIP+DQ+G+ S+LF PGDLDDCL K+
Sbjct  163  FIMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPEDQEGRTSFLFTPGDLDDCLGKV  222

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              LL +R+ RE MG+ AR EMEK DWRAA+K IRNE YNAAIW+WRKK A+L++P QWL 
Sbjct  223  QQLLTNREFRENMGRTARSEMEKCDWRAASKTIRNEFYNAAIWYWRKKHAELVKPLQWLA  282

Query  304  KRVFQPPQI  278
            +     P++
Sbjct  283  QMFLPAPEV  291



>gb|ACN26074.1| unknown [Zea mays]
 tpg|DAA59313.1| TPA: hypothetical protein ZEAMMB73_291487 [Zea mays]
Length=188

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -1

Query  814  MDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDVFVMPSESETL  635
            MDRLP ARIAFIGDGP+R ELE++FSGMP VFTGTLQGEELS+AYASGDVFVMPSESETL
Sbjct  1    MDRLPGARIAFIGDGPFRAELEQMFSGMPVVFTGTLQGEELSQAYASGDVFVMPSESETL  60

Query  634  GLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKLGPLLRDRDLR  455
            G VVLEAMSSG+PVV ARAGGIPDIIP+DQ+G+ S+L+ PGD+DDC+ K+  LL   +LR
Sbjct  61   GFVVLEAMSSGVPVVGARAGGIPDIIPEDQEGRTSFLYTPGDVDDCVGKIKRLLSSEELR  120

Query  454  ETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLFK  302
            E MG+AAR+EMEK+DWRAAT+ IRNEQY+AAIWFWRKKRAQ+LRP QW+ +
Sbjct  121  EAMGRAARKEMEKFDWRAATRKIRNEQYSAAIWFWRKKRAQVLRPLQWVLR  171



>ref|XP_002457385.1| hypothetical protein SORBIDRAFT_03g006480 [Sorghum bicolor]
 gb|EES02505.1| hypothetical protein SORBIDRAFT_03g006480 [Sorghum bicolor]
Length=430

 Score =   262 bits (669),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLK VMDRLP  RIAFIGDGPYR ELE++F GMPAVFTG +QGEELS+AYASGDV
Sbjct  236  EKNLDFLKMVMDRLPGVRIAFIGDGPYRCELEKMFEGMPAVFTGMMQGEELSQAYASGDV  295

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+MPSESETLG VVLE+MSSG+PVVAARAGGIPDIIP+DQ+GK S+LF PGDLDDCLSK+
Sbjct  296  FIMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPEDQEGKTSFLFTPGDLDDCLSKV  355

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              LL +R+ R+ MG+ AR EMEK DW+AA+K IRNE YNAAIW+WRKKRA+L++P QWL 
Sbjct  356  QQLLTNREFRDNMGRTARSEMEKCDWQAASKTIRNEFYNAAIWYWRKKRAELVKPLQWLA  415

Query  304  KRVFQPPQI  278
            +     P++
Sbjct  416  QMFLPAPEV  424



>ref|NP_001144658.1| uncharacterized protein LOC100277683 [Zea mays]
 gb|ACG42115.1| hypothetical protein [Zea mays]
Length=437

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EKSLDFLK VM+RLP  RIAF+GDGPYR ELE++F GMPAVFTG +QGEELS+AYASGDV
Sbjct  243  EKSLDFLKMVMERLPGVRIAFVGDGPYRGELEKMFEGMPAVFTGMMQGEELSQAYASGDV  302

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+MPSESETLG VVLE+MSSG+PVVAARAGGIPDIIP+DQ+G+ S+LF PGDLDDCL K+
Sbjct  303  FIMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPEDQEGRTSFLFTPGDLDDCLGKV  362

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              LL +R+ R+ MG+ AR EMEK DWRAA+KMIRNE YNAAIW+WRKK A+L++P QWL 
Sbjct  363  QQLLTNREFRDNMGRTARSEMEKCDWRAASKMIRNEFYNAAIWYWRKKHAELVKPLQWLA  422

Query  304  KRVFQPPQI  278
            +     P++
Sbjct  423  QMFLPAPEV  431



>ref|NP_001041991.1| Os01g0142300 [Oryza sativa Japonica Group]
 dbj|BAD61068.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD61477.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF03905.1| Os01g0142300 [Oryza sativa Japonica Group]
 gb|EEE53847.1| hypothetical protein OsJ_00324 [Oryza sativa Japonica Group]
Length=436

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLK VMDRLP  RIAFIGDGPYR ELE++F GMPAVFTG +QGEELS+AYASGDV
Sbjct  242  EKNLDFLKTVMDRLPGVRIAFIGDGPYRSELEKMFEGMPAVFTGMMQGEELSQAYASGDV  301

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESETLG VVLE+MSSG+PVVAARAGG+PDIIP+DQ+GK S+LF PGDL+DCL K+
Sbjct  302  FVMPSESETLGQVVLESMSSGVPVVAARAGGVPDIIPEDQEGKTSFLFTPGDLEDCLGKI  361

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              LL D++ R+ MG  AR EMEK DWRAA+K IRNE YNAAIW+WRKKRA+L++P QWL 
Sbjct  362  QLLLTDKEFRDNMGMTARAEMEKCDWRAASKKIRNEFYNAAIWYWRKKRAELIKPLQWLA  421

Query  304  KRVFQPPQIE  275
            +     P++ 
Sbjct  422  QMFLPAPEVN  431



>ref|XP_004968167.1| PREDICTED: uncharacterized protein LOC101764078 [Setaria italica]
Length=437

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLK VMDRLP  RIAFIGDGPYR ELE++F GMPAVFTG +QGEELS+AYASGDV
Sbjct  243  EKNLDFLKIVMDRLPGVRIAFIGDGPYRTELEKMFEGMPAVFTGMMQGEELSQAYASGDV  302

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESETLG VVLE+MSSG+PVVAARAGGIPDIIP+DQ+GK S+LF PGDLDDC+ K+
Sbjct  303  FVMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPEDQEGKTSFLFTPGDLDDCVGKV  362

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              LL +R+ R+ MG+ AR EMEK DWRAA+K IRNE YNAAIW+WRKKRA+L++P QWL 
Sbjct  363  QLLLTNREFRDNMGRTARAEMEKCDWRAASKTIRNEFYNAAIWYWRKKRAELVQPLQWLA  422

Query  304  KRVFQPPQI  278
            +     P++
Sbjct  423  QMFLPAPEV  431



>gb|EAY72486.1| hypothetical protein OsI_00342 [Oryza sativa Indica Group]
Length=436

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLK VMDRLP  RIAFIGDGPYR ELE++F GMPAVFTG +QGEELS+AYASGDV
Sbjct  242  EKNLDFLKTVMDRLPGVRIAFIGDGPYRSELEKMFEGMPAVFTGMMQGEELSQAYASGDV  301

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESETLG VVLE+MSSG+PVVAARAGG+PDIIP+DQ+GK S+LF PGDL+DCL K+
Sbjct  302  FVMPSESETLGQVVLESMSSGVPVVAARAGGVPDIIPEDQEGKTSFLFTPGDLEDCLGKI  361

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              LL D++ R+ MG  AR EMEK DWRAA+K IRNE YNAAIW+WRKKRA+L++P QWL 
Sbjct  362  QLLLTDKEFRDNMGMTARAEMEKCDWRAASKKIRNEFYNAAIWYWRKKRAELIKPLQWLA  421

Query  304  KRVFQPPQ  281
            +     P+
Sbjct  422  QMFLPAPE  429



>gb|EPS57661.1| hypothetical protein M569_17157, partial [Genlisea aurea]
Length=200

 Score =   251 bits (642),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMD LPEARIAF+GDGPYR ELE LFSG PAVFTG L GEELSRAYASGD
Sbjct  18   VEKSLDFLKRVMDELPEARIAFVGDGPYRAELERLFSGTPAVFTGMLHGEELSRAYASGD  77

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLGLVVLEAMSSG+PVVAARAGGIPDIIPDD+ GK  YL+ PGD+ DCLSK
Sbjct  78   VFVMPSESETLGLVVLEAMSSGLPVVAARAGGIPDIIPDDRRGKTGYLYAPGDVGDCLSK  137

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L PL+ D  LRE +GKAAR ++ KYDWR AT+ IR+E+Y  A+W WR++RA   R F+ L
Sbjct  138  LRPLVGDEKLREAIGKAARADVAKYDWRVATRKIRDEEYGGAVWSWRRRRASFSRHFRRL  197

Query  307  FK  302
            F+
Sbjct  198  FR  199



>ref|XP_006643739.1| PREDICTED: uncharacterized protein LOC102711739 [Oryza brachyantha]
Length=437

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLK VMDRLP  RIAF+GDGPYR ELE++F GMPAVFTG +QGEELS+AYASGDV
Sbjct  243  EKNLDFLKTVMDRLPGVRIAFVGDGPYRSELEKMFEGMPAVFTGMMQGEELSQAYASGDV  302

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESETLG VVLE+MSSG+PVVAARAGGIPDIIP+DQ+GK S+LF PGDL+DC+ K+
Sbjct  303  FVMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPEDQEGKTSFLFTPGDLEDCVGKI  362

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              LL +++ R+ MG  AR EME+ DWRAA+K IRNE YNAAIW+WRKKRA+L++P QWL 
Sbjct  363  QLLLANKEFRDNMGMTARAEMEQCDWRAASKKIRNEFYNAAIWYWRKKRAELIKPLQWLA  422

Query  304  KRVFQPPQ  281
            +     P+
Sbjct  423  QMFLPAPE  430



>ref|XP_003568443.1| PREDICTED: uncharacterized protein LOC100832140 [Brachypodium 
distachyon]
Length=439

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EKSLDFLK VMD+LP  RIAF+GDGPYR ELE++F GMPAVFTG +QGEELS+AYASGD+
Sbjct  244  EKSLDFLKTVMDQLPGVRIAFVGDGPYRTELEKMFEGMPAVFTGMMQGEELSQAYASGDI  303

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESETLG VVLE+MSSG+PVVAARAGGIPDIIP++++GK S+LF PG+LDDC+ K+
Sbjct  304  FVMPSESETLGQVVLESMSSGVPVVAARAGGIPDIIPEEEEGKTSFLFTPGNLDDCVGKI  363

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
              LL DR+ R++MG+ AR EMEK DWR A++ IRNE YN AI++WRKKRA+L++P QWL
Sbjct  364  KLLLTDREFRDSMGRTARAEMEKCDWRTASRTIRNEFYNTAIFYWRKKRAELVQPLQWL  422



>gb|EEE66415.1| hypothetical protein OsJ_22761 [Oryza sativa Japonica Group]
Length=443

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 148/187 (79%), Gaps = 27/187 (14%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDFLKRVMDRLP +RIAF+GDGP+R EL+ +F+GMPAVFTGTLQGEELS+AYASGD
Sbjct  274  VEKSLDFLKRVMDRLPGSRIAFVGDGPFRAELQLMFTGMPAVFTGTLQGEELSQAYASGD  333

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVVAARA                     G + D + +
Sbjct  334  VFVMPSESETLGFVVLEAMSSGVPVVAARA---------------------GGIPDIIPE  372

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
                  D++LRETM KAAR+EMEK+DWRAAT+ IRNEQY+AAIWFWRKKRAQLLRP QW+
Sbjct  373  ------DQELRETMRKAARKEMEKFDWRAATRKIRNEQYSAAIWFWRKKRAQLLRPIQWV  426

Query  307  FKRVFQP  287
             +R+F+P
Sbjct  427  SRRLFRP  433



>gb|EMS60261.1| GDP-mannose-dependent alpha-mannosyltransferase [Triticum urartu]
Length=591

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 157/186 (84%), Gaps = 1/186 (1%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLK VMDRLP  RIAFIGDGPYR ELE++F GMPAVFTG +QGEELS+AYASGDV
Sbjct  395  EKNLDFLKMVMDRLPGVRIAFIGDGPYRTELEKMFEGMPAVFTGMMQGEELSQAYASGDV  454

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESETLG VVLE+MSSG+PVVA RAGGIPDIIP+D +G+ S+LF PGDLDDC+ K+
Sbjct  455  FVMPSESETLGQVVLESMSSGVPVVAVRAGGIPDIIPEDVEGRTSFLFAPGDLDDCVGKI  514

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              LL D + R  MG+ AR EMEK DWRAA+K IRNE Y++AI +WRKK+A++++P QWL 
Sbjct  515  RLLLTDDEFRGEMGRTARAEMEKCDWRAASKTIRNEFYSSAIDYWRKKQAEMVQPLQWL-  573

Query  304  KRVFQP  287
             ++F P
Sbjct  574  AQMFMP  579



>emb|CDM81044.1| unnamed protein product [Triticum aestivum]
Length=440

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLK VMDRLP  RIAF+GDGPYR ELE++F GMPAVFTG +QGEELS+ YASGDV
Sbjct  244  EKNLDFLKMVMDRLPGVRIAFVGDGPYRTELEKMFEGMPAVFTGMMQGEELSQVYASGDV  303

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESETLG VVLE+MSSG+PVVA RAGGIPDIIP D +G+ S+LF PGDLDDC+ K+
Sbjct  304  FVMPSESETLGQVVLESMSSGVPVVAVRAGGIPDIIPGDAEGRTSFLFAPGDLDDCVGKI  363

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              LL D + R  MG+ AR EMEK DWRAA+K IRNE Y++AI +WRKK+A +++P QWL 
Sbjct  364  RLLLTDDEFRGDMGRTARAEMEKCDWRAASKTIRNEFYSSAIDYWRKKQADIVQPLQWL-  422

Query  304  KRVFQP  287
             ++F P
Sbjct  423  AQMFMP  428



>ref|XP_002468134.1| hypothetical protein SORBIDRAFT_01g040150 [Sorghum bicolor]
 gb|EER95132.1| hypothetical protein SORBIDRAFT_01g040150 [Sorghum bicolor]
Length=414

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM+RLP ARIAF+GDGPYR ELE++F GMPAVFTG LQGEELS+AYAS DV
Sbjct  242  EKNLDFLKRVMERLPGARIAFVGDGPYRAELEKMFMGMPAVFTGMLQGEELSQAYASADV  301

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  302  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  361

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              LL  +DLRET+GKAAR+EMEK DWRAA+K IRNE Y+ AI +WRKK
Sbjct  362  EQLLNSKDLRETIGKAAREEMEKCDWRAASKKIRNEHYSTAISYWRKK  409



>ref|XP_008653982.1| PREDICTED: uncharacterized protein LOC103634168 [Zea mays]
 tpg|DAA44537.1| TPA: hypothetical protein ZEAMMB73_879639 [Zea mays]
Length=429

 Score =   238 bits (608),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM+RLP ARIAF+GDGPYR ELE++F+GMPAVFTG LQGEELS+AYASGDV
Sbjct  242  EKNLDFLKRVMERLPGARIAFVGDGPYRSELEKMFTGMPAVFTGMLQGEELSQAYASGDV  301

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  302  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  361

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              LL  +DLRET+G AAR+EMEK DWR A+K IRNE Y+ AI +WRKK
Sbjct  362  EQLLSSKDLRETIGMAAREEMEKCDWRTASKKIRNEHYSTAISYWRKK  409



>gb|EMT15719.1| Putative glycosyltransferase [Aegilops tauschii]
Length=410

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLK VMDRLP  RIAFIGDGPYR ELE++F GMPAVFTG +QG ELS+AYASGDV
Sbjct  215  EKNLDFLKTVMDRLPGVRIAFIGDGPYRAELEKMFEGMPAVFTGMMQGGELSQAYASGDV  274

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESETLG VVLE+MSSG+PVVA RAGGIPDIIP+D +G+ S+LF PGDLDDC+ K+
Sbjct  275  FVMPSESETLGQVVLESMSSGVPVVAVRAGGIPDIIPEDVEGRTSFLFAPGDLDDCVGKI  334

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              LL D + R  MG+ AR  MEK DWRAA+K IRNE Y++AI +WRKK+A++++P QWL 
Sbjct  335  RLLLADDEFRGDMGRTARAAMEKCDWRAASKTIRNEFYSSAIDYWRKKQAEIVQPLQWL-  393

Query  304  KRVFQP  287
             ++F P
Sbjct  394  AQMFMP  399



>ref|NP_001150015.1| glycosyl transferase, group 1 family protein [Zea mays]
 gb|ACG37508.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM+RLP ARIAF+GDGPYR ELE++F GMPAVFTG LQGEELS+AYAS DV
Sbjct  242  EKNLDFLKRVMERLPGARIAFVGDGPYRAELEKMFMGMPAVFTGMLQGEELSQAYASADV  301

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  302  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  361

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              +L  +DLRET+GKAAR+EMEK DWRAA+K IRNE Y+ AI +WRKK
Sbjct  362  EQVLNSKDLRETVGKAAREEMEKCDWRAASKKIRNEHYSTAISYWRKK  409



>gb|ACG31912.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM+RLP ARIAF+GDGPYR ELE++F GMPAVFTG LQGEELS+AYAS DV
Sbjct  242  EKNLDFLKRVMERLPGARIAFVGDGPYRAELEKMFMGMPAVFTGMLQGEELSQAYASADV  301

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  302  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  361

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              +L  +DLRET+GKAAR+EMEK DWRAA+K IRNE Y+ AI +WRKK
Sbjct  362  EQVLNSKDLRETVGKAAREEMEKCDWRAASKKIRNEHYSTAISYWRKK  409



>gb|ACN34235.1| unknown [Zea mays]
 gb|AFW88879.1| glycosyl transferase, group 1 family protein [Zea mays]
Length=414

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM+RLP ARIAF+GDGPYR ELE++F GMPAVFTG LQGEELS+AYAS DV
Sbjct  242  EKNLDFLKRVMERLPGARIAFVGDGPYRAELEKMFMGMPAVFTGMLQGEELSQAYASADV  301

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  302  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  361

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              +L  +DLRET+GKAAR+EMEK DWRAA+K IRNE Y+ AI +WRKK
Sbjct  362  EQVLSSKDLRETVGKAAREEMEKCDWRAASKKIRNEHYSTAISYWRKK  409



>ref|XP_003558286.1| PREDICTED: uncharacterized protein LOC100846446 [Brachypodium 
distachyon]
Length=420

 Score =   236 bits (602),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM+RLP ARIAF+GDGPYR ELE++F+GMPAVFTG LQGEELS+AYASGDV
Sbjct  248  EKNLDFLKRVMERLPAARIAFVGDGPYRAELEKMFTGMPAVFTGMLQGEELSQAYASGDV  307

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  308  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  367

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQ  332
              LL  +DLRE++G+AAR+EME  DWRAA+K IRNE Y+ A  +WRKK  +
Sbjct  368  EQLLFSKDLRESIGRAAREEMENCDWRAASKTIRNEHYSTATTYWRKKTGK  418



>ref|XP_004984689.1| PREDICTED: uncharacterized protein LOC101779471 [Setaria italica]
Length=413

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM+RLP +RIAF+GDGPYR ELE+LF+GMPAVFTG LQGEELS+AYAS DV
Sbjct  242  EKNLDFLKRVMERLPGSRIAFVGDGPYRAELEKLFTGMPAVFTGMLQGEELSQAYASADV  301

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  302  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  361

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              LL+ +DLRE++GKAAR+EMEK DWRAA++ IRNE Y+ A+ +WRKK
Sbjct  362  EQLLKSKDLRESVGKAAREEMEKCDWRAASRKIRNEHYSTAMSYWRKK  409



>ref|XP_006649799.1| PREDICTED: uncharacterized protein LOC102700221 [Oryza brachyantha]
Length=417

 Score =   230 bits (587),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM+RLP  RIAF+GDGPYR ELE +F+GMPAVFTG LQGEELS+AYASGD+
Sbjct  245  EKNLDFLKRVMERLPGVRIAFVGDGPYRTELERMFTGMPAVFTGMLQGEELSQAYASGDL  304

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  305  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  364

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              LL  +DL E++G+AAR+EMEK DWRAA+K IRNE Y+ A  +WRKK
Sbjct  365  EQLLSSKDLIESIGRAAREEMEKCDWRAASKKIRNEHYSTATIYWRKK  412



>gb|EAY89357.1| hypothetical protein OsI_10861 [Oryza sativa Indica Group]
Length=415

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM+RLP  RIAF+GDGPYR ELE +F+GMPAVFTG LQGEELS+AYASGD+
Sbjct  243  EKNLDFLKRVMERLPGVRIAFVGDGPYRAELERMFTGMPAVFTGMLQGEELSQAYASGDL  302

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  303  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  362

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              LL  + LRE++G+AAR+EMEK DWRAA+K IRNE Y  A  +WRKK
Sbjct  363  EQLLSSKVLRESIGRAAREEMEKCDWRAASKTIRNEHYCTATLYWRKK  410



>ref|NP_001049645.1| Os03g0265100 [Oryza sativa Japonica Group]
 gb|AAP06834.1| putative sulfolipid synthase [Oryza sativa Japonica Group]
 gb|ABF95130.1| glycosyl transferase, group 1 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11559.1| Os03g0265100 [Oryza sativa Japonica Group]
 gb|EAZ26361.1| hypothetical protein OsJ_10243 [Oryza sativa Japonica Group]
 dbj|BAG97169.1| unnamed protein product [Oryza sativa Japonica Group]
Length=415

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM+RLP  RIAF+GDGPYR ELE +F+GMPAVFTG LQGEELS+AYASGD+
Sbjct  243  EKNLDFLKRVMERLPGVRIAFVGDGPYRAELERMFTGMPAVFTGMLQGEELSQAYASGDL  302

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  303  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  362

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              LL  + LRE++G+AAR+EMEK DWRAA+K IRNE Y  A  +WRKK
Sbjct  363  EQLLSSKVLRESIGRAAREEMEKCDWRAASKTIRNEHYCTATLYWRKK  410



>dbj|BAJ94304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM++LP  RIAF+GDGPYR ELE++F+GMPAVFTG LQGEELS+AYASGDV
Sbjct  186  EKNLDFLKRVMEKLPGVRIAFVGDGPYRAELEKMFTGMPAVFTGMLQGEELSQAYASGDV  245

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  246  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  305

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQ  332
              LL  ++LRE++G+AAR+EME  DWR A+K IRNE Y  A  +W+KK  +
Sbjct  306  EQLLSSKNLRESVGRAAREEMENCDWRTASKTIRNEHYRTATLYWQKKTGR  356



>gb|EMT15626.1| Lipopolysaccharide core biosynthesis glycosyltransferase lpsE 
[Aegilops tauschii]
Length=437

 Score =   229 bits (583),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM++LP  RIAF+GDGPYR ELE++F+GMPAVFTG  QGEELS+AYASGDV
Sbjct  265  EKNLDFLKRVMEKLPGVRIAFVGDGPYRAELEKMFTGMPAVFTGMFQGEELSQAYASGDV  324

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  325  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  384

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              LL  +DLRE++G+AAR+EME  DWR A+K IRNE Y+ A  +W+KK
Sbjct  385  EQLLSSKDLRESVGRAAREEMENCDWRTASKTIRNEHYSTATLYWQKK  432



>dbj|BAJ91585.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=415

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM++LP  RIAF+GDGPYR ELE++F+GMPAVFTG LQGEELS+AYASGDV
Sbjct  243  EKNLDFLKRVMEKLPGVRIAFVGDGPYRAELEKMFTGMPAVFTGMLQGEELSQAYASGDV  302

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F MPSESETLG VVLE+M+SG+PVVAARAGGIPDIIP D++GK S+LF PGDLD+C+ K+
Sbjct  303  FAMPSESETLGQVVLESMASGVPVVAARAGGIPDIIPKDKEGKTSFLFTPGDLDECVRKI  362

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              LL  ++LRE++G+AAR+EME  DWR A+K IRNE Y  A  +W+KK
Sbjct  363  EQLLSSKNLRESVGRAAREEMENCDWRTASKTIRNEHYRTATLYWQKK  410



>ref|XP_002968644.1| UDP-sulfoquinovose: alpha-diacylglycerol-sulfoquinovosyltransferase 
[Selaginella moellendorffii]
 gb|EFJ29760.1| UDP-sulfoquinovose: alpha-diacylglycerol-sulfoquinovosyltransferase 
[Selaginella moellendorffii]
Length=514

 Score =   228 bits (582),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 146/184 (79%), Gaps = 2/184 (1%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEK+L+FL +VM RLP+ARIAF+GDGP R++LEELF+ +P VFTG LQGEELS+AYAS D
Sbjct  318  VEKNLEFLYKVMQRLPDARIAFVGDGPSRKDLEELFADLPVVFTGMLQGEELSQAYASAD  377

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAM+SG+PVVAARA          + G+  +L+ PGDLD+C+++
Sbjct  378  VFVMPSESETLGFVVLEAMASGVPVVAARA--GGIPDIICEGGETGFLYAPGDLDECVNR  435

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LR+ +G A R+E+EK+DWRA+T+ +RNE+Y AAIWFWRK+R Q LR   W+
Sbjct  436  VRSLLDCEELRQRIGDAGRKEVEKFDWRASTRQVRNEEYGAAIWFWRKRRQQFLRRLAWV  495

Query  307  FKRV  296
             +++
Sbjct  496  MRKL  499



>ref|XP_001756850.1| predicted protein [Physcomitrella patens]
 gb|EDQ78447.1| predicted protein [Physcomitrella patens]
Length=472

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 141/187 (75%), Gaps = 3/187 (2%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEK+LDFL +VM+R+PE R+ F+GDGPY+ +LE++F G    FTG L GEELS+AYASGD
Sbjct  286  VEKNLDFLVKVMERIPETRLVFVGDGPYKSDLEQMFEGKNVHFTGMLTGEELSQAYASGD  345

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +F+ PSESETLG VVLEAM+SGIPVV ARA         +Q+G   YL+ PGD++DC+ K
Sbjct  346  IFITPSESETLGFVVLEAMASGIPVVCARA--GGIPDIVNQNGVTGYLYTPGDVEDCVGK  403

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            L  L+   DLRE +G+A R+E+EKYDW A+T+ +RNE+Y+AAIWFWR+++ QL   F   
Sbjct  404  LKALIESPDLRERIGRAGREEVEKYDWLASTRQVRNEEYSAAIWFWRRRKQQLANRFSGW  463

Query  307  FKRVFQP  287
            FK+  QP
Sbjct  464  FKQT-QP  469



>ref|XP_001766232.1| predicted protein [Physcomitrella patens]
 gb|EDQ68864.1| predicted protein [Physcomitrella patens]
Length=457

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 136/182 (75%), Gaps = 2/182 (1%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFL +VM+R+ EAR+ F+GDGPY+  LE+LF G    FTG L GEELS+AYASGD+
Sbjct  272  EKNLDFLVKVMERISEARLVFVGDGPYKPTLEKLFEGKNVHFTGMLSGEELSQAYASGDI  331

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PSESETLG VVLEAM+SG+PVV ARA         +QDG   +L+ PGD+DDC+ KL
Sbjct  332  FITPSESETLGFVVLEAMASGVPVVCARA--GGIPDIVNQDGVTGFLYTPGDVDDCVGKL  389

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              L+   +LR+  G+A R+E+EKYDWRA+TK +RNE+Y+AAIWFWR+++ QL   F   F
Sbjct  390  KALIESPELRDRTGRAGREEVEKYDWRASTKQVRNEEYSAAIWFWRRRKQQLASRFSGWF  449

Query  304  KR  299
            K 
Sbjct  450  KH  451



>gb|EMS55944.1| GDP-mannose-dependent alpha-mannosyltransferase [Triticum urartu]
Length=493

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 143/186 (77%), Gaps = 29/186 (16%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDF KRVMDRLP +RIAFIGDGP+                             SGD
Sbjct  322  VEKSLDFHKRVMDRLPGSRIAFIGDGPF-----------------------------SGD  352

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAMSSG+PVVAARAGGIPDIIP+DQ+GK S+L+ PGD+DDC+ K
Sbjct  353  VFVMPSESETLGFVVLEAMSSGVPVVAARAGGIPDIIPEDQEGKTSFLYTPGDVDDCVGK  412

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWL  308
            +  LL   +LRETMGKAAR+EMEK+ W+AAT+ IRNEQY+AAIWFWRKKR+QLLRP QW+
Sbjct  413  VELLLSCEELRETMGKAARKEMEKFGWKAATRKIRNEQYSAAIWFWRKKRSQLLRPLQWV  472

Query  307  FKRVFQ  290
            F+R+F+
Sbjct  473  FRRLFR  478



>gb|AFA36602.1| putative sulfolipid synthase, partial [Lolium perenne]
Length=170

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/90 (89%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEKSLDF KRVMDRLP +RIAFIGDGP+R ELEE+FSGMPAVFTGTLQG ELS+AYASGD
Sbjct  63   VEKSLDFHKRVMDRLPGSRIAFIGDGPFRPELEEMFSGMPAVFTGTLQGGELSQAYASGD  122

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARA  578
            VFVMPSESETLG VVLEAMSSG+PVVAARA
Sbjct  123  VFVMPSESETLGFVVLEAMSSGVPVVAARA  152



>gb|KIZ07633.1| sulfoquinovosyltransferase [Monoraphidium neglectum]
Length=268

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 114/183 (62%), Gaps = 7/183 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+L  LK V++ +P AR+AF+GDGP REELE +F+G+P  F G ++G+ELS AYAS D+
Sbjct  58   EKNLTVLKGVLEAVPSARLAFVGDGPQREELERVFAGLPVKFMGMMKGQELSEAYASADI  117

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSE+ETLG VVLEAM+SG+PVVA  A          Q GK   L+ PGD   C   +
Sbjct  118  FVMPSETETLGFVVLEAMASGVPVVAVAA--GGLTDILTQPGKTGLLYAPGDYAACAGHV  175

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQWLF  305
              L+ D      +G A R E+E + W AAT+ IR +QY  AI   R KR      F WL 
Sbjct  176  RRLVADPAAARELGAAGRSEVELFGWSAATRKIREQQYARAIRLARGKRR-----FWWLA  230

Query  304  KRV  296
             RV
Sbjct  231  LRV  233



>ref|XP_005843576.1| hypothetical protein CHLNCDRAFT_33086 [Chlorella variabilis]
 gb|EFN51474.1| hypothetical protein CHLNCDRAFT_33086 [Chlorella variabilis]
Length=413

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+L FLK +++R+P AR+AF+GDGP REEL++ F     VFTG L GEELS AYAS D+
Sbjct  225  EKNLKFLKGILERIPGARLAFVGDGPAREELKQYFMNTATVFTGMLHGEELSTAYASADI  284

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSE+ETLG VVLEAM+SG+PVVA RA          + G+  YL+  GD+++   ++
Sbjct  285  FVMPSETETLGFVVLEAMASGVPVVAVRA--GGIPDILTKQGETGYLYQSGDVEEAAGQV  342

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQY  371
              L+   +LR  +G AAR+E+  +DWRAAT  + + QY
Sbjct  343  AQLIEHPELRARIGTAAREEVSLWDWRAATLHLLHVQY  380



>tpg|DAA44536.1| TPA: hypothetical protein ZEAMMB73_879639 [Zea mays]
Length=404

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LDFLKRVM+RLP ARIAF+GDGPYR ELE++F+GMPAVFTG LQGEELS+AYASGDV
Sbjct  242  EKNLDFLKRVMERLPGARIAFVGDGPYRSELEKMFTGMPAVFTGMLQGEELSQAYASGDV  301

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARA  578
            F MPSESETLG VVLE+M+SG+PVVAARA
Sbjct  302  FAMPSESETLGQVVLESMASGVPVVAARA  330



>ref|XP_001689662.1| sulfolipid synthase [Chlamydomonas reinhardtii]
 gb|EDP09400.1| sulfolipid synthase [Chlamydomonas reinhardtii]
Length=402

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 107/158 (68%), Gaps = 0/158 (0%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+L FL+ V+ R P   +AF+GDGP R+EL+  F G P  F G L GE+LS AYAS D+
Sbjct  207  EKNLFFLREVLQRNPGVGLAFVGDGPARQELQAAFKGTPTQFLGMLHGEDLSAAYASSDI  266

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESETLG VVLEAM+S +PVVA RAGGIPDII     G   +L+ PGD+D     +
Sbjct  267  FVMPSESETLGFVVLEAMASELPVVAVRAGGIPDIITPGDSGVTGFLYEPGDVDKAAELI  326

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQY  371
              L  D  LR  +G  ARQE+ K+DWRAAT  + N QY
Sbjct  327  QQLAADAQLRSRVGIRARQEVAKWDWRAATMHLLNVQY  364



>ref|XP_002953985.1| hypothetical protein VOLCADRAFT_82536 [Volvox carteri f. nagariensis]
 gb|EFJ45014.1| hypothetical protein VOLCADRAFT_82536 [Volvox carteri f. nagariensis]
Length=543

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 112/163 (69%), Gaps = 1/163 (1%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+L FL+ +++R P   +AF+GDGP R EL+  F G P  F G L GE+LS AYAS D+
Sbjct  350  EKNLFFLRELLNRNPGVSLAFVGDGPARSELQATFKGTPTTFLGMLHGEDLSAAYASADI  409

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkIS-YLFNPGDLDDCLSK  488
            FVMPSESETLG VVLEAM+S +PVVA RAGGIPDII  +    ++ +L+ P D+D     
Sbjct  410  FVMPSESETLGFVVLEAMASELPVVAVRAGGIPDIICPEDSAGVTGFLYEPADVDKASEL  469

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAI  359
            +G L  + +LR  +G  ARQE+ K+DWRAAT  + N QY  A+
Sbjct  470  IGTLAANPELRARVGARARQEVAKWDWRAATMYLLNVQYPIAM  512



>ref|XP_005705641.1| UDP-sulfoquinovose:DAG sulfoquinovosyltransferase [Galdieria 
sulphuraria]
 gb|EME29121.1| UDP-sulfoquinovose:DAG sulfoquinovosyltransferase [Galdieria 
sulphuraria]
Length=434

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 108/162 (67%), Gaps = 3/162 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+L  L+ V++ +P  R+A IGDGP+ + L + F+G    FTG L+G+ELS A+A GDV
Sbjct  252  EKNLTCLRTVIETIPNVRLALIGDGPFAKYLRKYFAGTRTHFTGQLRGKELSEAFACGDV  311

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESET+G VV+EAM+SG+PVV A A     I    Q     YL+NPG++D  +  +
Sbjct  312  FVMPSESETMGFVVMEAMASGVPVVGAAA---GGIPHLIQHQVTGYLYNPGNIDQLIGLV  368

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAI  359
              L+ +  LR+ M   AR+E E++DW +AT ++RN QY  AI
Sbjct  369  KQLVDNPWLRKDMSIQARKETERWDWYSATAVLRNVQYAQAI  410



>emb|CBJ27894.1| UDP-sulfoquinovose: diacylglycerol alpha-sulfoquinovosyltransferase 
SQD2, C-terminal fragment, family GT4 [Ectocarpus siliculosus]
Length=268

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 110/168 (65%), Gaps = 3/168 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK L  +K V++R P+AR+A +G GP  + L+E FSG   V TG + GE LS+A+AS DV
Sbjct  45   EKRLRDIKGVLERNPKARLALVGKGPDSDALKEHFSGTKTVLTGVMSGEALSQAFASADV  104

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPS+SETLG VVLE+M+SG+PVV A A     I    +DGK  YL   GD++    ++
Sbjct  105  FVMPSDSETLGFVVLESMASGVPVVGANA---GGIPDLIEDGKTGYLVPAGDVEAMSDRV  161

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              LL D+ LR  M KA R+E E++ W AAT ++RN QY  AI  ++ +
Sbjct  162  KALLEDKALRGKMSKAGREETERWSWEAATSVLRNVQYQKAIVNFKSR  209



>ref|XP_005538341.1| sulfoquinovosyldiacylglycerol biosynthesis protein [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82305.1| sulfoquinovosyldiacylglycerol biosynthesis protein [Cyanidioschyzon 
merolae strain 10D]
Length=517

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 114/183 (62%), Gaps = 7/183 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEA-RIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            EK+L  LKR++   P   R+AF+GDGPY E +   F+G+P V TG L G++LSRA+A  D
Sbjct  323  EKNLLSLKRILTCCPPGTRLAFVGDGPYAETVRRHFAGLPVVMTGQLHGDDLSRAFACAD  382

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSESETLG VVLEAM+SG+PVVA  A     I      G+  +L+  G+  +  + 
Sbjct  383  VFVMPSESETLGFVVLEAMASGVPVVATAA---GGIPDLIVHGETGFLYTKGNTSEAATY  439

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKR---AQLLRPF  317
            +  LL D  +R+ MG AAR+E E++ W AAT  IRN QYN A+  +R +      L R  
Sbjct  440  VCALLGDAVMRKRMGDAARREAERWSWCAATAWIRNVQYNRAMNNFRFRALGGLGLPRSL  499

Query  316  QWL  308
             WL
Sbjct  500  SWL  502



>ref|XP_005715110.1| unnamed protein product [Chondrus crispus]
 emb|CDF35291.1| unnamed protein product [Chondrus crispus]
Length=474

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 105/162 (65%), Gaps = 3/162 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+L F K ++ R P  R+A +GDGP +  LE+  +G   +FTG L GEELS+A+AS D+
Sbjct  271  EKNLIFFKELLQRFPHCRLALVGDGPAKPMLEQELAGTKTLFTGILHGEELSQAFASADI  330

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPSESETLG VVLE+M+SG+PV+ A A     I     D +  YLF+ G  ++C +++
Sbjct  331  FVMPSESETLGFVVLESMASGVPVIGANA---GGIPDIIDDSRTGYLFSRGSQEECSARI  387

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAI  359
              LL D  LRE MG+ AR+E  ++ WRA+    RN  Y  AI
Sbjct  388  EQLLGDDALRENMGRVAREEALRWSWRASAAATRNVGYGRAI  429



>ref|XP_002185276.1| glycosyl transferase, group 1 [Phaeodactylum tricornutum CCAP 
1055/1]
 gb|EEC43145.1| glycosyl transferase, group 1 [Phaeodactylum tricornutum CCAP 
1055/1]
Length=507

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 125/224 (56%), Gaps = 17/224 (8%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK L  +K +++R+P AR+  +G GP  EEL + F G   VFTG L G+ELS A+AS DV
Sbjct  286  EKRLKDIKPMLERMPNARLCIVGKGPQEEELHDYFKGTNTVFTGQLDGDELSSAFASADV  345

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FVMPS+SETLG VVLE+M+SG+PVV A A     I     DGK  +L  PGD+   +S+L
Sbjct  346  FVMPSDSETLGFVVLESMASGVPVVGAAA---GGIPDIIDDGKTGFLVPPGDIAGFVSRL  402

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAI---------WFWRKKRAQ  332
               LR+   R  M KAAR+E E++ W AAT  +RN QY  A+          F R +   
Sbjct  403  ES-LRNAKFRTQMAKAARKETERWGWEAATSYLRNVQYEKALINFHSRAFGGFGRPRSGT  461

Query  331  LLRPFQWLFKRVFQ---PPQIEYR*CISRLLGFFSSNNLCSTRP  209
            + R   W  +RV      P+  +   I R L F    N  S +P
Sbjct  462  MWRLLGWRMRRVIHKVAKPKAVFS-SIWRKLSFGRQENSNSGKP  504



>ref|XP_005644605.1| UDP-Glycosyltransferase/glycogen phosphorylase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20061.1| UDP-Glycosyltransferase/glycogen phosphorylase [Coccomyxa subellipsoidea 
C-169]
Length=487

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 105/170 (62%), Gaps = 3/170 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLP-EARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            EK+L+ LK +M+RLP    + F+GDGP R +L + F G+P  FTG L+GEELS AYAS D
Sbjct  294  EKNLEALKGMMERLPSNVCLCFVGDGPSRPDLAKRFEGLPVYFTGMLRGEELSSAYASAD  353

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +F+MPSE+ETLG V LEAM+SG+PVVA  A     +    + G   +L+ P D       
Sbjct  354  IFMMPSETETLGFVALEAMASGLPVVAVAA--GGLVDIITKPGYAGHLYAPNDYTAATEL  411

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKR  338
               L+ D   RE MG+AAR  +EK  W AA + IR+ QY  AI  +R  +
Sbjct  412  TRKLVHDVAAREAMGQAARAHVEKLGWMAAVRRIRDHQYQRAIHTFRAHK  461



>ref|XP_005706721.1| sulfoquinovosyltransferase [Galdieria sulphuraria]
 gb|EME30201.1| sulfoquinovosyltransferase [Galdieria sulphuraria]
Length=561

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 103/171 (60%), Gaps = 3/171 (2%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            +EK+L  LK +   +P   +AFIG+GP+  +LE  +     +FTG L G+ELS A+AS D
Sbjct  357  IEKNLLCLKELFKYIPNLSLAFIGNGPFAMQLESHYRDTATIFTGILSGQELSEAFASAD  416

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VFVMPSE+ETLG VVLEAM+SG+PVVA R+     I    Q      L+ PGD+  C   
Sbjct  417  VFVMPSETETLGFVVLEAMASGVPVVATRS---GGIPDLVQHEITGLLYEPGDMATCALY  473

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRA  335
            +  L+ D      +   AR+E E +DWR AT ++RN  Y+ A+  ++  RA
Sbjct  474  VSRLIEDPYFARKLSAKARKEAENWDWRTATAVLRNTHYHRAMHHFQNTRA  524



>ref|WP_023066667.1| glycosyl transferases group 1 family protein [Lyngbya aestuarii]
 gb|ERT07174.1| glycosyl transferases group 1 family protein [Lyngbya aestuarii 
BL J]
Length=377

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 101/154 (66%), Gaps = 3/154 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P AR+A +GDGP R+ LEE F+G P  F G L+G+EL+ AYA  D 
Sbjct  211  EKEIDRIKPVLEAIPNARLALVGDGPNRQTLEEYFAGTPTYFVGYLRGQELADAYACADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P D D  +S  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGTPVVAARS---GGIPDIVTDGGNGYLFDPADEDGAISAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIR  383
              LL  +  RET+ + AR E E++ W AAT+ +R
Sbjct  328  QRLLSHQLERETLRQNARLEAERWGWAAATQQLR  361



>ref|WP_013178429.1| glycosyl transferase family 1 [Truepera radiovictrix]
 gb|ADI15064.1| glycosyl transferase group 1 [Truepera radiovictrix DSM 17093]
Length=381

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 101/153 (66%), Gaps = 3/153 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK LD+L   + +LP  R+A +G GP    L E F   P VFTG + G+EL++AYAS DV
Sbjct  212  EKRLDWLYAPITQLPGVRLAMVGSGPAESFLRERFKDTPTVFTGYMSGDELAQAYASADV  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F  PS++ETLG V +EAM+SG+PVV ARA     I    ++G+   +F+PGDL D   KL
Sbjct  272  FAFPSDTETLGFVAMEAMASGVPVVGARA---GGIPDVIREGETGLMFSPGDLGDLTEKL  328

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMI  386
              LL + +LR  MG+ ARQ+ME++ WRAAT+ +
Sbjct  329  RTLLFNPELRRAMGERARQDMERWSWRAATEAL  361



>gb|EWM27152.1| gdp-mannose-dependent alpha-mannosyltransferase [Nannochloropsis 
gaditana]
Length=505

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 102/168 (61%), Gaps = 3/168 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK L  L+ V+ R+P AR+A +G GP   +L E F G   VFTG L GEELS+A+AS DV
Sbjct  309  EKKLKTLRGVLKRIPGARLALVGGGPAEGDLREYFKGTNTVFTGLLHGEELSKAFASADV  368

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+MPS+SETLG VVLE+M+SG+PVV ARA     +    + GK  +L   GD     +++
Sbjct  369  FLMPSDSETLGFVVLESMASGVPVVGARA---GGLPNVIEHGKTGFLVPVGDEPAFAARV  425

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
              LL DR L   M  A R+E E  DW +A   +RN  Y  A+   R++
Sbjct  426  QQLLGDRGLMRDMMAAGREEAESLDWASAMDHLRNIHYKRAVMIHRRR  473



>ref|WP_015225187.1| group 1 glycosyl transferase [Halothece sp. PCC 7418]
 gb|AFZ43310.1| glycosyl transferase group 1 [Halothece sp. PCC 7418]
Length=377

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 101/155 (65%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K +++ +P+AR+A +GDGPYRE LE+ F+  P  F G L+GE L  AYAS D 
Sbjct  211  EKQIDEIKPILEAIPQARLAIVGDGPYRETLEKHFADTPTHFVGYLEGETLGAAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P D +  ++  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGVNGYLFDPHDPEGAVTAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL  +  RE + + ARQE E + W AAT+ +R+
Sbjct  328  KRLLETQSERELLREKARQEAECWGWSAATQQLRD  362



>ref|WP_012629991.1| glycosyl transferase [Cyanothece sp. PCC 7425]
 gb|ACL46949.1| glycosyl transferase group 1 [Cyanothece sp. PCC 7425]
Length=376

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 104/162 (64%), Gaps = 3/162 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K +++ +P AR+A +GDGPYR+ELE+ F+G    F G + G EL+ A+AS D 
Sbjct  211  EKEIDRIKPILETIPTARLALVGDGPYRKELEQHFAGTKTCFAGYMTGRELATAFASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I    QDG   YLF+P D    +   
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVQDGVNGYLFDPTDEQGSIVAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAI  359
              LLR++  RET+ + AR+E E++ W AAT+ +     N  +
Sbjct  328  QKLLRNQSERETLRQNARKEAERWGWAAATQQLETYYQNVLL  369



>ref|WP_019157421.1| hypothetical protein [Brevibacterium senegalense]
Length=399

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLP-EARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            EK LD L+ +MDR+P + R+A +G GP+REELE  F+G   VFTG + GEEL+ AYAS D
Sbjct  212  EKDLDLLRPLMDRMPSDVRLALVGSGPHREELEAEFAGTRTVFTGYMAGEELAAAYASAD  271

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            +FV PS +ETLGLV LE+M+SG+PVV ARA     I    +DG    L  PG +DD  ++
Sbjct  272  LFVFPSTTETLGLVALESMASGVPVVGARA---GGIPFAVRDGVGGLLHEPGSVDDLQTQ  328

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKR  338
            +  +L D  LR  +     +E +K+ WRAAT+ +      A   +W   R
Sbjct  329  VLRVLEDPQLRARLSAGGLEETQKHGWRAATESLVGAYEEAIERYWSDHR  378



>ref|WP_009786934.1| glycosyl transferase [Lyngbya sp. PCC 8106]
 gb|EAW34534.1| Glycosyl transferase, group 1 [Lyngbya sp. PCC 8106]
Length=377

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P AR+A +GDGP R+ LEE F+G P  F G L+G+EL+ AYA  D 
Sbjct  211  EKEIDRIKPVLEAIPNARLALVGDGPNRQTLEEHFAGTPTYFVGYLRGQELADAYACADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P D +  +S  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGTPVVAARS---GGIPDIVTDGVNGYLFDPTDENGAISAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAI  359
              LL  +  RET+ + AR E E++ W AAT+ +R  +Y +A+
Sbjct  328  QRLLSHQLERETLRQNARLEAERWGWAAATQQLR--RYYSAV  367



>ref|WP_015220908.1| group 1 glycosyl transferase [Cyanobacterium aponinum]
 gb|AFZ55189.1| glycosyl transferase group 1 [Cyanobacterium aponinum PCC 10605]
Length=376

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P AR+A +G+GP REELE LF+G    F G L G++L  AYAS D 
Sbjct  211  EKEIDKIKPVLENIPNARLAIVGNGPAREELEALFAGTNTNFVGYLHGQDLGSAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR      I     DG   YLF P D    ++  
Sbjct  271  FIFPSSTETLGLVLLEAMAAGCPVVAAR---RGGIPDIVTDGVNGYLFEPDDPQGAIAAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL   D RE + + AR+E EK+ W +AT  +RN
Sbjct  328  QKLLAKTDEREQLRQNARKEAEKWGWASATTQLRN  362



>ref|WP_015175196.1| glycosyl transferase group 1 [Oscillatoria nigro-viridis]
 gb|AFZ05874.1| glycosyl transferase group 1 [Oscillatoria nigro-viridis PCC 
7112]
Length=377

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 108/164 (66%), Gaps = 5/164 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V+  +P+AR+A +GDGP+R+ LE+ F+G P  F G L+G+EL+RAYAS D 
Sbjct  211  EKEIERIKPVLAAIPDARLALVGDGPHRQTLEQYFAGTPTNFVGYLKGQELARAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P D +  L+  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGTPVVAARS---GGIPDIVTDGVNGYLFDPADEEGALAAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWF  353
              L  + + RET+ + AR+E E++ W AA   +  ++Y  ++ F
Sbjct  328  QRLFANPEERETLRQNARKEAERWGWAAAAAQL--QRYYQSVVF  369



>ref|WP_017719528.1| glycosyl transferase [Oscillatoria sp. PCC 10802]
Length=377

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 101/154 (66%), Gaps = 3/154 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +  V++ +P+AR+A +GDGP+R+ LEE F+G PA F G +QG EL+ AYAS D 
Sbjct  211  EKEIDRILPVLEAIPDARLALVGDGPHRQALEEHFAGAPAHFAGYMQGLELASAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG    LF+P D        
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGVNGCLFDPADDAGARKAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIR  383
              LL+ R  RET+ + ARQE E++ W AAT+ +R
Sbjct  328  LRLLQHRQERETLRQNARQEAERWGWAAATRQLR  361



>ref|WP_008314395.1| glycosyltransferase [Leptolyngbya sp. PCC 6406]
Length=377

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 100/154 (65%), Gaps = 3/154 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P AR+A +GDGPYREELE+ F G    F G L GEEL+ AYAS DV
Sbjct  211  EKEIDCIKPVLESIPGARLALVGDGPYREELEKHFDGTNTNFVGYLAGEELASAYASADV  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FV PS +ETLGLV+LEAM++G PVVAA +     I     +G+  Y+F+P D +  ++  
Sbjct  271  FVFPSRTETLGLVLLEAMAAGCPVVAANS---GGIPDIVTNGENGYMFDPQDENGAIAAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIR  383
              +     LRET+   AR E E++ WR AT+ ++
Sbjct  328  QRIFATDALRETLRLNARAEAERWGWRGATQQLQ  361



>ref|WP_012596832.1| glycosyl transferase [Cyanothece sp. PCC 8801]
 gb|ACK67574.1| glycosyl transferase group 1 [Cyanothece sp. PCC 8801]
Length=377

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 99/155 (64%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P+AR+A +GDGPYRE LE  F+G    F G LQG EL+ A+AS D 
Sbjct  211  EKQIDQIKPVLEAIPDARLAIVGDGPYREALEAHFAGTKTNFVGYLQGLELASAFASSDA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAA +     I     DG   YLF+P D D  +   
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAANS---GGIPDIVTDGVNGYLFDPADPDGAIVAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL  ++ RE + + AR E E++ W AAT  +RN
Sbjct  328  KRLLAAKEEREKLRENARLEAERWSWSAATSQLRN  362



>ref|WP_015784192.1| glycosyl transferase [Cyanothece sp. PCC 8802]
 gb|ACV01369.1| glycosyl transferase group 1 [Cyanothece sp. PCC 8802]
Length=377

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 99/155 (64%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P+AR+A +GDGPYRE LE  F+G    F G LQG EL+ A+AS D 
Sbjct  211  EKQIDQIKPVLEAIPDARLAIVGDGPYREALEAHFAGTKTNFVGYLQGLELASAFASSDA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAA +     I     DG   YLF+P D D  +   
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAANS---GGIPDIVTDGVNGYLFDPADPDGAIVAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL  ++ RE + + AR E E++ W AAT  +RN
Sbjct  328  KRLLAAKEEREKLRENARLEAERWSWSAATSQLRN  362



>ref|WP_011056273.1| glycosyl transferase [Thermosynechococcus elongatus]
 ref|NP_681208.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Thermosynechococcus elongatus BP-1]
 dbj|BAC07970.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Thermosynechococcus elongatus BP-1]
Length=379

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 107/162 (66%), Gaps = 5/162 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K +++++P+AR+A +G+GP+RE LE+ F+G P  F G L+GE L+ A+AS DV
Sbjct  211  EKEIEQIKPILEQIPQARLALVGNGPHREALEKHFAGTPTHFVGYLRGERLAGAFASADV  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAA +     I     DG   +LF+P D    ++  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAANS---GGIPDIVTDGVNGFLFDPADPTGAITAC  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAI  359
              L    D RET+ + ARQE E++ W AAT+ +  EQY  ++
Sbjct  328  QRLFDSPDDRETLRQNARQEAERWSWAAATQQL--EQYYRSV  367



>ref|WP_015184883.1| glycosyltransferase [Microcoleus sp. PCC 7113]
 gb|AFZ20750.1| glycosyltransferase [Microcoleus sp. PCC 7113]
Length=377

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 101/155 (65%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P AR+A +GDGP+R  LE+ F+G P  F G L G+EL  A+AS D 
Sbjct  211  EKEIERIKPVLEAIPNARLALVGDGPHRSALEKHFAGTPTHFVGYLTGKELGAAFASSDA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FV PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P D    ++  
Sbjct  271  FVFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGVNGYLFDPADEQGAITAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL  ++ RET+ + AR E E++ W AAT+ ++N
Sbjct  328  QRLLERQEERETLRQNARAEAERWGWAAATRQLQN  362



>ref|WP_019501737.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=379

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 106/169 (63%), Gaps = 7/169 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +  +  +++ +P +R+A +GDGPYR+ELE +F+G P  F G LQGEEL+ A+AS DV
Sbjct  212  EKEITQILPILEAVPNSRLALVGDGPYRQELERIFAGTPTNFVGYLQGEELASAFASSDV  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF P D D  L   
Sbjct  272  FLFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGINGYLFEPDDPDGLLHAT  328

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKR  338
              LL +        + ARQE EK+ W AAT  ++ + Y+AAI   R ++
Sbjct  329  QRLLEN---PVQFKQCARQEAEKWSWAAATVQLQ-QYYDAAIVACRDRK  373



>gb|KIZ02980.1| sulfoquinovosyltransferase [Monoraphidium neglectum]
Length=430

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 106/162 (65%), Gaps = 2/162 (1%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK++  L  V+ +LP AR+A +GDGP R ELE+LF GMP  FTGTLQG +LS A+AS D 
Sbjct  218  EKNITALLDVLQQLPGARLAIVGDGPLRLELEQLFRGMPVKFTGTLQGRDLSEAFASADA  277

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+MPSE+ETLG VVLEAM+SG+PVVA  A          + G+   L+ PG+   C +  
Sbjct  278  FLMPSETETLGFVVLEAMASGLPVVAVAA--GGLTDVVSRPGENGLLYPPGNYATCAAHA  335

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAI  359
              L+ D   R  MG AAR+E +++ W AAT+ +R +QY  A+
Sbjct  336  RRLIADVAARRAMGAAARREAQRFGWAAATRHLREQQYARAV  377



>ref|WP_011243256.1| MULTISPECIES: glycosyl transferase [Synechococcus]
 gb|AAF14309.1| SqdX [Synechococcus elongatus PCC 7942]
 dbj|BAD79134.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Synechococcus elongatus PCC 6301]
 gb|ABB56611.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Synechococcus elongatus PCC 7942]
 gb|AJD56350.1| glycosyl transferase [Synechococcus sp. UTEX 2973]
Length=377

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 101/155 (65%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D L+ ++D  PEA +A +GDGP+R ELE+LF+G    F G L GE+L  AYAS D 
Sbjct  211  EKQIDRLRPILDANPEACLALVGDGPHRAELEQLFAGTQTQFIGYLHGEQLGAAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FV PS +ETLGLV+LEAM++G PVVAA +     I     DG   +LF+P D    ++ +
Sbjct  271  FVFPSRTETLGLVLLEAMAAGCPVVAANS---GGIPDIVSDGINGFLFDPEDEQGAIAAI  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL +   RE + +AARQE E++ W AAT+ +++
Sbjct  328  QRLLANPAEREILRQAARQEAERWSWNAATRQLQD  362



>ref|WP_015956855.1| glycosyl transferase [Cyanothece sp. PCC 7424]
 gb|ACK73273.1| glycosyl transferase group 1 [Cyanothece sp. PCC 7424]
Length=377

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P+A +A +GDGP+RE LEE F G    F G LQG EL+ AYAS D 
Sbjct  211  EKQIDQIKPVLEAIPQAHLAIVGDGPHREALEEHFKGTNTHFIGYLQGLELASAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAA +     I     DG   YLF+P D D  ++  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAAAS---GGIPDIVTDGVNGYLFDPADADGAITAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL     RE +   AR E E++ W AAT+ ++N
Sbjct  328  QRLLEATQEREKLRHNARLEAERWGWAAATRQLQN  362



>ref|WP_010145366.1| glycosyl transferase family 1 [Citricoccus sp. CH26A]
Length=400

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 104/174 (60%), Gaps = 7/174 (4%)
 Frame = -1

Query  844  EKSLDFL----KRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYA  677
            EK LD L    +R+  R+P AR+A +G GP+ E+L   F     VFTG + G ELS+AYA
Sbjct  212  EKDLDALLEPMRRLRQRVPGARLAMVGSGPHVEQLRRHFDPAWTVFTGYMSGPELSQAYA  271

Query  676  SGDVFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDC  497
            S DVF  PS +ETLGLV LE+M+SG+PVV ARA     I     D +  +L +P D+D  
Sbjct  272  SADVFAFPSTTETLGLVALESMASGVPVVGARA---GGIPFVIDDARTGFLVDPVDVDGW  328

Query  496  LSKLGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRA  335
              +L  LL D  LR  MG+AAR+E E++ WRAAT+ +      A    WR  R+
Sbjct  329  ADRLERLLTDPGLRLRMGRAAREEAERHSWRAATQTLVGFYDQAIDTHWRDHRS  382



>gb|AGF71936.1| glycogen synthase [Corynebacterium halotolerans YIM 70093 = DSM 
44683]
Length=375

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 103/164 (63%), Gaps = 5/164 (3%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            +E+ +  +  + +R+P AR+A +G GPYREELE +       FTG L G EL+ A+ASGD
Sbjct  211  LERLVGIMSNLRERVPGARLAMVGSGPYREELERMLDPAWTTFTGYLSGPELAEAFASGD  270

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLS-  491
            VFV PS +ETLGLV LE+M+SG+PVV ARA     I     DG   +L +P D D   + 
Sbjct  271  VFVFPSTTETLGLVALESMASGVPVVGARA---GGIPFVIDDGVTGHLVDPADGDGIWAQ  327

Query  490  KLGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAI  359
            +L  LL DR LR  +G AAR E E++ WRA+T+ +  E Y  AI
Sbjct  328  RLATLLTDRQLRTGVGAAARVEAERHSWRASTETL-VEAYEHAI  370



>ref|WP_036477227.1| glycosyl transferase [Myxosarcina sp. GI1]
Length=377

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K +++ +PEAR+A +GDGPYRE L+  F+     F G LQG EL+ AYAS D 
Sbjct  211  EKQIDEIKPILEAIPEARLAIVGDGPYREALQAKFADTNTHFVGYLQGLELASAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAA +     I     DG   YLF P D    +   
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAANS---GGIPDIVTDGVNGYLFEPDDPQGAIKAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL   D+RE + + AR E E++ W AAT+ ++N
Sbjct  328  KALLEATDIREQLRQNARSEAERWGWAAATRHLQN  362



>ref|WP_024125070.1| sulfoquinovosyldiacylglycerol biosynthesis protein SqdX [Thermosynechococcus 
sp. NK55a]
 gb|AHB88679.1| sulfoquinovosyldiacylglycerol biosynthesis protein SqdX [Thermosynechococcus 
sp. NK55a]
Length=379

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K +++++P+AR+A +G+GP+RE LE+ F+G P  F G L+GE L+ A+AS DV
Sbjct  211  EKEIEQIKPILEQIPQARLALVGNGPHREALEKHFAGTPTHFVGYLRGERLAGAFASADV  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FV PS +ETLGLV+LEAM++G PVVAA +     I     DG   +LF+P D    ++  
Sbjct  271  FVFPSRTETLGLVLLEAMAAGCPVVAANS---GGIPDIVTDGVNGFLFDPADPTGAITAC  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAI  359
              L      RET+ + ARQE E++ W AAT+ +  EQY  ++
Sbjct  328  QRLFDSPGDRETLRQNARQEAERWSWAAATQQL--EQYYQSV  367



>ref|WP_027004308.1| glycosyl transferase [Corynebacterium halotolerans]
Length=379

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 103/164 (63%), Gaps = 5/164 (3%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            +E+ +  +  + +R+P AR+A +G GPYREELE +       FTG L G EL+ A+ASGD
Sbjct  215  LERLVGIMSNLRERVPGARLAMVGSGPYREELERMLDPAWTTFTGYLSGPELAEAFASGD  274

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLS-  491
            VFV PS +ETLGLV LE+M+SG+PVV ARA     I     DG   +L +P D D   + 
Sbjct  275  VFVFPSTTETLGLVALESMASGVPVVGARA---GGIPFVIDDGVTGHLVDPADGDGIWAQ  331

Query  490  KLGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAI  359
            +L  LL DR LR  +G AAR E E++ WRA+T+ +  E Y  AI
Sbjct  332  RLATLLTDRQLRTGVGAAARVEAERHSWRASTETL-VEAYEHAI  374



>ref|WP_012164458.1| glycosyl transferase [Acaryochloris marina]
 gb|ABW29117.1| glycosyl transferase, group 1 family protein [Acaryochloris marina 
MBIC11017]
Length=388

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 99/153 (65%), Gaps = 3/153 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K ++D +P AR+A +GDGPYR+ELE+ F+G    F G + G+ L+ A+AS D 
Sbjct  211  EKEIDRIKLILDAMPSARLALVGDGPYRQELEKHFAGTKTYFAGYMSGKTLASAFASADC  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I    +D    YLF+P    D +   
Sbjct  271  FMFPSRTETLGLVLLEAMAAGCPVVAARS---GGITDIVEDEANGYLFDPSSDQDFIQAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMI  386
              LL + D RET+ + AR E E++ W AAT+ +
Sbjct  328  QRLLANSDERETIRRNARVEAERWGWAAATRQL  360



>ref|WP_006457040.1| glycosyl transferase [Synechococcus sp. PCC 7335]
 gb|EDX87251.1| glycosyl transferase, group 1 family protein [Synechococcus sp. 
PCC 7335]
Length=377

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 101/165 (61%), Gaps = 6/165 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P+AR+A +GDGPYREELEE F G P  F G L GEEL  AYAS D 
Sbjct  211  EKEIDRIKPVLESIPDARLALVGDGPYREELEEHFEGTPTHFVGYLAGEELGAAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+AA A     I     +G   ++F+P D    ++  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVIAADA---GGIPDIVTNGVNGFMFDPADEQGAITAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN---EQYNAAI  359
              LL  +  +E + + AR E E++ W  AT+ +     E  NA I
Sbjct  328  QKLLGMKAEKELLRQNARVEAERWGWEGATRQLERFYIEVLNAGI  372



>ref|WP_006513788.1| glycosyltransferase [Leptolyngbya sp. PCC 7375]
 gb|EKU99338.1| glycosyltransferase [Leptolyngbya sp. PCC 7375]
Length=376

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 99/155 (64%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K +++ +P+AR+A +GDGPYREELEE F+G    F G L GEEL+ AYASGD 
Sbjct  211  EKEVDRIKPILEAIPDARLALVGDGPYREELEEHFAGTATNFVGYLGGEELASAYASGDA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G P VAA A     I     DG   +LF+P D +  +   
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPTVAANA---GGIPDIVTDGTNGFLFDPQDEEGAIKAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL  R   E + + AR E E++ WR AT+ ++ 
Sbjct  328  QRLLATRAEIELLRRNARIEAERWGWRGATQQLQK  362



>ref|WP_011610261.1| glycosyl transferase [Trichodesmium erythraeum]
 gb|ABG49865.1| glycosyl transferase, group 1 [Trichodesmium erythraeum IMS101]
Length=377

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            VEK +D +K +++ +P   IA +GDGP R+ LE+ F+  P  F G L+G++L+ AYAS D
Sbjct  210  VEKEIDRIKPIVEAIPNTCIAIVGDGPNRQNLEQYFANTPTHFVGYLRGQKLASAYASAD  269

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
             F+ PS +ETLGLV+LEAM++G PVVAA +     I     +G   YLF+P D    ++ 
Sbjct  270  AFIFPSRTETLGLVLLEAMAAGTPVVAANS---GGIPDIVTNGINGYLFDPDDEKGAITA  326

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
               L    + RET+ K AR E E++ W AAT+ +RN
Sbjct  327  TQKLFAHSEERETLRKNARAEAERWGWSAATQQLRN  362



>ref|WP_006101106.1| glycosyl transferase [Coleofasciculus chthonoplastes]
 gb|EDX75396.1| glycosyl transferase, group 1 family protein [Coleofasciculus 
chthonoplastes PCC 7420]
Length=377

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 103/167 (62%), Gaps = 5/167 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P AR+A +GDGP+R  LE+ F+G P  F G L GE L  A+AS D 
Sbjct  211  EKEIDRIKPVLESIPGARLALVGDGPHRSALEKHFAGTPTHFVGYLTGEALGSAFASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P D    ++  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGVNGYLFDPKDEQGAIAAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRK  344
              L +++  RET+ + AR E E++ W AAT+ +  +QY   +   R 
Sbjct  328  QRLFQEQTERETLRENARAEAERWSWSAATRQL--QQYYQGVVLSRS  372



>ref|WP_015223063.1| group 1 glycosyl transferase [Cyanobacterium stanieri]
 gb|AFZ47747.1| glycosyl transferase group 1 [Cyanobacterium stanieri PCC 7202]
Length=378

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P AR+A +G+GP R ELE+ F+     F G L G+EL  AYAS D 
Sbjct  211  EKEIDKIKPVLESIPNARLAIVGNGPARAELEQFFADTNTNFVGYLHGKELGEAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR      I     DG   Y+F P D    ++  
Sbjct  271  FIFPSSTETLGLVLLEAMAAGCPVVAAR---RGGIPDIVTDGVNGYMFEPDDPQGAIAAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL  +D RET+ + AR E EK+ W AAT+ ++N
Sbjct  328  QRLLAQKDERETLRQNARLEAEKWGWAAATRQLQN  362



>ref|XP_001699258.1| sulfolipid synthase [Chlamydomonas reinhardtii]
 gb|EDO98898.1| sulfolipid synthase, partial [Chlamydomonas reinhardtii]
Length=395

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 104/174 (60%), Gaps = 5/174 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK+LD L+ VM+ +P  R+A +GDGP R +LE+  +G+P  F G L+G+ELS AYAS DV
Sbjct  217  EKNLDALRCVMEAVPGCRLALVGDGPARPQLEQHLAGLPVTFMGMLRGDELSAAYASADV  276

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARA-----ggipdiipddqdgkISYLFNPGDLDD  500
            FVMPSE+ETLG VVLEAM+SG+PVVA  A        P        G  S   +      
Sbjct  277  FVMPSETETLGFVVLEAMASGLPVVAVAAGGLKDILAPAAASASSPGGSSSAADLAAAAA  336

Query  499  CLSKLGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKR  338
                +  L    +LR ++G AAR E+E+Y W  AT+++R EQY  AI     +R
Sbjct  337  AAQLVAALAASPELRASVGAAARAEVERYGWGEATRVLREEQYKRAIHVHASRR  390



>ref|WP_039726013.1| MULTISPECIES: glycosyl transferase [Oscillatoriophycideae]
 gb|KIF14290.1| glycosyl transferase [Aphanocapsa montana BDHKU210001]
 gb|KIF39224.1| glycosyl transferase [Lyngbya confervoides BDU141951]
Length=378

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 98/153 (64%), Gaps = 3/153 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P+AR+A +GDGP+RE+LE+ F+G    F G L GEEL  AYAS D 
Sbjct  211  EKEVDRIKPVLESIPDARLALVGDGPHREDLEKHFAGTHTNFVGYLAGEELGSAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FV PS +ETLGLV+LEAM++G PVVAA A     I     +G+  YLF+P D    ++  
Sbjct  271  FVFPSRTETLGLVLLEAMAAGCPVVAANA---GGIPDIVTNGENGYLFDPKDEGGAIAAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMI  386
              LL     RE M + AR E EK+ W AAT+ +
Sbjct  328  QRLLDRGAERELMRRNARMEAEKWGWNAATRQL  360



>ref|WP_017288576.1| glycosyl transferase [Leptolyngbya boryana]
Length=375

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P AR+A +GDGP R+ LE+ F+G    F G L G+EL+ A+AS D 
Sbjct  211  EKEIDRIKPVLESIPNARLALVGDGPNRQVLEKHFAGTHTNFVGYLAGQELASAFASSDA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FV PS +ETLGLV+LEAM++G PVVAAR+     I    +DG   YLF+P D +  +   
Sbjct  271  FVFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVEDGVNGYLFDPTDENGAIVAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL   + RE + + AR E E++ W +ATK ++N
Sbjct  328  RSLLAQTETREMIRQNARHEAERWSWSSATKQLQN  362



>ref|WP_036913154.1| MULTISPECIES: glycosyl transferase [Prochlorococcus]
 gb|KGG27004.1| Glycosyltransferase [Prochlorococcus sp. MIT 0701]
 gb|KGG27918.1| Glycosyltransferase [Prochlorococcus sp. MIT 0702]
 gb|KGG31359.1| Glycosyltransferase [Prochlorococcus sp. MIT 0703]
Length=381

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V+DR+PEAR+A +GDGP+R++LE+ F G    F G L+GEEL+ AYASGD 
Sbjct  212  EKQIERIKPVLDRIPEARLALVGDGPHRQQLEKAFEGTATTFVGYLEGEELASAYASGDA  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVV A       I     DG    L+ P  +D   + L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVVGAN---RGGIPDIITDGVNGCLYEPDGVDGGSTSL  328

Query  484  GPLLRD---RDL-RETMGKAARQEMEKYDWRAATKMIRN  380
                R     DL R+ + KAARQE E++ W +AT+ +RN
Sbjct  329  INATRQLLGNDLERQGLRKAARQEAERWGWASATQQLRN  367



>ref|WP_006633738.1| glycosyl transferase [Microcoleus vaginatus]
 gb|EGK86746.1| glycosyl transferase group 1 [Microcoleus vaginatus FGP-2]
Length=377

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 105/164 (64%), Gaps = 5/164 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V+  +P+AR+A +GDGP+R+ LE+ F+G P  F G L+G+EL+ AYAS D 
Sbjct  211  EKEIERIKPVLAAIPDARLALVGDGPHRQTLEQYFAGTPTNFVGYLKGQELATAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P D +  L   
Sbjct  271  FIFPSRTETLGLVLLEAMAAGTPVVAARS---GGIPDIVTDGVNGYLFDPADEEGSLVAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWF  353
              L  + + RET+   AR+E E++ W AA   +  ++Y  ++ F
Sbjct  328  KRLFANPEERETLRHNARREAERWGWAAAAAQL--QRYYQSVVF  369



>ref|WP_040657553.1| glycosyl transferase, partial [Ornithinimicrobium pekingense]
Length=376

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 99/155 (64%), Gaps = 5/155 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPE--ARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASG  671
            EK LD L   + RL     R+A +G GP REEL+++F+G P VFTG L G +L+ AYAS 
Sbjct  214  EKDLDQLLEPLRRLGGYGVRLALVGSGPGREELQQMFAGTPTVFTGYLGGSDLAAAYASA  273

Query  670  DVFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLS  491
            DVF  PS +ETLGLV LE+M+SG+PVV A A     I     DG+  +L  PGD D    
Sbjct  274  DVFAFPSTTETLGLVALESMASGVPVVGADA---GGIPFVIDDGRTGFLVPPGDTDALTD  330

Query  490  KLGPLLRDRDLRETMGKAARQEMEKYDWRAATKMI  386
            +L  L+ D  LRE MG AAR++ E++ WRAAT+ +
Sbjct  331  RLERLVADPSLRERMGAAAREDAEQHSWRAATEAL  365



>ref|WP_011316987.1| glycosyl transferase [Anabaena variabilis]
 gb|ABA19716.1| Glycosyl transferase, group 1 [Anabaena variabilis ATCC 29413]
Length=378

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K +++ +P+AR+A +GDGP+R+ LE+ FSG    F G L G EL  A+AS D 
Sbjct  211  EKEIERIKPILEAIPQARLALVGDGPHRQALEKHFSGTNTHFVGYLTGRELGAAFASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNP-GDLDDCLSK  488
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLFNP  D+ D ++ 
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGVNGYLFNPKADIQDAINA  327

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
               LL +   R+T+ + AR+E E++ W AAT+ +++
Sbjct  328  TVRLLENAQERDTIRQNARREAERWGWAAATRQLQD  363



>ref|WP_022608621.1| glycosyltransferase [Rubidibacter lacunae]
 gb|ERN40475.1| glycosyltransferase [Rubidibacter lacunae KORDI 51-2]
Length=377

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K +++ +P+AR+A +GDGP+RE LE+ F+  P  F G L+GE L+ AYAS D 
Sbjct  211  EKEIDRIKPILESIPDARLAIVGDGPHREVLEQHFAETPTYFVGYLRGEALASAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAA +     I     DG   YLF P D D  +   
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAAAS---GGIPDIVTDGVNGYLFAPDDPDGAVRAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL  R  RE + + AR+E E++ W AAT+ +++
Sbjct  328  QCLLDARTEREQLRQNARREAERWSWAAATQQLQD  362



>ref|WP_017292828.1| glycosyl transferase [Geminocystis herdmanii]
Length=377

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 94/155 (61%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P AR+A +G+GP R ELE  F+     F G L G+EL  AYAS D 
Sbjct  211  EKEIDKIKPVLESIPHARLAIVGNGPARAELETYFANTNTNFVGYLHGQELGSAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR      I     DG   Y+FNP D    +   
Sbjct  271  FIFPSSTETLGLVLLEAMAAGCPVVAAR---RGGIPDIVTDGVNGYMFNPDDAQGAIEAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL  ++ RE + + AR E EK+ W +AT  +RN
Sbjct  328  RRLLAHKEEREQLRQNARLEAEKWGWSSATAQLRN  362



>ref|WP_015170725.1| group 1 glycosyl transferase [Geitlerinema sp. PCC 7407]
 gb|AFY65157.1| glycosyl transferase group 1 [Geitlerinema sp. PCC 7407]
Length=376

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 101/154 (66%), Gaps = 3/154 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D ++ V++ +P AR+A +GDGP+R+EL   F+G    F G L GEELS AYAS D 
Sbjct  211  EKEIDRIRPVLEAIPNARLALVGDGPHRQELMRFFAGTNTHFVGYLMGEELSTAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FV PS +ETLGLV+LEAM++G PVVAA +     I    +DG   +LF+P D    ++  
Sbjct  271  FVFPSSTETLGLVLLEAMAAGCPVVAAGS---GGITDIVEDGVNGFLFDPRDERGAIAAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIR  383
              LL   ++RET+ + AR+E E++ W AAT+ ++
Sbjct  328  QRLLASTEIRETLRQNARREAERWGWEAATRQLQ  361



>ref|WP_006910279.1| glycosyl transferase [Cyanobium sp. PCC 7001]
 gb|EDY38380.1| SqdX [Cyanobium sp. PCC 7001]
Length=382

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 101/159 (64%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +  V+D LP+AR+A +GDGP+R+ LE++F+G P  F G L GEEL+ AYASGD 
Sbjct  212  EKQIERILPVLDALPDARLALVGDGPHRQTLEKVFTGTPTTFVGYLAGEELASAYASGDA  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FV PS +ETLGLV+LEAM++G PVV A       I     DG    L++P  +D   + L
Sbjct  272  FVFPSSTETLGLVLLEAMAAGCPVVGAN---RGGIPDIVTDGINGCLYDPDGIDGGSASL  328

Query  484  GP----LLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  LL D   R+ + +AARQE E++ W +AT+ +R 
Sbjct  329  TAAVQRLLGDDAERQQLRQAARQEAERWGWASATRQLRG  367



>ref|WP_031283693.1| glycosyl transferase [Kocuria sp. UCD-OTCP]
 gb|EYT54493.1| glycosyl transferase [Kocuria sp. UCD-OTCP]
Length=385

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 91/153 (59%), Gaps = 3/153 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK++  L   + RLP  R+A +GDGP+R ELE  F+G P VF G L GEEL+ AYAS DV
Sbjct  213  EKNVAALLEPIRRLPGTRLAVVGDGPHRPELERRFAGTPTVFPGRLAGEELAAAYASADV  272

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
               PS +ETLGLV LE+++SG+PVV ARA     I      G+   L  PGD D   + L
Sbjct  273  LAFPSTTETLGLVALESLASGVPVVGARA---GGIPFAVAHGRTGLLVPPGDADALTAGL  329

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMI  386
              LL D  LR  MG A   E E   WRAAT+ +
Sbjct  330  ARLLDDAALRARMGAAGLAEAEGLGWRAATEFL  362



>ref|WP_035923791.1| glycosyl transferase [Kocuria polaris]
 gb|KHD99131.1| glycosyl transferase [Kocuria polaris]
Length=385

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 100/176 (57%), Gaps = 4/176 (2%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
             EK++  L   + RLP  R+A +GDGP+R ELE  F+  P VF G L GEEL+ AYAS D
Sbjct  212  TEKNVAALLEPIRRLPGTRLAVVGDGPHRPELERRFADTPTVFPGRLVGEELAAAYASAD  271

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            V   PS +ETLGLV LE+++SG+PVV ARA     I     DG+   L  PGD D   + 
Sbjct  272  VLAFPSTTETLGLVALESLASGVPVVGARA---GGIPFAVADGRTGLLVPPGDADALTAG  328

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRP  320
            L  LL D  LR  MG A R E E   WRAAT+ +    Y+ A+   R +R     P
Sbjct  329  LARLLDDAALRARMGAAGRAEAEGLGWRAATEFL-VACYDEAVRRHRSRRPAPRHP  383



>ref|WP_015230997.1| glycosyltransferase [Dactylococcopsis salina]
 gb|AFZ52023.1| glycosyltransferase [Dactylococcopsis salina PCC 8305]
Length=377

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P+AR+A +GDGP RE LE+ F+     F G L+GE L  AYAS D 
Sbjct  211  EKQIDEIKPVLEAIPQARLAIVGDGPNRETLEKHFADTSTHFVGYLEGETLGAAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG+  YLF+P D    ++  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGENGYLFDPKDPKGAVTAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL  +  RE + + ARQE E++ W AAT+ +R+
Sbjct  328  KRLLETQSERELLREKARQEAERWGWGAATQQLRD  362



>ref|WP_006196765.1| glycosyl transferase [Nodularia spumigena]
 gb|EAW45108.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Nodularia spumigena CCY9414]
 gb|AHJ30703.1| Glycosyltransferase [Nodularia spumigena CCY9414]
Length=378

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 100/156 (64%), Gaps = 4/156 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K +++ +P AR+A +GDGP+R+ELE+ F+  P  F G L G+EL  A+AS D 
Sbjct  211  EKEIERIKPILEAIPHARLALVGDGPHRQELEKHFADTPTHFVGYLTGQELGSAFASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNP-GDLDDCLSK  488
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P  D+ D +  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGVNGYLFDPTADIQDAIHA  327

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
               LL+ +  RE + + AR E E + W AAT  +++
Sbjct  328  TVRLLQHKQEREVIRQNARSEAENWGWSAATCQLQD  363



>ref|WP_007356158.1| MULTISPECIES: glycosyl transferase [Kamptonema]
 emb|CBN56954.1| glycosyl transferase, group 1 [ [[Oscillatoria] sp. PCC 6506]
Length=377

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 96/154 (62%), Gaps = 3/154 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V+  +P AR+A +GDGP+R+ LE+ F+G P  F G L+G EL+ AYA  D 
Sbjct  211  EKEIDRIKPVLASIPNARLALVGDGPHRQTLEQYFAGTPTYFAGYLRGRELASAYACADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P D +  ++  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGTPVVAARS---GGIPDIVTDGVNGYLFDPADEEGAIAAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIR  383
              L       ET+ + AR E E++ W AAT  +R
Sbjct  328  QRLFAQPQEGETLRQNARIEAERWGWAAATHQLR  361



>ref|WP_025943510.1| glycosyl transferase [Prochlorococcus sp. scB241_526B19]
Length=379

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 100/159 (63%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V+D +P+A +A +GDGPYR +LE++F      F G L G+ELS AYASGD+
Sbjct  212  EKQIERIKPVLDSIPDACLALVGDGPYRNQLEKIFENTKTNFVGYLSGDELSSAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+  + L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPEEKDNGETSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L D++ RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILEDKEKREVMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_010467672.1| glycosyl transferase [Acaryochloris sp. CCMEE 5410]
Length=388

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 98/153 (64%), Gaps = 3/153 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K ++D +P AR+A +GDGPYR++LE+ F+G    F G + G  L+ A+AS D 
Sbjct  211  EKEIDRIKLILDAMPSARLALVGDGPYRQDLEKHFAGTKTYFAGYMSGTTLASAFASADC  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I    +D    YLF+P    D +   
Sbjct  271  FMFPSRTETLGLVLLEAMAAGCPVVAARS---GGITDIVEDEANGYLFDPTSDQDFIQAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMI  386
              LL + + RET+ + AR E E++ W AAT+ +
Sbjct  328  QRLLANSEERETIRRNARAEAERWGWAAATRQL  360



>ref|WP_025976056.1| glycosyl transferase, partial [Prochlorococcus sp. scB243_495N3]
Length=290

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  125  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  184

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  185  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  241

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR+E EK+DW  AT  ++N
Sbjct  242  IEATKKILENEDKREIMRKEARKEAEKWDWNQATLQLQN  280



>ref|WP_010312701.1| glycosyl transferase [Synechococcus sp. CB0101]
Length=383

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ ++ V+D LPEAR+A +GDGPYR++LE LF+G  A F G L GEEL+ AYAS D 
Sbjct  212  EKQIERIRPVLDALPEARLALVGDGPYRQQLETLFAGSAATFVGYLAGEELASAYASADA  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVV A       I     DG    L+ P  +D     L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVVGAN---RGGIPDIVTDGVNGCLYEPDGVDGGAGSL  328

Query  484  GP----LLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  LL D   RE + + ARQE E++ W  AT+ +R+
Sbjct  329  TAAALRLLGDPSQREQLRRNARQEAERWGWAGATEQLRS  367



>ref|WP_011824740.1| glycosyl transferase [Prochlorococcus marinus]
 gb|ABM76807.1| SqdX [Prochlorococcus marinus str. MIT 9303]
Length=381

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V+DR+PEAR+A +GDGP+R++LE+ F G    F G L+GEEL+ AYASGD 
Sbjct  212  EKQIERIKPVLDRIPEARLALVGDGPHRQQLEKAFEGTATTFVGYLEGEELASAYASGDA  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVV A       I     DG    L+ P  +D   + L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVVGAN---RGGIPDIITDGVNGCLYEPDGVDGGSTSL  328

Query  484  GPLLR---DRDL-RETMGKAARQEMEKYDWRAATKMIRN  380
                R     DL R+ + KAARQE E++ W +AT+ +R+
Sbjct  329  INATRRLLGNDLERQGLRKAARQEAERWGWASATQQLRS  367



>ref|WP_041384827.1| glycosyl transferase [Prochlorococcus marinus]
Length=381

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V+DR+PEAR+A +GDGP+R++LE+ F G    F G L+GEEL+ AYASGD 
Sbjct  212  EKQIERIKPVLDRIPEARLALVGDGPHRQQLEKAFEGTATTFVGYLEGEELASAYASGDA  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVV A       I     DG    L+ P  +D   + L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVVGAN---RGGIPDIITDGVNGCLYEPDGVDGGSTSL  328

Query  484  GPLLR---DRDL-RETMGKAARQEMEKYDWRAATKMIRN  380
                R     DL R+ + KAARQE E++ W +AT+ +R+
Sbjct  329  INATRRLLGNDLERQGLRKAARQEAERWGWASATQQLRS  367



>ref|WP_019494764.1| glycosyl transferase [Calothrix sp. PCC 7103]
Length=378

 Score =   126 bits (317),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 108/171 (63%), Gaps = 5/171 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K +++ +P+AR+A +GDGP+R+ LE+ F+G  A F G L G EL  A+AS D 
Sbjct  211  EKEIERIKPILEAIPDARLALVGDGPHRQALEKHFAGTNAFFVGYLTGVELGSAFASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLD-DCLSK  488
            FV PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P   D   ++ 
Sbjct  271  FVFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGVNGYLFDPNTSDAGAIAA  327

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRA  335
               LL ++  RET+ + AR E EK+ W AAT  +++  Y   ++  ++K A
Sbjct  328  TIRLLSEKQERETIRQNARSEAEKWGWAAATSQLQS-YYRKVVYSVKQKVA  377



>ref|WP_040944064.1| glycosyl transferase, partial [Prochloron didemni]
Length=225

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 104/163 (64%), Gaps = 4/163 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +PEAR+A +GDGP R+++   F+G    F G L G EL+ AYAS D 
Sbjct  59   EKQIDEIKPVLEAIPEARLAIVGDGPARQDMFAHFAGTATHFVGYLHGLELASAYASADA  118

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAA +     I+    DG+  YLF+P +    ++  
Sbjct  119  FIFPSRTETLGLVLLEAMAAGCPVVAAAS---GGIVDIVTDGENGYLFDPLEPQSIITAT  175

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIW  356
              LL  ++ RE + + ARQE E++ W AAT  ++ E Y + ++
Sbjct  176  QRLLAAKEEREILRQNARQEAERWSWSAATGQLQ-EYYKSVVY  217



>ref|WP_025939760.1| glycosyl transferase [Prochlorococcus sp. scB245a_520B18]
Length=377

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 99/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +LR+ D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILRNEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_040937982.1| glycosyl transferase, partial [Prochloron didemni]
Length=209

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 104/163 (64%), Gaps = 4/163 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +PEAR+A +GDGP R+++   F+G    F G L G EL+ AYAS D 
Sbjct  47   EKQIDEIKPVLEAIPEARLAIVGDGPARKDMFAHFAGTATHFVGYLHGLELASAYASADA  106

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAA +     I+    DG+  YLF+P +    ++  
Sbjct  107  FIFPSRTETLGLVLLEAMAAGCPVVAAAS---GGIVDIVTDGENGYLFDPLEPQSIITAT  163

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIW  356
              LL  ++ RE + + ARQE E++ W AAT  ++ E Y + ++
Sbjct  164  QRLLAAKEEREILRQNARQEAERWSWSAATGQLQ-EYYKSVVY  205



>ref|WP_015133176.1| group 1 glycosyl transferase [Leptolyngbya sp. PCC 7376]
 gb|AFY37402.1| glycosyl transferase group 1 [Leptolyngbya sp. PCC 7376]
Length=378

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P +R+A +GDGPYR ELEE F+     F G LQG EL+ A+AS D 
Sbjct  211  EKQIDQIKPVLESIPGSRLAIVGDGPYRSELEEHFAETNTHFVGYLQGLELASAFASSDA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FV PS +ETLGLV+LEAM++G PVVAA +     I     DG+  ++F+P D D  +   
Sbjct  271  FVFPSRTETLGLVLLEAMAAGCPVVAANS---GGIPDIVTDGENGFMFDPADPDGAVKAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL   + RE M   AR E EK+ W AAT+ +R 
Sbjct  328  QRLLAATEEREAMRVNARLEAEKWGWAAATQQLRG  362



>emb|CAE20224.1| SqdX [Prochlorococcus marinus str. MIT 9313]
Length=409

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 102/159 (64%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V+DR+PEAR+A +GDGP+R++LE+ F G    F G L+GEEL+ AYASGD 
Sbjct  240  EKQIERIKPVLDRIPEARLALVGDGPHRQQLEKAFEGTATTFVGYLEGEELASAYASGDA  299

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVV A       I     DG    L+ P  +D   + L
Sbjct  300  FLFPSSTETLGLVLLEAMAAGCPVVGAN---RGGIPDIITDGVNGCLYEPDGVDGGSTSL  356

Query  484  GPLLR---DRDL-RETMGKAARQEMEKYDWRAATKMIRN  380
                R     DL R+ + KAARQE E++ W +AT+ +R+
Sbjct  357  INATRRLLGNDLERQGLRKAARQEAERWGWASATQQLRS  395



>ref|WP_028091028.1| glycosyl transferase [Dolichospermum circinale]
Length=377

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 106/169 (63%), Gaps = 6/169 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K +++ +P+AR+A +GDGP+R+ L++ F+G    F G L G+EL  A+AS D 
Sbjct  211  EKEIERIKPILEAIPDARLALVGDGPHRQALQKHFAGTNTYFVGYLMGKELGSAFASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNP-GDLDDCLSK  488
            F+ PS +ETLGLV+LEAM+SG PVVAAR+     I     DG   YLF+P  D+ + ++ 
Sbjct  271  FIFPSRTETLGLVLLEAMASGCPVVAARS---GGIPDIVTDGVNGYLFDPQADIQEAINA  327

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
               LL+ R     + K AR E EK+ W +ATK +++  Y   I F  +K
Sbjct  328  TVNLLKQRQEINIIRKNARAEAEKWGWSSATKQLQD--YYQKIVFNHEK  374



>ref|WP_015113812.1| group 1 glycosyl transferase [Nostoc sp. PCC 7107]
 gb|AFY43601.1| glycosyl transferase group 1 [Nostoc sp. PCC 7107]
Length=378

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K +++ +P+AR+A +GDGP+R+ LE+ F+G    F G L G EL  A+AS D 
Sbjct  211  EKEIERIKPILEAIPQARLALVGDGPHRQALEKHFAGTNTNFVGYLMGRELGSAFASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNP-GDLDDCLSK  488
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P  D+ D +S 
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGINGYLFDPKADIQDAISA  327

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
               LL ++  R+ + + AR+E EK+ W +AT+ +++
Sbjct  328  TIRLLENQQERDIIRQNARKEAEKWGWASATRQLQD  363



>ref|WP_028085475.1| glycosyl transferase [Dolichospermum circinale]
Length=377

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 105/169 (62%), Gaps = 6/169 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K ++  +P+AR+A +GDGP+R+ LE+ F+G    F G L G+EL  A+AS D 
Sbjct  211  EKEIERIKPILAAIPDARLALVGDGPHRQALEKHFAGTNTYFVGYLMGKELGSAFASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNP-GDLDDCLSK  488
            F+ PS +ETLGLV+LEAM+SG PVVAAR+     I     DG   YLF+P  D+ + ++ 
Sbjct  271  FIFPSRTETLGLVLLEAMASGCPVVAARS---GGIPDIVTDGVNGYLFDPQADIQEAINA  327

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKK  341
               LL+ R     + K AR E EK+ W +ATK +++  Y   I F  +K
Sbjct  328  TVNLLKQRQEINIIRKNARAEAEKWGWSSATKQLQD--YYQKIVFNHEK  374



>ref|WP_017655891.1| glycosyl transferase [Microchaete sp. PCC 7126]
Length=377

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 103/165 (62%), Gaps = 8/165 (5%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ ++ +++ +P AR+A +GDGP+R+ L+E F G    F G L G EL+ A+AS DV
Sbjct  211  EKEIERMRAILEAIPAARLALVGDGPHRQALKEHFHGTNTYFVGYLTGRELASAFASADV  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGD---LDD--  500
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF PG+   + D  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGVNGYLFEPGEQLSMSDSG  327

Query  499  CLSKLGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNA  365
             +  +  LL+ +    TM + AR E EK+ W AAT+ ++N  + A
Sbjct  328  AIKAVMNLLQHQQKHHTMRENARLEAEKWGWAAATQQLQNYYHKA  372



>ref|WP_023072791.1| group 1 glycosyl transferase [Leptolyngbya sp. Heron Island J]
 gb|ESA36438.1| group 1 glycosyl transferase [Leptolyngbya sp. Heron Island J]
Length=376

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 96/155 (62%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K ++  +PEAR+A +GDGPYREELEE F+G    F G L GEEL+ AYAS D 
Sbjct  211  EKEVDRIKPILAAIPEARLALVGDGPYREELEEHFAGTATNFVGYLGGEELASAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            FV PS +ETLGLV+LEAM++G P VAA A     I     DG   +LF+P D +  +   
Sbjct  271  FVFPSRTETLGLVLLEAMAAGCPTVAANA---GGIPDIVTDGTNGFLFDPKDEEGAIKAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL  R   E + + AR E E++ W  AT+ ++ 
Sbjct  328  QRLLAARAEIELLRRNARIEAERWGWCGATQQLQK  362



>ref|WP_011824631.1| glycosyl transferase [Prochlorococcus marinus]
 gb|ABM76692.1| SqdX [Prochlorococcus marinus str. NATL1A]
Length=382

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 100/159 (63%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ LP  R+A +GDGPYR++LE++F G    F G L G EL+ AYASGD 
Sbjct  212  EKQIERIKPVLEALPSTRLALVGDGPYRQQLEKIFQGTSTTFVGYLSGNELASAYASGDA  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNP-GDLDDCLSK  488
            F+ PS +ETLGLV+LEAM++G PVV A       I     DG+   L+NP G+ D  LS 
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVVGAN---KGGIPDIISDGENGCLYNPDGENDGALSL  328

Query  487  L---GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
            +     LL +   R +M KAAR E E++ W  ATK +++
Sbjct  329  IEATKKLLGNETERTSMRKAARSEAERWGWAGATKQLKS  367



>gb|KGF85728.1| Glycosyltransferase [Prochlorococcus marinus str. GP2]
Length=373

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 99/164 (60%), Gaps = 7/164 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  208  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  267

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  268  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  324

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNA  365
                  +L + D RE M K AR E EK+DW  AT  ++N   N 
Sbjct  325  IEATKKILENEDQREVMRKEARNEAEKWDWNQATLQLQNYYSNT  368



>ref|WP_010147154.1| glycosyl transferase group 1 protein, partial [Serinicoccus profundi]
Length=276

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 109/189 (58%), Gaps = 7/189 (4%)
 Frame = -1

Query  844  EKSLD-FLKRVMDRLPEA-RIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASG  671
            EK LD  L+ +    PE  R+AF+G GP REELE +F+G P VFTG L GE+L+ AYAS 
Sbjct  92   EKDLDQLLEPIRALAPEGVRLAFVGSGPAREELETMFAGTPTVFTGYLAGEDLASAYASA  151

Query  670  DVFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLS  491
            D F  PS +ETLGLV LE+M+S +PVV ARA     I    +DG   +L  PGD      
Sbjct  152  DAFAFPSTTETLGLVALESMASEVPVVGARA---GGIPFVIEDGVTGFLVEPGDTTGYAD  208

Query  490  KLGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWFWRKKRAQLLRPFQW  311
            +L  LL +  L++ MG AAR +   + WRA+T+ +  E Y  A+     +R  + +P + 
Sbjct  209  RLRRLLLEPGLKQRMGAAARADALTHSWRASTESL-VESYELAVERHAGRR-PVPKPLRA  266

Query  310  LFKRVFQPP  284
               R   PP
Sbjct  267  RAHRDLPPP  275



>ref|WP_032525173.1| glycosyl transferase [Prochlorococcus marinus]
Length=377

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 99/164 (60%), Gaps = 7/164 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNA  365
                  +L + D RE M K AR E EK+DW  AT  ++N   N 
Sbjct  329  IEATKKILENEDQREVMRKEARNEAEKWDWNQATLQLQNYYSNT  372



>ref|WP_038654761.1| glycosyl transferase [Prochlorococcus sp. MIT 0801]
 gb|AIQ98313.1| Glycosyltransferase [Prochlorococcus sp. MIT 0801]
Length=382

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 101/159 (64%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ LP  R+A +GDGPYR++LE++F G    F G L G+EL+ AYASGD 
Sbjct  212  EKQIERIKPVLEALPNTRLALVGDGPYRQQLEKIFQGTSTTFVGYLSGKELASAYASGDA  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNP-GDLDDCLSK  488
            F+ PS +ETLGLV+LEAM++G PVV A       I     DG+   L+NP G+ D  +S 
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVVGAN---KGGIPDIISDGENGCLYNPDGENDGAVSL  328

Query  487  L---GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
            +     LL +   R TM +AAR E E++ W  ATK +R+
Sbjct  329  IEATKKLLGNEIERTTMRQAARSEAERWGWAGATKQLRS  367



>ref|WP_025928974.1| glycosyl transferase [Prochlorococcus sp. scB243_495G23]
Length=377

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A+      I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAK---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_017713210.1| glycosyl transferase [Prochlorothrix hollandica]
Length=376

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 98/155 (63%), Gaps = 3/155 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D +K V++ +P AR+A +G+GP+REELE  F+G    F G L GE+L  AYAS D 
Sbjct  211  EKQVDQIKGVLEAIPSARLALVGNGPHREELESHFAGTKTHFVGYLHGEDLGSAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+AA A     I     DG   +LF+P D    +   
Sbjct  271  FMFPSRTETLGLVLLEAMAAGCPVIAANA---GGIPDIVTDGDNGFLFDPQDDQGLVKAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
              LL ++  RE + + ARQE E++ W AAT+ ++ 
Sbjct  328  ERLLANQIERERLRRNARQEAERWGWAAATRQLQG  362



>ref|WP_036905889.1| glycosyl transferase [Prochlorococcus marinus]
 gb|KGG20553.1| Glycosyltransferase [Prochlorococcus marinus str. PAC1]
Length=382

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 100/159 (63%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ LP  R+A +GDGPYR++LE++F G    F G L G EL+ AYASGD 
Sbjct  212  EKQIERIKPVLEALPSTRLALVGDGPYRQQLEKIFQGTSTTFVGYLSGNELASAYASGDA  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNP-GDLDDCLSK  488
            F+ PS +ETLGLV+LEAM++G PVV A       I     DGK   L+NP G+ D  LS 
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVVGAN---KGGIPDIISDGKNGCLYNPDGENDGALSL  328

Query  487  L---GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
            +     LL +   R +M KAAR E E++ W  ATK +++
Sbjct  329  IEATKKLLGNEIERTSMRKAARSEAERWGWAGATKQLKS  367



>ref|WP_025947052.1| glycosyl transferase [Prochlorococcus sp. scB241_528N20]
Length=377

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     +G    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISNGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_017662025.1| glycosyl transferase [Geitlerinema sp. PCC 7105]
Length=377

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 99/158 (63%), Gaps = 5/158 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK +D ++ V++ +P AR+A +GDGP+R+ LEE F+  P  F G L+G EL  AYAS D 
Sbjct  211  EKEIDRIRPVLEAIPNARLALVGDGPHRQALEEHFAETPTNFVGYLKGLELGAAYASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAA   G   I     DG   YLF P D +  +   
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAA---GTGGITDIVTDGSNGYLFEPADEEGAIRAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQY  371
              LL +   RET+   AR+E E++ W AAT+ +  +QY
Sbjct  328  QRLLDNTQERETLRANARREAERWGWEAATRNL--QQY  363



>ref|WP_025927153.1| glycosyl transferase [Prochlorococcus sp. scB241_528J8]
Length=377

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGIQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025974177.1| glycosyl transferase [Prochlorococcus sp. scB241_529B19]
Length=377

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNASLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARTEAEKWDWNQATLQLQN  367



>ref|WP_011295609.1| glycosyl transferase [Prochlorococcus marinus]
 gb|AAZ58755.1| glycosyltransferase [Prochlorococcus marinus str. NATL2A]
Length=382

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 100/159 (63%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ LP  R+A +GDGPYR++LE++F G    F G L G EL+ AYASGD 
Sbjct  212  EKQIERIKPVLEALPSTRLALVGDGPYRQQLEKIFQGTSTTFVGYLSGNELASAYASGDA  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNP-GDLDDCLSK  488
            F+ PS +ETLGLV+LEAM++G PVV A       I     DG+   L+NP G+ D  LS 
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVVGAN---KGGIPDIISDGENGCLYNPDGENDGALSL  328

Query  487  L---GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
            +     LL +   R +M KAAR E E++ W  ATK +++
Sbjct  329  IEATKKLLGNEIERTSMRKAARSEAERWGWAGATKQLKS  367



>ref|WP_029421832.1| glycosyl transferase [Alicyclobacillus macrosporangiidus]
Length=381

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 94/158 (59%), Gaps = 3/158 (2%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK L+ L+  +DRLP   +A +GDGP+R ELE +F+G    FTG L GEEL++AYAS D 
Sbjct  212  EKGLERLRPCLDRLPGVHLALVGDGPHRAELERVFAGSNTTFTGYLFGEELAQAYASADA  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+ EAM+SG+PV+AA +   P        G+  +LFNP D    L  +
Sbjct  272  FIFPSTTETLGLVMYEAMASGLPVMAADS---PATREVLLHGEAGWLFNPLDTASILGAI  328

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQY  371
               L D D RE + +   +   K DW   TK + +  Y
Sbjct  329  EDWLGDADKRERVARRGLEVASKLDWSGPTKQLIHHYY  366



>ref|WP_025927759.1| MULTISPECIES: glycosyl transferase [Prochlorococcus]
Length=377

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025967336.1| glycosyl transferase [Prochlorococcus sp. scB243_498P3]
Length=377

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025965084.1| glycosyl transferase [Prochlorococcus sp. scB243_498P15]
Length=377

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025913940.1| MULTISPECIES: glycosyl transferase [Prochlorococcus]
Length=377

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025882496.1| glycosyl transferase [Prochlorococcus sp. scB241_527E14]
Length=377

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025925654.1| MULTISPECIES: glycosyl transferase [Prochlorococcus]
Length=377

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_036899853.1| glycosyl transferase [Prochlorococcus marinus]
Length=376

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 99/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++++P+A +A +GDGPYR +LE++F      F G L GEEL+ AYASGD+
Sbjct  212  EKQIERIKPVLEKIPDASLALVGDGPYRNQLEKIFENTKTNFIGYLAGEELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDD----C  497
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P   D+     
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIINDGINGCLYDPDQKDNGKESL  328

Query  496  LSKLGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
            ++    +L+D   +E M  AAR E EK+DW  AT  ++N
Sbjct  329  IAATKKILQDNSKKEKMRIAARTEAEKWDWNQATLQLKN  367



>ref|WP_025945509.1| glycosyl transferase [Prochlorococcus sp. scB241_528N17]
Length=377

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025893675.1| glycosyl transferase [Prochlorococcus sp. scB241_527N11]
Length=377

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025971371.1| glycosyl transferase [Prochlorococcus sp. scB245a_521N5]
Length=377

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025980084.1| MULTISPECIES: glycosyl transferase [Prochlorococcus]
Length=377

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025947613.1| glycosyl transferase [Prochlorococcus sp. scB241_528N8]
Length=377

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_025923704.1| glycosyl transferase [Prochlorococcus sp. scB243_495D8]
Length=377

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IKATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_008180177.1| glycosyl transferase [Moorea producens]
 gb|EGJ34506.1| glycosyltransferase [Moorea producens 3L]
Length=377

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 99/164 (60%), Gaps = 5/164 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGP+R+ELE  F+G P  F G L G  L  A+AS D 
Sbjct  211  EKEIERIKLVLEAIPNACLALVGDGPHRKELEAHFAGTPTHFVGYLTGTTLGSAFASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PVVAA +     I     DG   YL++P D    ++  
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAANS---GGIPDIVTDGMNGYLYDPADEQGAIAAT  327

Query  484  GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRNEQYNAAIWF  353
              LL  +  RET+ + AR E E++ W AAT+ +  + Y   I F
Sbjct  328  QRLLAQQQERETLRRNARAEAERWSWSAATRQL--QHYYQTIVF  369



>gb|ABO18479.1| SqdX [Prochlorococcus marinus str. MIT 9301]
 gb|KGG08614.1| Glycosyltransferase [Prochlorococcus marinus str. SB]
Length=373

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  208  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  267

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  268  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  324

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  325  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  363



>ref|WP_029150485.1| glycosyl transferase [Microbacterium indicum]
Length=396

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 90/154 (58%), Gaps = 4/154 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEA-RIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
            EK LD L+  +DR P+  R+AF+GDGP   +L  LF G P VFTG L+G +L  AYAS D
Sbjct  212  EKDLDLLRHALDRAPQGTRLAFVGDGPAAADLRALFRGTPTVFTGPLRGRDLDEAYASAD  271

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
            VF  PS +ETLGLV LEAM+SG PVV A A     I     DG    L  P D  D   K
Sbjct  272  VFAFPSTTETLGLVALEAMASGTPVVGADA---GGIPFAVPDGVGGLLARPRDAADLSEK  328

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMI  386
            L  +L D  LR  + + AR   E + WRA+T+ +
Sbjct  329  LNRVLTDAGLRSRLAEGARAATEPFGWRASTEAL  362



>ref|WP_025938801.1| glycosyl transferase [Prochlorococcus sp. scB245a_519A13]
Length=377

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++ +P A +A +GDGPYR +LE++F      F G L G+EL+ AYASGD+
Sbjct  212  EKQIERIKPVLESIPNACLALVGDGPYRNQLEKIFENTKTNFIGYLSGDELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSKL  485
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P + D+ +  L
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIISDGINGCLYDPDEKDNGVQSL  328

Query  484  ----GPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
                  +L + D RE M K AR E EK+DW  AT  ++N
Sbjct  329  IEATKKILENEDKREIMRKEARNEAEKWDWNQATLQLQN  367



>ref|WP_010996422.1| glycosyl transferase [Nostoc sp. PCC 7120]
 dbj|BAB73964.1| sulfolipid sulfoquinovosyldiacylglycerol biosynthesis protein 
[Nostoc sp. PCC 7120]
Length=378

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 101/156 (65%), Gaps = 4/156 (3%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K +++ +P+AR+A +GDGP+R+ LE+ F G    F G L G EL  A+AS D 
Sbjct  211  EKEIERIKPILEAIPQARLALVGDGPHRQALEKHFFGTNTHFVGYLTGRELGSAFASADA  270

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNP-GDLDDCLSK  488
            F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLFNP  D+ D ++ 
Sbjct  271  FIFPSRTETLGLVLLEAMAAGCPVVAARS---GGIPDIVTDGVNGYLFNPKADIQDAINA  327

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
               LL +   R+T+ + AR+E E + W +AT+ +++
Sbjct  328  TVRLLENAQERDTIRQNARREAEGWGWASATRQLQD  363



>ref|WP_042156569.1| glycosyl transferase [Planktothrix agardhii]
 gb|KEI69010.1| Glycosyl transferase group 1 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=377

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 98/155 (63%), Gaps = 3/155 (2%)
 Frame = -1

Query  847  VEKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGD  668
             EK ++ +K V++++P +R+A +GDGP R+ LE  F G P  F G L+G++L+ AYAS D
Sbjct  210  TEKEIERIKPVLEKIPNSRLALVGDGPNRQVLEAHFRGTPTHFVGYLRGKDLATAYASAD  269

Query  667  VFVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDDCLSK  488
             F+ PS +ETLGLV+LEAM++G PVVAAR+     I     DG   YLF+P   D  ++ 
Sbjct  270  AFIFPSRTETLGLVLLEAMAAGTPVVAARS---GGIPDIVTDGVNGYLFDPRQEDGAITA  326

Query  487  LGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIR  383
               L  +   RE + + AR+E E + W AAT+ +R
Sbjct  327  TQRLFDNSQEREILRQNARKEAESWGWAAATQQLR  361



>ref|WP_019474951.1| glycosyl transferase [Prochlorococcus sp. W2]
Length=378

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 98/159 (62%), Gaps = 7/159 (4%)
 Frame = -1

Query  844  EKSLDFLKRVMDRLPEARIAFIGDGPYREELEELFSGMPAVFTGTLQGEELSRAYASGDV  665
            EK ++ +K V++++P+A +A +GDGPYR +LE++F      F G L GEEL+ AYASGD+
Sbjct  212  EKQIERIKPVLEKIPDASLALVGDGPYRNQLEKIFENTKTNFIGYLAGEELASAYASGDI  271

Query  664  FVMPSESETLGLVVLEAMSSGIPVVAARAggipdiipddqdgkISYLFNPGDLDD----C  497
            F+ PS +ETLGLV+LEAM++G PV+ A       I     DG    L++P   D+     
Sbjct  272  FLFPSSTETLGLVLLEAMAAGCPVIGAN---KGGIPDIINDGVNGCLYDPDQQDNGKESL  328

Query  496  LSKLGPLLRDRDLRETMGKAARQEMEKYDWRAATKMIRN  380
            ++    +L D   +E M  AAR E EK+DW  AT  ++N
Sbjct  329  IAATKKILEDNSKKEKMRIAARTEAEKWDWNQATLQLKN  367



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1792753749675