BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF039H17

Length=921
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009604104.1|  PREDICTED: nuclear cap-binding protein subun...    208   5e-88   Nicotiana tomentosiformis
ref|XP_009758879.1|  PREDICTED: nuclear cap-binding protein subun...    207   6e-87   Nicotiana sylvestris
ref|XP_009605652.1|  PREDICTED: nuclear cap-binding protein subun...    192   9e-84   
ref|XP_009357142.1|  PREDICTED: nuclear cap-binding protein subun...    199   1e-83   Pyrus x bretschneideri [bai li]
gb|AFK38601.1|  unknown                                                 197   2e-83   Lotus japonicus
ref|XP_004233527.1|  PREDICTED: nuclear cap-binding protein subun...    196   2e-83   Solanum lycopersicum
ref|NP_001275117.1|  nuclear cap-binding protein CBP20                  194   4e-83   Solanum tuberosum [potatoes]
ref|XP_006346957.1|  PREDICTED: nuclear cap-binding protein subun...    193   6e-83   Solanum tuberosum [potatoes]
gb|ACN43580.1|  nuclear cap-binding protein                             193   7e-83   Solanum tuberosum [potatoes]
gb|ACL54982.1|  nuclear cap-binding protein CBP20                       192   2e-82   Solanum tuberosum [potatoes]
ref|XP_008381576.1|  PREDICTED: nuclear cap-binding protein subun...    197   5e-82   Malus domestica [apple tree]
gb|KCW47249.1|  hypothetical protein EUGRSUZ_K01050                     193   5e-82   Eucalyptus grandis [rose gum]
ref|XP_010035788.1|  PREDICTED: nuclear cap-binding protein subun...    192   1e-81   Eucalyptus grandis [rose gum]
ref|XP_008342882.1|  PREDICTED: nuclear cap-binding protein subun...    193   1e-81   
ref|XP_011096094.1|  PREDICTED: nuclear cap-binding protein subun...    192   4e-81   Sesamum indicum [beniseed]
gb|ACN43581.1|  nuclear cap-binding protein                             190   5e-81   Solanum tuberosum [potatoes]
ref|XP_009354294.1|  PREDICTED: nuclear cap-binding protein subun...    186   1e-79   Pyrus x bretschneideri [bai li]
ref|XP_010688443.1|  PREDICTED: nuclear cap-binding protein subun...    187   5e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007043674.1|  CAP-binding protein 20 isoform 2                   181   2e-78   
ref|XP_002276868.1|  PREDICTED: nuclear cap-binding protein subun...    182   3e-78   Vitis vinifera
ref|XP_006372745.1|  hypothetical protein POPTR_0017s04640g             180   3e-77   Populus trichocarpa [western balsam poplar]
ref|XP_011029071.1|  PREDICTED: nuclear cap-binding protein subun...    179   3e-77   Populus euphratica
gb|AIX10951.1|  nuclear cap-binding protein subunit 2-like protein      184   5e-77   Gardenia jasminoides
gb|KJB31634.1|  hypothetical protein B456_005G199600                    174   1e-76   Gossypium raimondii
ref|XP_006591867.1|  PREDICTED: uncharacterized protein LOC100789...    172   2e-76   
ref|XP_011466924.1|  PREDICTED: nuclear cap-binding protein subun...    175   6e-76   Fragaria vesca subsp. vesca
gb|KJB31636.1|  hypothetical protein B456_005G199600                    171   6e-76   Gossypium raimondii
ref|XP_006447223.1|  hypothetical protein CICLE_v10016365mg             171   9e-76   Citrus clementina [clementine]
ref|XP_007198839.1|  hypothetical protein PRUPE_ppa010346mg             173   2e-75   Prunus persica
ref|XP_008229021.1|  PREDICTED: nuclear cap-binding protein subun...    173   2e-75   Prunus mume [ume]
ref|XP_006594834.1|  PREDICTED: nuclear cap-binding protein subun...    171   3e-75   Glycine max [soybeans]
ref|XP_007149811.1|  hypothetical protein PHAVU_005G100900g             171   3e-75   Phaseolus vulgaris [French bean]
gb|KJB31635.1|  hypothetical protein B456_005G199600                    169   4e-75   Gossypium raimondii
ref|XP_010441918.1|  PREDICTED: nuclear cap-binding protein subun...    174   4e-75   
ref|XP_010441915.1|  PREDICTED: nuclear cap-binding protein subun...    174   6e-75   
ref|XP_010481768.1|  PREDICTED: nuclear cap-binding protein subun...    174   6e-75   Camelina sativa [gold-of-pleasure]
ref|XP_011047689.1|  PREDICTED: nuclear cap-binding protein subun...    172   8e-75   Populus euphratica
ref|XP_002309756.2|  hypothetical protein POPTR_0007s01170g             171   3e-74   
gb|ABK96113.1|  unknown                                                 170   6e-74   Populus trichocarpa [western balsam poplar]
ref|XP_006280871.1|  hypothetical protein CARUB_v10026861mg             171   2e-73   
ref|XP_009383469.1|  PREDICTED: nuclear cap-binding protein subun...    169   5e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010522593.1|  PREDICTED: nuclear cap-binding protein subun...    166   7e-73   Tarenaya hassleriana [spider flower]
ref|XP_004487199.1|  PREDICTED: nuclear cap-binding protein subun...    164   7e-73   Cicer arietinum [garbanzo]
ref|XP_010522592.1|  PREDICTED: nuclear cap-binding protein subun...    164   4e-72   Tarenaya hassleriana [spider flower]
gb|EYU22773.1|  hypothetical protein MIMGU_mgv1a012251mg                160   7e-72   Erythranthe guttata [common monkey flower]
ref|XP_004137136.1|  PREDICTED: nuclear cap-binding protein subun...    163   2e-71   Cucumis sativus [cucumbers]
ref|XP_008464581.1|  PREDICTED: nuclear cap-binding protein subun...    162   3e-71   Cucumis melo [Oriental melon]
ref|XP_009101729.1|  PREDICTED: nuclear cap-binding protein subun...    160   9e-71   Brassica rapa
ref|XP_002863606.1|  cap-binding protein 20                             159   2e-70   
ref|NP_001242001.1|  uncharacterized protein LOC100789535               150   7e-70   
ref|XP_006380277.1|  hypothetical protein POPTR_0007s01170g             157   7e-70   
ref|XP_009413394.1|  PREDICTED: nuclear cap-binding protein subun...    166   8e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG20168.1|  Nuclear cap-binding subunit 2 -like protein             150   1e-69   Gossypium arboreum [tree cotton]
ref|NP_199233.1|  nuclear cap-binding protein subunit 20                156   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517864.1|  20 kD nuclear cap binding protein, putative        153   3e-69   
gb|KEH39183.1|  nuclear cap-binding protein subunit 2                   154   5e-69   Medicago truncatula
ref|XP_006403129.1|  hypothetical protein EUTSA_v10003260mg             152   3e-68   Eutrema salsugineum [saltwater cress]
gb|KGN53785.1|  hypothetical protein Csa_4G129020                       153   4e-68   Cucumis sativus [cucumbers]
ref|XP_010904911.1|  PREDICTED: nuclear cap-binding protein subun...    157   4e-68   Elaeis guineensis
ref|XP_008809996.1|  PREDICTED: nuclear cap-binding protein subun...    155   4e-68   Phoenix dactylifera
emb|CDX94763.1|  BnaC07g17720D                                          150   7e-68   
emb|CDY22302.1|  BnaA06g36240D                                          148   3e-67   Brassica napus [oilseed rape]
gb|KDP24088.1|  hypothetical protein JCGZ_25745                         148   4e-67   Jatropha curcas
ref|XP_007043673.1|  CAP-binding protein 20 isoform 1                   140   2e-65   
ref|XP_006647502.1|  PREDICTED: nuclear cap-binding protein subun...    141   2e-65   Oryza brachyantha
gb|AIN39831.1|  hypothetical protein                                    140   7e-65   Zoysia matrella [Japanese carpet grass]
ref|NP_001147247.1|  LOC100280855                                       139   2e-64   Zea mays [maize]
gb|AFW62948.1|  hypothetical protein ZEAMMB73_103683                    139   4e-64   
ref|XP_004953081.1|  PREDICTED: nuclear cap-binding protein subun...    137   5e-64   Setaria italica
ref|NP_001047412.1|  Os02g0612300                                       140   6e-64   
ref|XP_004953080.1|  PREDICTED: nuclear cap-binding protein subun...    137   8e-64   
ref|XP_002454163.1|  hypothetical protein SORBIDRAFT_04g025800          137   1e-63   Sorghum bicolor [broomcorn]
gb|ACO90183.1|  nuclear cap-binding protein 20                          141   1e-62   Nicotiana tabacum [American tobacco]
ref|XP_003575342.1|  PREDICTED: nuclear cap-binding protein subun...    134   2e-62   Brachypodium distachyon [annual false brome]
gb|ACA24134.1|  cap-binding protein CBP20                               135   3e-62   Lolium temulentum
ref|NP_001150096.1|  LOC100283725                                       133   3e-61   
gb|ACL83596.1|  CBP20                                                   134   1e-60   Hordeum vulgare [barley]
gb|AFW72309.1|  hypothetical protein ZEAMMB73_547300                    134   2e-59   
ref|XP_004953078.1|  PREDICTED: nuclear cap-binding protein subun...    136   9e-58   
ref|XP_004953079.1|  PREDICTED: nuclear cap-binding protein subun...    136   9e-58   
gb|ABR26569.1|  cap-binding protein CPB20                               134   3e-57   Lolium perenne [perennial ryegrass]
gb|EYU22772.1|  hypothetical protein MIMGU_mgv1a012251mg                159   4e-55   Erythranthe guttata [common monkey flower]
ref|XP_010112771.1|  Nuclear cap-binding protein subunit 2              137   8e-54   
gb|ABK25999.1|  unknown                                                 131   1e-50   Picea sitchensis
ref|XP_010260317.1|  PREDICTED: nuclear cap-binding protein subun...    173   2e-48   Nelumbo nucifera [Indian lotus]
gb|ACG49204.1|  nuclear cap-binding protein subunit 2                   134   2e-48   Zea mays [maize]
gb|AAT07459.1|  cap-binding protein                                     136   6e-48   Mirabilis jalapa
ref|XP_010694058.1|  PREDICTED: nuclear cap-binding protein subun...    128   8e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009774544.1|  PREDICTED: nuclear cap-binding protein subun...    144   3e-45   Nicotiana sylvestris
gb|KCW47250.1|  hypothetical protein EUGRSUZ_K01050                     139   4e-44   Eucalyptus grandis [rose gum]
gb|KDO43068.1|  hypothetical protein CISIN_1g037453mg                   140   6e-44   Citrus sinensis [apfelsine]
gb|KHN36662.1|  Nuclear cap-binding protein subunit 2                   138   2e-43   Glycine soja [wild soybean]
emb|CDP10731.1|  unnamed protein product                                140   2e-43   Coffea canephora [robusta coffee]
gb|ACN28303.1|  unknown                                                 138   2e-43   Zea mays [maize]
gb|KHN27908.1|  Nuclear cap-binding protein subunit 2                   160   2e-43   Glycine soja [wild soybean]
emb|CBI21896.3|  unnamed protein product                                137   3e-43   Vitis vinifera
gb|KDD72944.1|  hypothetical protein H632_c2705p0                       121   2e-42   Helicosporidium sp. ATCC 50920
gb|EMS64515.1|  Nuclear cap-binding protein subunit 2                   135   2e-42   Triticum urartu
gb|EPS58818.1|  hypothetical protein M569_15995                         134   2e-42   Genlisea aurea
ref|XP_006838981.1|  hypothetical protein AMTR_s00002p00271460          130   3e-41   
ref|XP_011398229.1|  Nuclear cap-binding protein subunit 2              117   7e-41   Auxenochlorella protothecoides
ref|XP_009787371.1|  PREDICTED: nuclear cap-binding protein subun...    145   2e-39   Nicotiana sylvestris
ref|XP_002989180.1|  hypothetical protein SELMODRAFT_129288             125   3e-39   
ref|XP_002987302.1|  hypothetical protein SELMODRAFT_125790             125   3e-39   
ref|XP_005646121.1|  cap-binding protein                                118   5e-39   Coccomyxa subellipsoidea C-169
ref|XP_005846487.1|  hypothetical protein CHLNCDRAFT_14225              113   1e-37   Chlorella variabilis
ref|XP_002946588.1|  hypothetical protein VOLCADRAFT_79141              102   2e-37   Volvox carteri f. nagariensis
ref|XP_005178552.2|  PREDICTED: nuclear cap-binding protein subun...    107   3e-37   Musca domestica
gb|ELT96352.1|  hypothetical protein CAPTEDRAFT_149941                  108   5e-37   Capitella teleta
gb|AFW62946.1|  hypothetical protein ZEAMMB73_103683                    138   7e-37   
ref|XP_004335873.1|  RNA recognition domain containing protein          107   1e-36   Acanthamoeba castellanii str. Neff
ref|XP_009594973.1|  PREDICTED: nuclear cap-binding protein subun...    137   4e-36   
ref|XP_011176485.1|  PREDICTED: nuclear cap-binding protein subun...    104   4e-36   Zeugodacus cucurbitae [melon fruit fly]
gb|ACN34918.1|  unknown                                                 141   5e-36   Zea mays [maize]
ref|XP_004518120.1|  PREDICTED: nuclear cap-binding protein subun...    104   5e-36   Ceratitis capitata [medfly]
ref|XP_002166119.2|  PREDICTED: nuclear cap-binding protein subun...    107   6e-36   
ref|XP_009031866.1|  hypothetical protein HELRODRAFT_91084              105   6e-36   Helobdella robusta
ref|XP_011208204.1|  PREDICTED: nuclear cap-binding protein subun...    103   8e-36   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011421116.1|  PREDICTED: nuclear cap-binding protein subun...    106   9e-36   Crassostrea gigas
ref|XP_010622332.1|  PREDICTED: nuclear cap-binding protein subun...    105   9e-36   Fukomys damarensis [Damara mole rat]
gb|EFA03363.1|  hypothetical protein TcasGA2_TC013348                   103   9e-36   
ref|XP_002160076.1|  PREDICTED: nuclear cap-binding protein subun...    107   1e-35   Hydra vulgaris
ref|XP_003745498.1|  PREDICTED: nuclear cap-binding protein subun...    102   1e-35   Galendromus occidentalis
gb|EDK97761.1|  nuclear cap binding protein subunit 2, isoform CRA_b    105   1e-35   Mus musculus [mouse]
gb|ENN74806.1|  hypothetical protein YQE_08579                          102   1e-35   Dendroctonus ponderosae
ref|XP_001690572.1|  hypothetical protein CHLREDRAFT_169371             103   2e-35   Chlamydomonas reinhardtii
ref|XP_001954395.1|  GF16759                                            104   2e-35   Drosophila ananassae
ref|XP_001632015.1|  predicted protein                                  109   2e-35   Nematostella vectensis
ref|XP_001994622.1|  GH15101                                            103   2e-35   Drosophila grimshawi
gb|KDR17129.1|  Nuclear cap-binding protein subunit 2                   103   2e-35   Zootermopsis nevadensis
ref|XP_003063843.1|  predicted protein                                98.6    2e-35   Micromonas pusilla CCMP1545
ref|XP_002053575.1|  GJ23276                                            103   3e-35   Drosophila virilis
gb|KFO33122.1|  Nuclear cap-binding protein subunit 2                   105   4e-35   Fukomys damarensis [Damara mole rat]
ref|XP_009050432.1|  hypothetical protein LOTGIDRAFT_186993             107   4e-35   Lottia gigantea
gb|AAP36198.1|  Homo sapiens nuclear cap binding protein subunit ...    105   4e-35   synthetic construct
ref|XP_002401570.1|  Cap binding protein, putative                      104   4e-35   Ixodes scapularis [blacklegged tick]
ref|XP_008549903.1|  PREDICTED: nuclear cap-binding protein subun...    103   5e-35   Microplitis demolitor
ref|XP_005344885.1|  PREDICTED: nuclear cap-binding protein subun...    105   5e-35   Microtus ochrogaster [prairie voles]
ref|XP_011250963.1|  PREDICTED: nuclear cap-binding protein subun...    103   5e-35   Camponotus floridanus
ref|XP_010957606.1|  PREDICTED: nuclear cap-binding protein subun...    104   5e-35   Camelus bactrianus [camel]
ref|XP_006974561.1|  PREDICTED: nuclear cap-binding protein subun...    105   5e-35   Peromyscus maniculatus bairdii
ref|XP_004876671.1|  PREDICTED: nuclear cap-binding protein subun...    105   5e-35   
gb|EDM11451.1|  rCG52909, isoform CRA_a                                 104   5e-35   Rattus norvegicus [brown rat]
ref|XP_001998283.1|  GI23717                                            102   6e-35   Drosophila mojavensis
ref|XP_011336388.1|  PREDICTED: nuclear cap-binding protein subun...    102   6e-35   Ooceraea biroi
ref|XP_003692414.1|  PREDICTED: nuclear cap-binding protein subun...    103   6e-35   Apis florea [dwarf honeybee]
ref|NP_080830.1|  nuclear cap-binding protein subunit 2                 105   6e-35   Mus musculus [mouse]
emb|CDJ82645.1|  RNA recognition motif domain containing protein        110   6e-35   Haemonchus contortus [red stomach worm]
ref|XP_397316.1|  PREDICTED: nuclear cap-binding protein subunit ...    103   6e-35   Apis mellifera [bee]
ref|XP_005341025.1|  PREDICTED: nuclear cap-binding protein subun...    104   6e-35   Ictidomys tridecemlineatus
ref|XP_011164867.1|  PREDICTED: nuclear cap-binding protein subun...    102   7e-35   Solenopsis invicta [imported red fire ant]
ref|XP_010992712.1|  PREDICTED: nuclear cap-binding protein subun...    105   7e-35   Camelus dromedarius [camel]
ref|XP_011067287.1|  PREDICTED: nuclear cap-binding protein subun...    102   7e-35   Acromyrmex echinatior
ref|XP_005703214.1|  nuclear cap-binding protein subunit 2              110   7e-35   Galdieria sulphuraria
ref|XP_003477149.1|  PREDICTED: nuclear cap-binding protein subun...    105   8e-35   Cavia porcellus [guinea pig]
ref|XP_002070032.1|  GK11244                                            102   8e-35   Drosophila willistoni
ref|XP_006884350.1|  PREDICTED: nuclear cap-binding protein subun...    105   9e-35   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002096138.1|  GE25514                                            102   9e-35   Drosophila yakuba
ref|XP_008767006.1|  PREDICTED: nuclear cap-binding protein subun...    104   1e-34   
ref|XP_001608109.1|  PREDICTED: nuclear cap-binding protein subun...    103   1e-34   Nasonia vitripennis
ref|XP_001979694.1|  GG22670                                            101   1e-34   Drosophila erecta
gb|EPY85295.1|  nuclear cap-binding protein subunit 2 isoform 1         105   1e-34   Camelus ferus
ref|XP_003394780.1|  PREDICTED: nuclear cap-binding protein subun...    102   1e-34   Bombus terrestris [large earth bumblebee]
ref|XP_001600470.2|  PREDICTED: nuclear cap-binding protein subun...    104   1e-34   Nasonia vitripennis
ref|XP_004465946.1|  PREDICTED: nuclear cap-binding protein subun...    105   1e-34   Dasypus novemcinctus
ref|NP_524396.1|  cap binding protein 20                                101   1e-34   Drosophila melanogaster
ref|XP_011506502.1|  PREDICTED: nuclear cap-binding protein subun...    102   1e-34   Ceratosolen solmsi marchali
ref|XP_011148098.1|  PREDICTED: nuclear cap-binding protein subun...    101   1e-34   Harpegnathos saltator
ref|XP_008007826.1|  PREDICTED: nuclear cap-binding protein subun...    105   1e-34   Chlorocebus sabaeus
ref|XP_011384673.1|  PREDICTED: nuclear cap-binding protein subun...    105   1e-34   Pteropus vampyrus
ref|XP_005545356.1|  PREDICTED: nuclear cap-binding protein subun...    105   1e-34   Macaca fascicularis [crab eating macaque]
ref|NP_031388.2|  nuclear cap-binding protein subunit 2 isoform 1       105   2e-34   Homo sapiens [man]
ref|XP_004278828.1|  PREDICTED: nuclear cap-binding protein subun...    105   2e-34   Orcinus orca [Orca]
dbj|BAA09599.1|  NCBP interacting protein 1                             105   2e-34   Homo sapiens [man]
ref|XP_005961506.1|  PREDICTED: nuclear cap-binding protein subun...    105   2e-34   Pantholops hodgsonii [Tibetan antelope]
ref|XP_001359956.1|  GA11577                                            101   2e-34   Drosophila pseudoobscura pseudoobscura
ref|XP_002716573.1|  PREDICTED: nuclear cap-binding protein subun...    104   2e-34   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004675178.1|  PREDICTED: nuclear cap-binding protein subun...    104   2e-34   Condylura cristata
ref|XP_010379473.1|  PREDICTED: nuclear cap-binding protein subun...    104   2e-34   Rhinopithecus roxellana
ref|XP_010992713.1|  PREDICTED: nuclear cap-binding protein subun...    105   2e-34   Camelus dromedarius [camel]
ref|XP_003412984.1|  PREDICTED: nuclear cap-binding protein subun...    105   2e-34   Loxodonta africana [African bush elephant]
ref|XP_008007825.1|  PREDICTED: nuclear cap-binding protein subun...    105   2e-34   Chlorocebus sabaeus
ref|XP_010379472.1|  PREDICTED: nuclear cap-binding protein subun...    104   3e-34   Rhinopithecus roxellana
ref|XP_007465922.1|  PREDICTED: nuclear cap-binding protein subun...    105   3e-34   Lipotes vexillifer [baiji]
gb|EMT25461.1|  Nuclear cap-binding protein subunit 2                   135   3e-34   
emb|CBY24385.1|  unnamed protein product                                100   3e-34   Oikopleura dioica
gb|ACL54295.1|  unknown                                                 132   5e-34   Zea mays [maize]
ref|XP_006637539.1|  PREDICTED: nuclear cap-binding protein subun...    102   5e-34   Lepisosteus oculatus
ref|XP_007517494.1|  PREDICTED: nuclear cap-binding protein subun...    104   5e-34   Erinaceus europaeus [common hedgehog]
ref|XP_003228961.1|  PREDICTED: nuclear cap-binding protein subun...    100   5e-34   Anolis carolinensis [Carolina anole]
gb|EHH51794.1|  hypothetical protein EGM_11239                          103   5e-34   Macaca fascicularis [crab eating macaque]
ref|XP_005107563.1|  PREDICTED: nuclear cap-binding protein subun...    104   5e-34   Aplysia californica
ref|XP_003700782.1|  PREDICTED: nuclear cap-binding protein subun...    100   6e-34   Megachile rotundata
ref|XP_011299634.1|  PREDICTED: nuclear cap-binding protein subun...    102   6e-34   Fopius arisanus
gb|EEC73582.1|  hypothetical protein OsI_08043                          106   6e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001155469.1|  nuclear cap-binding protein subunit 2-like         103   7e-34   Acyrthosiphon pisum
ref|XP_006258125.1|  PREDICTED: nuclear cap-binding protein subun...  98.6    7e-34   Alligator mississippiensis
ref|XP_002603437.1|  hypothetical protein BRAFLDRAFT_158723             105   7e-34   Branchiostoma floridae
gb|KGG51643.1|  hypothetical protein DI09_2p200                         106   8e-34   Mitosporidium daphniae
ref|XP_637361.1|  RNA-binding region RNP-1 domain-containing protein    100   1e-33   Dictyostelium discoideum AX4
ref|XP_004712391.1|  PREDICTED: nuclear cap-binding protein subun...    102   1e-33   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003289703.1|  hypothetical protein DICPUDRAFT_154090             100   1e-33   Dictyostelium purpureum
ref|XP_008933114.1|  PREDICTED: nuclear cap-binding protein subun...  99.8    1e-33   Manacus vitellinus
ref|XP_975066.2|  PREDICTED: nuclear cap-binding protein subunit 2      103   1e-33   Tribolium castaneum [rust-red flour beetle]
ref|XP_004392931.1|  PREDICTED: nuclear cap-binding protein subun...    105   1e-33   Odobenus rosmarus divergens
emb|CDJ87529.1|  unnamed protein product                                111   2e-33   Haemonchus contortus [red stomach worm]
ref|NP_001232044.1|  nuclear cap-binding protein subunit 2            99.8    2e-33   Taeniopygia guttata
ref|NP_001155582.1|  nuclear cap-binding protein subunit 2-like         102   2e-33   Acyrthosiphon pisum
emb|CDS11358.1|  Putative Small subunit of nuclear cap-bindingFT ...    107   2e-33   Lichtheimia ramosa
ref|XP_312392.3|  AGAP002547-PA                                         102   2e-33   Anopheles gambiae str. PEST
gb|ACO14906.1|  Nuclear cap-binding protein subunit 2                 97.4    2e-33   Caligus clemensi
ref|XP_008332614.1|  PREDICTED: nuclear cap-binding protein subun...  99.4    2e-33   Cynoglossus semilaevis [half-smooth tongue sole]
emb|CDH58989.1|  rna-binding domain-containing protein                  107   2e-33   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007252633.1|  PREDICTED: nuclear cap-binding protein subun...  99.8    2e-33   Astyanax mexicanus [blind cave fish]
ref|XP_005923946.1|  PREDICTED: nuclear cap-binding protein subun...  98.6    2e-33   Haplochromis burtoni
ref|XP_002055508.1|  GJ18756                                          99.0    2e-33   
gb|ETN63045.1|  nuclear cap-binding protein subunit 2                   102   3e-33   Anopheles darlingi [American malaria mosquito]
ref|XP_001657521.1|  AAEL006135-PA                                      101   3e-33   Aedes aegypti
ref|XP_010870827.1|  PREDICTED: nuclear cap-binding protein subun...  99.4    3e-33   Esox lucius
gb|KHJ88245.1|  hypothetical protein OESDEN_11964                       106   3e-33   Oesophagostomum dentatum [nodule worm]
gb|EYB98803.1|  hypothetical protein Y032_0128g1452                     106   3e-33   Ancylostoma ceylanicum
ref|XP_005737000.1|  PREDICTED: nuclear cap-binding protein subun...  98.6    3e-33   Pundamilia nyererei
ref|XP_006927128.1|  PREDICTED: LOW QUALITY PROTEIN: nuclear cap ...    100   3e-33   
ref|XP_005286082.1|  PREDICTED: nuclear cap-binding protein subun...  97.8    3e-33   Chrysemys picta bellii
ref|XP_005989454.1|  PREDICTED: nuclear cap-binding protein subun...  99.4    4e-33   Latimeria chalumnae
ref|XP_003138855.1|  nuclear cap binding protein subunit 2              105   4e-33   Loa loa
ref|XP_007897111.1|  PREDICTED: nuclear cap-binding protein subun...  96.7    4e-33   Callorhinchus milii [Australian ghost shark]
ref|XP_003458995.1|  PREDICTED: nuclear cap-binding protein subun...  98.6    4e-33   Oreochromis niloticus
ref|XP_003769622.1|  PREDICTED: nuclear cap-binding protein subun...    100   4e-33   
ref|XP_004640072.1|  PREDICTED: nuclear cap-binding protein subun...    101   4e-33   Octodon degus
ref|XP_008304825.1|  PREDICTED: nuclear cap-binding protein subun...  98.2    5e-33   Stegastes partitus
sp|Q8JGR6.2|NCBP2_DANRE  RecName: Full=Nuclear cap-binding protei...  95.9    5e-33   Danio rerio [leopard danio]
ref|XP_005808853.1|  PREDICTED: nuclear cap-binding protein subun...  97.1    5e-33   Xiphophorus maculatus
ref|XP_001845223.1|  nuclear cap-binding protein subunit 2              103   5e-33   Culex quinquefasciatus
ref|NP_001006430.1|  nuclear cap-binding protein subunit 2            97.4    6e-33   Gallus gallus [bantam]
ref|XP_007540685.1|  PREDICTED: nuclear cap-binding protein subun...  97.1    6e-33   Poecilia formosa
ref|XP_010752640.1|  PREDICTED: nuclear cap-binding protein subun...  97.4    6e-33   
gb|EFX66775.1|  hypothetical protein DAPPUDRAFT_231808                98.2    6e-33   Daphnia pulex
emb|CDJ82646.1|  RNA recognition motif domain containing protein        107   7e-33   Haemonchus contortus [red stomach worm]
ref|XP_005147075.1|  PREDICTED: nuclear cap-binding protein subun...    102   7e-33   Melopsittacus undulatus
ref|XP_008404481.1|  PREDICTED: nuclear cap-binding protein subun...  96.7    7e-33   Poecilia reticulata
gb|ACO14652.1|  Nuclear cap-binding protein subunit 2                 95.5    8e-33   Caligus clemensi
ref|NP_001167476.1|  nuclear cap binding protein subunit 2, 20kDa     98.2    9e-33   Xenopus laevis [clawed frog]
ref|XP_002741239.1|  PREDICTED: nuclear cap-binding protein subun...  99.0    1e-32   Saccoglossus kowalevskii
ref|NP_001290613.1|  nuclear cap-binding protein subunit 2            99.0    1e-32   Esox lucius
gb|ACN31065.1|  unknown                                                 131   1e-32   Zea mays [maize]
ref|XP_004068089.1|  PREDICTED: nuclear cap-binding protein subun...  95.9    1e-32   Oryzias latipes [Japanese rice fish]
emb|CEJ03570.1|  Putative Genomic scaffold, msy_sf_27                   100   1e-32   Rhizopus microsporus
ref|XP_005314260.1|  PREDICTED: nuclear cap-binding protein subun...  99.0    1e-32   Chrysemys picta bellii
emb|CEI96241.1|  Putative Nuclear cap-binding protein subunit 2         100   1e-32   Rhizopus microsporus
sp|A2SW84.1|NCBP2_SINCH  RecName: Full=Nuclear cap-binding protei...  96.7    1e-32   Siniperca chuatsi [Chautsi bass]
ref|NP_001006879.1|  nuclear cap-binding protein subunit 2            97.1    1e-32   Xenopus tropicalis [western clawed frog]
ref|XP_003376039.1|  nuclear cap-binding protein subunit 2              102   1e-32   Trichinella spiralis
ref|XP_003974412.1|  PREDICTED: nuclear cap-binding protein subun...  95.9    1e-32   Takifugu rubripes [tiger puffer]
sp|C0H859.1|NCBP2_SALSA  RecName: Full=Nuclear cap-binding protei...  98.2    1e-32   Salmo salar
emb|CEP10058.1|  hypothetical protein                                   100   2e-32   Parasitella parasitica
emb|CAA59259.1|  CAP binding protein                                  97.8    2e-32   Xenopus laevis [clawed frog]
ref|XP_005051114.1|  PREDICTED: nuclear cap-binding protein subun...  99.4    2e-32   Ficedula albicollis
gb|ACH70847.1|  nuclear cap binding protein subunit 2                 98.2    2e-32   Salmo salar
ref|NP_001264384.1|  nuclear cap-binding protein subunit 2 2          99.8    2e-32   Gallus gallus [bantam]
ref|XP_007510017.1|  predicted protein                                95.5    2e-32   Bathycoccus prasinos
ref|XP_007426097.1|  PREDICTED: nuclear cap-binding protein subun...  96.7    2e-32   Python bivittatus
ref|XP_005428044.1|  PREDICTED: nuclear cap-binding protein subun...  99.4    2e-32   Geospiza fortis
ref|XP_008642408.1|  PREDICTED: nuclear cap-binding protein subun...  99.4    2e-32   Corvus brachyrhynchos
gb|EUB57460.1|  Nuclear cap-binding protein subunit 2                   100   2e-32   Echinococcus granulosus
gb|EPB86874.1|  hypothetical protein HMPREF1544_06300                   100   2e-32   Mucor circinelloides f. circinelloides 1006PhL
ref|NP_001264378.1|  nuclear cap-binding protein subunit 2 1          99.4    2e-32   Gallus gallus [bantam]
gb|KFB35824.1|  AGAP002548-PA-like protein                            90.5    2e-32   Anopheles sinensis
ref|XP_002188900.1|  PREDICTED: nuclear cap-binding protein subun...  99.4    2e-32   Taeniopygia guttata
ref|XP_001892082.1|  nuclear cap binding protein subunit 2              103   2e-32   Brugia malayi [agent of lymphatic filariasis]
ref|XP_002127821.2|  PREDICTED: nuclear cap-binding protein subun...    100   2e-32   Ciona intestinalis [sea vase]
ref|XP_009631917.1|  PREDICTED: nuclear cap-binding protein subun...    127   2e-32   
ref|XP_008264932.1|  PREDICTED: nuclear cap-binding protein subun...  97.8    3e-32   Oryctolagus cuniculus [domestic rabbit]
gb|ADD24223.1|  Nuclear cap-binding protein subunit 2                 95.1    3e-32   Lepeophtheirus salmonis
gb|ACO11997.1|  Nuclear cap-binding protein subunit 2                 95.1    3e-32   Lepeophtheirus salmonis
emb|CDS27318.1|  Nuclear cap binding protein subunit 2                99.4    3e-32   Hymenolepis microstoma
ref|XP_001373445.1|  PREDICTED: nuclear cap-binding protein subun...    100   3e-32   Monodelphis domestica
emb|CAF95006.1|  unnamed protein product                              94.7    4e-32   Tetraodon nigroviridis
ref|NP_775356.1|  nuclear cap-binding protein subunit 2               92.8    4e-32   Danio rerio [leopard danio]
ref|XP_003082903.1|  putative endonuclease (ISS)                      90.1    4e-32   
gb|KFH65143.1|  hypothetical protein MVEG_08624                         107   4e-32   
gb|EXX56821.1|  Cbc2p                                                   105   4e-32   
ref|NP_001250552.1|  Protein NCBP-2, isoform a                          103   4e-32   
gb|AAH83529.1|  Ncbp2 protein                                         95.9    5e-32   
dbj|GAN08892.1|  RNA-binding domain-containing protein                  100   5e-32   
gb|EGT36604.1|  CBN-NCBP-2 protein                                      103   7e-32   
sp|A8Y1R8.2|NCBP2_CAEBR  RecName: Full=Nuclear cap-binding protei...    101   8e-32   
ref|XP_005714010.1|  Nuclear cap-binding protein subunit, putative      101   9e-32   
gb|EFA74823.1|  RNA-binding region RNP-1 domain-containing protein    93.6    9e-32   
ref|XP_003100631.1|  CRE-NCBP-2 protein                                 102   1e-31   
ref|XP_006871127.1|  PREDICTED: RNA-binding protein Rsf1-like         99.4    1e-31   
ref|XP_009176186.1|  hypothetical protein T265_11300                    101   1e-31   
gb|KIV91912.1|  hypothetical protein PV10_06403                       94.7    1e-31   
ref|XP_008836730.1|  PREDICTED: nuclear cap-binding protein subun...  94.7    1e-31   
dbj|GAA53215.1|  nuclear cap-binding protein subunit 2                  101   1e-31   
gb|KHN70922.1|  Nuclear cap-binding protein subunit 2                 98.2    1e-31   
ref|XP_010799519.1|  PREDICTED: nuclear cap-binding protein subun...  96.3    1e-31   
ref|XP_006054289.1|  PREDICTED: nuclear cap-binding protein subun...  96.3    2e-31   
ref|XP_002638958.1|  C. briggsae CBR-NCBP-2 protein                     101   2e-31   
gb|ETE71922.1|  Nuclear cap-binding protein subunit 2                 94.0    2e-31   
ref|XP_008540128.1|  PREDICTED: nuclear cap-binding protein subun...  95.1    3e-31   
ref|XP_002505801.1|  predicted protein                                91.7    3e-31   
gb|KHJ46221.1|  Low-density lipoprotein receptor domain class A       99.8    3e-31   
ref|XP_001422671.1|  predicted protein                                87.8    3e-31   
ref|XP_003776446.1|  PREDICTED: nuclear cap-binding protein subun...  94.4    3e-31   
ref|XP_007115291.1|  PREDICTED: nuclear cap-binding protein subun...  94.4    4e-31   
emb|CEG02019.1|  Nuclear cap-binding protein subunit 2                86.7    4e-31   
gb|EYB98804.1|  hypothetical protein Y032_0128g1452                   99.4    4e-31   
gb|EAW53623.1|  nuclear cap binding protein subunit 2, 20kDa, iso...  94.0    5e-31   
gb|KGB38529.1|  Nuclear cap-binding protein subunit 2                 96.7    6e-31   
ref|XP_008007828.1|  PREDICTED: nuclear cap-binding protein subun...  94.0    7e-31   
gb|ESA14801.1|  hypothetical protein GLOINDRAFT_78272                   105   7e-31   
emb|CAX74138.1|  Nuclear cap-binding protein subunit 2                96.7    7e-31   
ref|XP_006156827.1|  PREDICTED: nuclear cap-binding protein subun...  93.2    9e-31   
dbj|GAM22197.1|  hypothetical protein SAMD00019534_053720             91.3    9e-31   
emb|CAX69892.1|  Nuclear cap-binding protein subunit 2                96.3    1e-30   
emb|CDJ95338.1|  RNA recognition motif domain containing protein        105   1e-30   
ref|XP_006156828.1|  PREDICTED: nuclear cap-binding protein subun...  93.2    1e-30   
ref|XP_006114954.1|  PREDICTED: nuclear cap-binding protein subun...  87.8    1e-30   
ref|XP_007917133.1|  putative nuclear cap-binding protein subunit...  92.0    1e-30   
ref|XP_006156826.1|  PREDICTED: nuclear cap-binding protein subun...  92.8    2e-30   
ref|XP_009570299.1|  PREDICTED: nuclear cap-binding protein subun...  90.5    2e-30   
ref|XP_010401683.1|  PREDICTED: nuclear cap-binding protein subun...  89.4    2e-30   
ref|XP_003766281.1|  PREDICTED: nuclear cap-binding protein subun...  94.4    2e-30   
ref|XP_002790647.1|  nuclear cap-binding protein subunit 2            93.2    2e-30   
ref|XP_004363248.1|  RNA-binding region RNP-1 domain-containing p...  90.5    2e-30   
gb|EME45044.1|  hypothetical protein DOTSEDRAFT_70923                 92.4    2e-30   
ref|XP_001930735.1|  nuclear cap-binding protein subunit 2            89.4    2e-30   
ref|XP_007700825.1|  hypothetical protein COCSADRAFT_91061            89.0    3e-30   
ref|XP_007693580.1|  hypothetical protein COCMIDRAFT_10106            89.0    3e-30   
ref|XP_009910670.1|  PREDICTED: nuclear cap-binding protein subun...  89.0    3e-30   
ref|XP_006024523.1|  PREDICTED: nuclear cap-binding protein subun...  86.7    3e-30   
gb|EMC80813.1|  Nuclear cap-binding protein subunit 2                 90.5    3e-30   
ref|XP_002107603.1|  hypothetical protein TRIADDRAFT_19119            96.7    3e-30   
ref|XP_008264930.1|  PREDICTED: nuclear cap-binding protein subun...  92.8    4e-30   
ref|XP_009995479.1|  PREDICTED: nuclear cap-binding protein subun...  88.6    4e-30   
ref|XP_007779954.1|  hypothetical protein W97_03870                   90.9    4e-30   
ref|XP_009939818.1|  PREDICTED: nuclear cap-binding protein subun...  88.2    4e-30   
ref|XP_009573399.1|  PREDICTED: nuclear cap-binding protein subun...  89.0    5e-30   
gb|EUC67161.1|  RNA recognition motif protein                         90.9    5e-30   
gb|KEF52134.1|  hypothetical protein A1O9_11760                       90.1    5e-30   
ref|XP_005773383.1|  hypothetical protein EMIHUDRAFT_47653            98.6    5e-30   
ref|XP_003655328.1|  hypothetical protein THITE_42108                 92.0    5e-30   
ref|XP_010760920.1|  nuclear cap-binding protein subunit 2            92.4    5e-30   
ref|XP_005046209.1|  PREDICTED: nuclear cap-binding protein subun...  89.4    5e-30   
ref|XP_009683283.1|  PREDICTED: nuclear cap-binding protein subun...  89.0    5e-30   
ref|XP_003839494.1|  hypothetical protein LEMA_P031670.1              88.2    5e-30   
ref|XP_010212657.1|  PREDICTED: nuclear cap-binding protein subun...  89.4    6e-30   
ref|XP_007713662.1|  hypothetical protein COCCADRAFT_6180             87.8    6e-30   
ref|XP_008029051.1|  hypothetical protein SETTUDRAFT_164735           87.8    7e-30   
ref|XP_003319546.2|  hypothetical protein PGTG_01720                  89.4    7e-30   
ref|XP_009463678.1|  PREDICTED: nuclear cap-binding protein subun...  88.2    8e-30   
ref|XP_007056250.1|  PREDICTED: nuclear cap-binding protein subun...  86.7    8e-30   
gb|KIW14842.1|  hypothetical protein PV08_07627                       92.8    8e-30   
ref|XP_007395924.1|  hypothetical protein PHACADRAFT_209115           93.6    8e-30   
gb|ACI49201.1|  hypothetical protein Csp3_JD03.010                      102   8e-30   
gb|EEQ83343.1|  nuclear cap binding protein subunit 2                 91.3    8e-30   
gb|EYE91723.1|  small subunit of nuclear cap-binding protein complex  94.7    8e-30   
ref|XP_006129917.1|  PREDICTED: nuclear cap-binding protein subun...  89.4    9e-30   
gb|KDN66904.1|  putative RNA recognition domain-containing protein    92.0    9e-30   
gb|KIH57658.1|  hypothetical protein ANCDUO_12145                     94.7    1e-29   
ref|XP_009161492.1|  hypothetical protein HMPREF1120_08971            91.7    1e-29   
gb|KIW41178.1|  hypothetical protein PV06_06760                       91.3    1e-29   
ref|XP_003717292.1|  nuclear cap-binding protein subunit 2            90.1    1e-29   
ref|XP_010221836.1|  PREDICTED: nuclear cap-binding protein subun...  90.1    1e-29   
ref|XP_007734813.1|  hypothetical protein A1O3_06504                  90.5    1e-29   
ref|XP_009225603.1|  nuclear cap-binding protein subunit 2            90.1    1e-29   
ref|XP_009073015.1|  PREDICTED: nuclear cap-binding protein subun...  87.0    1e-29   
ref|XP_010713431.1|  PREDICTED: nuclear cap-binding protein subun...  86.7    2e-29   
gb|EOB03442.1|  Nuclear cap-binding protein subunit 2                 87.0    2e-29   
ref|XP_007762009.1|  hypothetical protein A1O7_09834                  89.4    2e-29   
ref|XP_010072078.1|  PREDICTED: nuclear cap-binding protein subun...  87.0    2e-29   
ref|XP_010404493.1|  PREDICTED: uncharacterized protein LOC104693501  89.7    2e-29   
ref|XP_956595.2|  nuclear cap binding protein subunit 2               92.8    2e-29   
gb|KIP09603.1|  hypothetical protein PHLGIDRAFT_67259                 91.7    2e-29   
ref|XP_005511747.1|  PREDICTED: nuclear cap-binding protein subun...  88.6    2e-29   
gb|KIW62753.1|  nuclear cap-binding protein subunit 2                 89.4    2e-29   
ref|XP_007722963.1|  hypothetical protein A1O1_03873                  89.7    2e-29   
gb|EEH07684.1|  nuclear cap binding protein subunit 2                 90.5    2e-29   
gb|EQB51521.1|  hypothetical protein CGLO_08930                       93.6    2e-29   
ref|XP_001537919.1|  nuclear cap binding protein subunit 2            90.1    2e-29   
ref|XP_009907060.1|  PREDICTED: nuclear cap-binding protein subun...  89.4    2e-29   
dbj|GAM85823.1|  hypothetical protein ANO11243_038310                 92.4    3e-29   
ref|XP_009285927.1|  PREDICTED: nuclear cap-binding protein subun...  85.9    3e-29   
ref|XP_005500526.1|  PREDICTED: nuclear cap-binding protein subun...  85.9    3e-29   
ref|XP_009894439.1|  PREDICTED: nuclear cap-binding protein subun...  85.9    3e-29   
ref|XP_001585390.1|  hypothetical protein SS1G_13629                  91.3    3e-29   
ref|XP_005018246.1|  PREDICTED: nuclear cap-binding protein subun...  90.1    3e-29   
emb|CEF63411.1|  Nuclear cap-binding protein subunit 2                97.8    3e-29   
ref|XP_007292342.1|  nuclear cap binding protein subunit 2            92.4    3e-29   
ref|XP_005237904.1|  PREDICTED: nuclear cap-binding protein subun...  85.9    3e-29   
gb|KFX47403.1|  Nuclear cap-binding protein subunit 2                 88.6    3e-29   
gb|EPZ33293.1|  Ribosomal protein S13 domain-containing protein       91.7    3e-29   
ref|XP_007843729.1|  small subunit of nuclear cap-binding protein...  90.1    3e-29   
gb|ESZ89538.1|  nuclear cap binding protein subunit 2                 90.9    3e-29   
ref|XP_003663357.1|  hypothetical protein MYCTH_2062826               91.3    3e-29   
ref|XP_011111711.1|  hypothetical protein H072_5905                   90.5    3e-29   
gb|EMS24367.1|  nuclear cap-binding protein subunit 2                 92.4    4e-29   
ref|XP_011119414.1|  hypothetical protein AOL_s00043g626              90.1    4e-29   
gb|KIW25200.1|  nuclear cap-binding protein subunit 2                 89.4    4e-29   
ref|XP_009653566.1|  nuclear cap-binding protein subunit 2            92.0    4e-29   
gb|KIK30960.1|  hypothetical protein PISMIDRAFT_86311                 90.5    4e-29   
gb|EFQ25033.1|  RNA recognition domain-containing protein             91.7    4e-29   
gb|KIW59239.1|  hypothetical protein PV05_03702                       88.2    4e-29   
ref|XP_007267810.1|  RNA-binding domain-containing protein            93.6    4e-29   
ref|XP_001799887.1|  hypothetical protein SNOG_09598                  88.6    5e-29   
gb|ERS99769.1|  nuclear cap-binding protein subunit 2                 91.3    5e-29   
ref|XP_009507031.1|  PREDICTED: nuclear cap-binding protein subun...  88.2    5e-29   
gb|KIM62079.1|  hypothetical protein SCLCIDRAFT_1215420               90.9    5e-29   
gb|KIH91831.1|  nuclear cap-binding protein subunit 2                 91.3    5e-29   
gb|KIW74132.1|  nuclear cap-binding protein subunit 2                 89.0    5e-29   
emb|CBI21897.3|  unnamed protein product                                118   6e-29   
gb|KDE06149.1|  hypothetical protein MVLG_03564                       96.7    6e-29   
ref|XP_003003248.1|  nuclear cap-binding protein subunit 2            91.3    6e-29   
dbj|GAA95101.1|  hypothetical protein E5Q_01756                       96.3    6e-29   
ref|XP_010566737.1|  PREDICTED: nuclear cap-binding protein subun...  89.4    6e-29   
ref|XP_007795535.1|  putative nuclear cap binding protein subunit...  92.0    6e-29   
ref|XP_008730983.1|  hypothetical protein G647_08450                  87.4    6e-29   
ref|XP_003035995.1|  hypothetical protein SCHCODRAFT_81360            91.7    7e-29   
ref|XP_007925178.1|  hypothetical protein MYCFIDRAFT_214779           87.8    7e-29   
ref|XP_003346387.1|  hypothetical protein SMAC_05283                  90.5    7e-29   
gb|KIL68604.1|  hypothetical protein M378DRAFT_100305                 90.9    7e-29   
ref|XP_007746109.1|  hypothetical protein A1O5_07330                  88.2    7e-29   
gb|KDQ33180.1|  hypothetical protein PLEOSDRAFT_1073475               92.4    7e-29   
gb|KEQ91005.1|  hypothetical protein AUEXF2481DRAFT_8961              88.6    8e-29   
gb|EKG14739.1|  hypothetical protein MPH_08014                        92.0    8e-29   
gb|EMD38382.1|  hypothetical protein CERSUDRAFT_113542                91.7    9e-29   
ref|XP_003048974.1|  predicted protein                                90.5    9e-29   
ref|XP_002558843.1|  Pc13g04070                                       89.0    9e-29   
ref|XP_010114170.1|  PREDICTED: nuclear cap-binding protein subun...  87.4    9e-29   
ref|XP_003066248.1|  Nuclear cap binding protein subunit 2 , puta...  89.0    9e-29   
ref|XP_001247066.1|  hypothetical protein CIMG_00837                  89.0    9e-29   
ref|XP_007275569.1|  nuclear cap binding protein subunit 2            92.8    1e-28   
ref|XP_007805760.1|  Nuclear cap-binding protein subunit 2            89.7    1e-28   
gb|KIW93297.1|  hypothetical protein Z519_05902                       87.8    1e-28   
dbj|GAM35661.1|  nuclear cap-binding protein complex small subunit    87.4    1e-28   
gb|KEQ77302.1|  RNA-binding domain-containing protein                 88.2    1e-28   
ref|XP_007594108.1|  RNA recognition domain-containing protein        91.7    1e-28   
ref|XP_007583069.1|  putative nuclear cap binding protein subunit...  92.0    1e-28   
ref|XP_005489535.1|  PREDICTED: nuclear cap-binding protein subun...  87.0    1e-28   
ref|XP_007414093.1|  hypothetical protein MELLADRAFT_38424            88.6    1e-28   
ref|XP_001557145.1|  nuclear cap binding protein subunit 2            89.4    1e-28   
ref|XP_007678781.1|  hypothetical protein BAUCODRAFT_74746            87.8    1e-28   
gb|KEQ67507.1|  RNA-binding domain-containing protein                 88.2    1e-28   
gb|KIJ44095.1|  hypothetical protein M422DRAFT_30620                  91.7    1e-28   
ref|XP_007385720.1|  RNA-binding domain-containing protein            93.2    2e-28   
gb|KFH43241.1|  Nuclear cap-binding protein subunit-like protein      89.4    2e-28   
gb|KHO00681.1|  nuclear cap binding protein subunit 2                 89.4    2e-28   
gb|KDR81771.1|  hypothetical protein GALMADRAFT_239961                90.9    2e-28   
ref|XP_008923821.1|  PREDICTED: nuclear cap-binding protein subun...  84.7    2e-28   
gb|KIX96470.1|  nuclear cap-binding protein subunit 2                 86.7    2e-28   
gb|KIM49408.1|  hypothetical protein M413DRAFT_438588                 90.9    2e-28   
ref|XP_002146544.1|  small subunit of nuclear cap-binding protein...  87.8    2e-28   
ref|NP_001037598.1|  nuclear cap-binding protein subunit 2              103   2e-28   
dbj|BAM18632.1|  cap binding protein 20                                 104   2e-28   
gb|EHJ69508.1|  nuclear cap-binding protein subunit 2                   103   2e-28   
ref|XP_005830697.1|  hypothetical protein GUITHDRAFT_153153           90.1    2e-28   
gb|KII88587.1|  hypothetical protein PLICRDRAFT_111049                91.3    2e-28   
gb|ENH81023.1|  nuclear cap binding protein subunit 2                 91.7    2e-28   
emb|CCE31122.1|  probable nuclear cap binding protein subunit 2       92.0    2e-28   
gb|KFY03728.1|  hypothetical protein O988_01272                       90.1    2e-28   
gb|EWG46619.1|  hypothetical protein FVEG_07036                       89.4    2e-28   
ref|XP_007361180.1|  RNA-binding domain-containing protein            92.4    2e-28   
ref|XP_007808852.1|  nuclear cap binding protein subunit 2            88.6    3e-28   
ref|XP_003236379.1|  nuclear cap binding protein subunit 2            90.5    3e-28   
ref|XP_007834793.1|  hypothetical protein PFICI_08021                 89.4    3e-28   
gb|KJA27500.1|  hypothetical protein HYPSUDRAFT_131178                90.9    3e-28   
ref|XP_009254908.1|  hypothetical protein FPSE_03514                  89.0    3e-28   
gb|EGD93578.1|  nuclear cap binding protein subunit 2                 90.1    3e-28   
gb|KIW04664.1|  nuclear cap-binding protein subunit 2                 87.8    3e-28   
gb|KIV83607.1|  nuclear cap-binding protein subunit 2                 87.4    3e-28   
ref|XP_002478850.1|  small subunit of nuclear cap-binding protein...  87.0    3e-28   
ref|XP_011324033.1|  nuclear cap-binding protein subunit 2            89.4    3e-28   
emb|CCM02400.1|  predicted protein                                    90.5    3e-28   
dbj|GAD93108.1|  nuclear cap-binding protein subunit 2                88.6    3e-28   
ref|XP_001907767.1|  hypothetical protein                             89.0    3e-28   
ref|XP_001878240.1|  predicted protein                                90.5    3e-28   
gb|KIJ16888.1|  hypothetical protein PAXINDRAFT_74697                 90.1    3e-28   
gb|KHJ33362.1|  putative nuclear cap binding protein subunit 2        88.6    3e-28   
gb|KIO13600.1|  hypothetical protein M404DRAFT_58226                  87.4    3e-28   
gb|KIK06521.1|  hypothetical protein K443DRAFT_674177                 90.5    3e-28   
ref|XP_002431557.1|  Nuclear cap-binding protein subunit, putative      101   3e-28   
gb|KIY68629.1|  RNA-binding domain-containing protein                 90.1    3e-28   
gb|EWC46953.1|  nuclear cap-binding protein subunit 2                 88.6    3e-28   
gb|EHK17040.1|  hypothetical protein TRIVIDRAFT_41964                 89.0    3e-28   
gb|KIW59240.1|  hypothetical protein, variant                         85.5    4e-28   
gb|KIK59815.1|  hypothetical protein GYMLUDRAFT_169264                90.5    4e-28   
ref|XP_007819628.1|  RNA recognition motif domain protein             89.0    4e-28   
gb|KFX97325.1|  hypothetical protein V490_02845                       89.4    4e-28   
gb|EJU05765.1|  RNA-binding domain-containing protein                 88.2    4e-28   
ref|XP_007321857.1|  hypothetical protein SERLADRAFT_475254           90.1    4e-28   
ref|XP_007764663.1|  RNA-binding domain-containing protein            90.9    4e-28   
ref|XP_006692728.1|  hypothetical protein CTHT_0022620                89.0    4e-28   
gb|KIK94301.1|  hypothetical protein PAXRUDRAFT_143185                90.1    4e-28   
ref|XP_006458509.1|  hypothetical protein AGABI2DRAFT_190786          90.1    4e-28   
ref|XP_006967414.1|  predicted protein                                89.7    4e-28   
ref|XP_007326888.1|  hypothetical protein AGABI1DRAFT_111556          90.1    4e-28   
gb|EPQ64453.1|  Small subunit of the heterodimeric cap binding co...  88.2    4e-28   
emb|CCU81573.1|  nuclear cap binding protein subunit 2                88.2    5e-28   
gb|KID89303.1|  nuclear cap binding protein subunit 2                 89.0    5e-28   



>ref|XP_009604104.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Nicotiana 
tomentosiformis]
Length=254

 Score =   208 bits (529),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 112/130 (86%), Gaps = 4/130 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGA  167

Query  450  FPPVM-APQYGRQG---GHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            +PPVM  P YGR G   GHGGSYRHGRDY+ KRHREDD HR DY KR Y RE  R SDHE
Sbjct  168  YPPVMPPPHYGRHGVNQGHGGSYRHGRDYHCKRHREDDHHRSDYPKRSYDRESRRTSDHE  227

Query  282  ARPEKNPRFR  253
            +RPEKNPRFR
Sbjct  228  SRPEKNPRFR  237


 Score =   145 bits (365),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 67/73 (92%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF GTQEEFE+ALLK+TTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  9    AKISAYRDRRFPGTQEEFEDALLKATTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVM  81



>ref|XP_009758879.1| PREDICTED: nuclear cap-binding protein subunit 2 [Nicotiana sylvestris]
 gb|ACN43578.1| nuclear cap-binding protein [Nicotiana tabacum]
 gb|ACY02034.1| cap binding protein 20 [Nicotiana tabacum]
Length=254

 Score =   207 bits (526),  Expect(2) = 6e-87, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 113/130 (87%), Gaps = 4/130 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGA  167

Query  450  FPPVM-APQYGRQG---GHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            +PPVM  P YGR G   G+GGSYRHGRDY+RKRHREDD HR DY KR Y RE  R SDHE
Sbjct  168  YPPVMPPPHYGRHGGNQGYGGSYRHGRDYHRKRHREDDHHRSDYPKRSYDRESRRTSDHE  227

Query  282  ARPEKNPRFR  253
            +RPEKNPRFR
Sbjct  228  SRPEKNPRFR  237


 Score =   142 bits (358),  Expect(2) = 6e-87, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF GTQEEFE+ALLK+TTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  9    AKISAYRDRRFPGTQEEFEDALLKATTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN +TPCGFCFV+
Sbjct  69   KNCKTPCGFCFVM  81



>ref|XP_009605652.1| PREDICTED: nuclear cap-binding protein subunit 2-like, partial 
[Nicotiana tomentosiformis]
Length=248

 Score =   192 bits (489),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 111/130 (85%), Gaps = 4/130 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  102  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGA  161

Query  450  FPPVMAP----QYGRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            +PPVM P    ++G   GHGGSYR GRDY+RKRHREDD HR DY KR Y RE  R SDHE
Sbjct  162  YPPVMPPPHYGRHGGNHGHGGSYRQGRDYHRKRHREDDHHRSDYPKRTYDRESRRTSDHE  221

Query  282  ARPEKNPRFR  253
            +RPEKNPRFR
Sbjct  222  SRPEKNPRFR  231


 Score =   146 bits (368),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 68/73 (93%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF GTQEEFE+ALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  3    AKISAYRDRRFPGTQEEFEDALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  62

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  63   KNSKTPCGFCFVM  75



>ref|XP_009357142.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Pyrus 
x bretschneideri]
 ref|XP_009357143.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Pyrus 
x bretschneideri]
 ref|XP_009357144.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Pyrus 
x bretschneideri]
Length=252

 Score =   199 bits (507),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 110/129 (85%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQR LVDYGTGSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRSLVDYGTGSLGS  167

Query  450  FPPVMAPQYGRQGG---HGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPVM P YGR GG   HGG++R GRDY RKRHR+DDRH  D SKR    E  +++DHE+
Sbjct  168  FPPVMQPHYGRHGGGPNHGGTHRPGRDYPRKRHRDDDRHSYDNSKRNSDSESRKNTDHES  227

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  228  RPEKNPRFR  236


 Score =   139 bits (349),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF G+QEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKLSQYRDRRFPGSQEEFEQALLASTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>gb|AFK38601.1| unknown [Lotus japonicus]
Length=253

 Score =   197 bits (501),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 111/129 (86%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYG+GSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGSGSLGS  167

Query  450  FPPVMAPQYGRQG---GHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPP+++  YGR G   GHGGS+R GRDY+RKRHR+DD H  + SKR    E  R+SDHE+
Sbjct  168  FPPMVSTSYGRHGRNHGHGGSHRPGRDYHRKRHRDDDHHTNESSKRTSDHESRRNSDHES  227

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  228  RPEKNPRFR  236


 Score =   140 bits (353),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQ+EFE+ALL STTVYVGNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    TKLSAYRDRRFPGTQDEFEQALLASTTVYVGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_004233527.1| PREDICTED: nuclear cap-binding protein subunit 2 [Solanum lycopersicum]
 ref|XP_010317221.1| PREDICTED: nuclear cap-binding protein subunit 2 [Solanum lycopersicum]
Length=255

 Score =   196 bits (499),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 111/131 (85%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGA  167

Query  450  FPPVMAPQY-----GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            +PPVM P +     G   G GGSYRHGRDY+RKRHREDD HR DY KR Y RE  R+SDH
Sbjct  168  YPPVMPPPHYGRHNGGNHGRGGSYRHGRDYHRKRHREDDHHRPDYPKRTYERESRRNSDH  227

Query  285  EARPEKNPRFR  253
            E+RPEKNPRFR
Sbjct  228  ESRPEKNPRFR  238


 Score =   141 bits (355),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRD+RF GTQEEFE+ALL+S TVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  9    AKISAYRDKRFPGTQEEFEDALLRSITVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCF++
Sbjct  69   KNSKTPCGFCFIM  81



>ref|NP_001275117.1| nuclear cap-binding protein CBP20 [Solanum tuberosum]
 gb|ACL54980.1| nuclear cap-binding protein CBP20 [Solanum tuberosum]
 gb|ACL54981.1| nuclear cap-binding protein CBP20 [Solanum tuberosum]
 gb|ACN43582.1| nuclear cap-binding protein [Solanum tuberosum]
 gb|ACY07775.1| CBP20 protein [Solanum tuberosum]
Length=255

 Score =   194 bits (493),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 110/131 (84%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGA  167

Query  450  FPPVMAPQY-----GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            +PPVM P +     G   G GGSYRHGRDY RKRHREDD HR DY KR Y RE  R+SDH
Sbjct  168  YPPVMPPPHYGRHNGGNHGRGGSYRHGRDYQRKRHREDDHHRPDYPKRTYDRESRRNSDH  227

Query  285  EARPEKNPRFR  253
            E+RPEKNPRFR
Sbjct  228  ESRPEKNPRFR  238


 Score =   142 bits (358),  Expect(2) = 4e-83, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF GTQEEFE+ALL+S TVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  9    AKISAYRDRRFPGTQEEFEDALLRSITVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCF++
Sbjct  69   KNSKTPCGFCFIM  81



>ref|XP_006346957.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Solanum 
tuberosum]
 ref|XP_006346958.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Solanum 
tuberosum]
 ref|XP_006346959.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X3 [Solanum 
tuberosum]
 ref|XP_006346960.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X4 [Solanum 
tuberosum]
Length=255

 Score =   193 bits (491),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 110/131 (84%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGA  167

Query  450  FPPVMAPQY-----GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            +PPVM P +     G   G GG+YRHGRDY RKRHREDD HR DY KR Y RE  R+SDH
Sbjct  168  YPPVMPPPHYGRHNGGNHGRGGAYRHGRDYQRKRHREDDHHRPDYPKRTYDRESRRNSDH  227

Query  285  EARPEKNPRFR  253
            E+RPEKNPRFR
Sbjct  228  ESRPEKNPRFR  238


 Score =   142 bits (359),  Expect(2) = 6e-83, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF GTQEEFE+ALL+S TVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  9    AKISAYRDRRFPGTQEEFEDALLRSITVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCF++
Sbjct  69   KNSKTPCGFCFIM  81



>gb|ACN43580.1| nuclear cap-binding protein [Solanum tuberosum]
Length=255

 Score =   193 bits (491),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 112/131 (85%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGA  167

Query  450  FPPVM-APQY----GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            +PPVM +P Y    G   G GGSYRHGR+Y+RKRHREDD HR DY KR Y RE  R+SDH
Sbjct  168  YPPVMPSPHYGRHNGGNHGRGGSYRHGREYHRKRHREDDHHRPDYPKRTYDRESRRNSDH  227

Query  285  EARPEKNPRFR  253
            E+RPEKNPRFR
Sbjct  228  ESRPEKNPRFR  238


 Score =   142 bits (359),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF GTQEEFE+ALL+S TVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  9    AKISAYRDRRFPGTQEEFEDALLRSITVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCF++
Sbjct  69   KNSKTPCGFCFIM  81



>gb|ACL54982.1| nuclear cap-binding protein CBP20 [Solanum tuberosum]
 gb|ACL54983.1| nuclear cap-binding protein CBP20 [Solanum tuberosum]
 gb|ACN43579.1| nuclear cap-binding protein [Solanum tuberosum]
Length=255

 Score =   192 bits (487),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 110/131 (84%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGA  167

Query  450  FPPVMAPQY-----GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            +PPVM P +     G   G GGSYRHGRDY+RKRHREDD  R DY KR Y RE  R+SDH
Sbjct  168  YPPVMPPPHYGRHNGGNHGRGGSYRHGRDYHRKRHREDDHPRPDYPKRTYDRESRRNSDH  227

Query  285  EARPEKNPRFR  253
            E+RPEKNPRFR
Sbjct  228  ESRPEKNPRFR  238


 Score =   142 bits (358),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF GTQEEFE+ALL+S TVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  9    AKISAYRDRRFPGTQEEFEDALLRSITVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCF++
Sbjct  69   KNSKTPCGFCFIM  81



>ref|XP_008381576.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Malus 
domestica]
 ref|XP_008381577.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Malus 
domestica]
 ref|XP_008381579.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Malus 
domestica]
Length=252

 Score =   197 bits (500),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 110/129 (85%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQR LVDYGTGSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRSLVDYGTGSLGS  167

Query  450  FPPVMAPQYGRQGG---HGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPVM P YGR GG   +GG++R GRDY RKRHR+DDRH  D SKR    E  +++DHE+
Sbjct  168  FPPVMPPHYGRHGGGPNYGGTHRPGRDYPRKRHRDDDRHSYDNSKRNSDSESRKNTDHES  227

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  228  RPEKNPRFR  236


 Score =   135 bits (341),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S Y DRRF G+QEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKLSQYWDRRFPGSQEEFEQALLASTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>gb|KCW47249.1| hypothetical protein EUGRSUZ_K01050 [Eucalyptus grandis]
Length=361

 Score =   193 bits (491),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 106/129 (82%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYG GSLG+
Sbjct  217  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGAGSLGS  276

Query  450  FPPVMAPQYGRQGG---HGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPVM P YGR GG   HGGSYR+ RDY RKR+REDDR   + SKR    E  RD D E+
Sbjct  277  FPPVMPPPYGRHGGSQSHGGSYRYSRDYNRKRNREDDRRPYESSKRTSDHESSRDQDPES  336

Query  279  RPEKNPRFR  253
            R EKNPRFR
Sbjct  337  RLEKNPRFR  345


 Score =   139 bits (351),  Expect(2) = 5e-82, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDR+F GTQEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGE+KKI+MGLD
Sbjct  118  NKLSAYRDRKFSGTQEEFEQALLSSTTVYIGNMSFYTTEEQVYELFSRAGELKKIIMGLD  177

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  178  KNSKTPCGFCFVL  190



>ref|XP_010035788.1| PREDICTED: nuclear cap-binding protein subunit 2 [Eucalyptus 
grandis]
Length=252

 Score =   192 bits (489),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 106/129 (82%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYG GSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGAGSLGS  167

Query  450  FPPVMAPQYGRQGG---HGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPVM P YGR GG   HGGSYR+ RDY RKR+REDDR   + SKR    E  RD D E+
Sbjct  168  FPPVMPPPYGRHGGSQSHGGSYRYSRDYNRKRNREDDRRPYESSKRTSDHESSRDQDPES  227

Query  279  RPEKNPRFR  253
            R EKNPRFR
Sbjct  228  RLEKNPRFR  236


 Score =   139 bits (351),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDR+F GTQEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGE+KKI+MGLD
Sbjct  9    NKLSAYRDRKFSGTQEEFEQALLSSTTVYIGNMSFYTTEEQVYELFSRAGELKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_008342882.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Malus 
domestica]
Length=252

 Score =   193 bits (491),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 109/129 (84%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQR LVDYGTGSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRTLVDYGTGSLGS  167

Query  450  FPPVMAPQYGRQGG---HGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPVM PQYGR GG   HGG++R  RDY RKR+R+DDR   D SKR    E  ++SDHE+
Sbjct  168  FPPVMPPQYGRHGGGPNHGGTHRPRRDYPRKRYRDDDRQSYDDSKRNSDYESXKNSDHES  227

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  228  RPEKNPRFR  236


 Score =   138 bits (348),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF G+QEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKLSQYRDRRFPGSQEEFEQALLASTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_011096094.1| PREDICTED: nuclear cap-binding protein subunit 2 [Sesamum indicum]
Length=253

 Score =   192 bits (488),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 111/133 (83%), Gaps = 11/133 (8%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYG GSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGAGSLGS  167

Query  450  FPPVMAPQYGRQG---GHGGSYRHGRDYYRKRHREDDRHRLDYSKR----VYRREPVRDS  292
            F PVMAP YGR G   GHGGS+RHGR+Y RKRHREDDR   ++S+R    VYRR P    
Sbjct  168  FAPVMAPNYGRHGGNYGHGGSHRHGREYPRKRHREDDRRGPEFSRRKSDYVYRRNP----  223

Query  291  DHEARPEKNPRFR  253
            D E+RPEKNPRFR
Sbjct  224  DLESRPEKNPRFR  236


 Score =   137 bits (346),  Expect(2) = 4e-81, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEFEEAL  STTVYVGNMSFYTTEEQVYELFSRAGE+KKI+MGLD
Sbjct  9    NKLSAYRDRRFPGTQEEFEEALQLSTTVYVGNMSFYTTEEQVYELFSRAGELKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVM  81



>gb|ACN43581.1| nuclear cap-binding protein [Solanum tuberosum]
Length=255

 Score =   190 bits (482),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 110/131 (84%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEAQRQLVDYGTGSLGA  167

Query  450  FPPVMAPQY-----GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            +PPVM P +     G   G GGSYRHGRDY+RKRHREDD  R DY KR Y RE  R+SDH
Sbjct  168  YPPVMPPPHYGRHNGGNHGRGGSYRHGRDYHRKRHREDDHPRPDYPKRTYDRESRRNSDH  227

Query  285  EARPEKNPRFR  253
            E+RPEKNPRFR
Sbjct  228  ESRPEKNPRFR  238


 Score =   139 bits (351),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF GTQEEFE+ALL+S TVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  9    AKISAYRDRRFPGTQEEFEDALLRSITVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TP GFCF++
Sbjct  69   KNSKTPWGFCFIM  81



>ref|XP_009354294.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Pyrus 
x bretschneideri]
Length=252

 Score =   186 bits (473),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 106/129 (82%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQR LVDYGTGSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQQELEAQRTLVDYGTGSLGS  167

Query  450  FPPVMAPQYGRQGG---HGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPVM P YGR GG   HGG++R  RDY RKR+R+DDR   D SKR    E  + SD E+
Sbjct  168  FPPVMQPHYGRHGGGPNHGGTHRPRRDYPRKRYRDDDRQSYDNSKRNSDYESQKSSDLES  227

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  228  RPEKNPRFR  236


 Score =   138 bits (348),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF G+QEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKLSQYRDRRFPGSQEEFEQALLASTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_010688443.1| PREDICTED: nuclear cap-binding protein subunit 2 [Beta vulgaris 
subsp. vulgaris]
Length=252

 Score =   187 bits (475),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 105/129 (81%), Gaps = 4/129 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELE QR LVDYG GSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEVQRTLVDYGAGSLGG  167

Query  450  FPPVMAPQYGRQG---GHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            F PV    YGR     GHGGSYR GRDY+RKRHRED+RH  D  KR   +EP R+SDHE+
Sbjct  168  FQPVAPSHYGRHERSHGHGGSYRQGRDYHRKRHREDERHPADMPKR-NEQEPRRNSDHES  226

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  227  RPEKNPRFR  235


 Score =   135 bits (340),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G+QEEFEEAL  STTVY+GNMSFYTTEEQVYELFSR GEIKK+ MGLD
Sbjct  9    NKLSAYRDRRFPGSQEEFEEALKNSTTVYIGNMSFYTTEEQVYELFSRVGEIKKMTMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_007043674.1| CAP-binding protein 20 isoform 2 [Theobroma cacao]
 gb|EOX99505.1| CAP-binding protein 20 isoform 2 [Theobroma cacao]
Length=270

 Score =   181 bits (458),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 106/129 (82%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF+EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQRQLVDYG GSLG+
Sbjct  125  DFDWGFVEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEAQRQLVDYGAGSLGS  184

Query  450  FPPVMAPQY---GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPVM P Y   G   GH  SYR GRDY RKRHR+DDR+    SKR    E  R+SD+++
Sbjct  185  FPPVMPPHYGRHGGGHGHRSSYRQGRDYNRKRHRDDDRYAHGSSKRTSDHEFRRNSDNDS  244

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  245  RPEKNPRFR  253


 Score =   140 bits (353),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDR+F GTQEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  26   AKLSAYRDRKFSGTQEEFEQALLNSTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  85

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  86   KNSKTPCGFCFVL  98



>ref|XP_002276868.1| PREDICTED: nuclear cap-binding protein subunit 2 [Vitis vinifera]
 ref|XP_003633238.1| PREDICTED: nuclear cap-binding protein subunit 2 [Vitis vinifera]
 ref|XP_010657003.1| PREDICTED: nuclear cap-binding protein subunit 2 [Vitis vinifera]
Length=253

 Score =   182 bits (462),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 108/129 (84%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQRQLVDYG+GSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEAQRQLVDYGSGSLGS  167

Query  450  FPPVMAPQYGRQGGHGGSY---RHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPVM  QYGR GG  G     RH RDY RKRHR+DDRH  D+SKR    +  R+SDH++
Sbjct  168  FPPVMPSQYGRHGGSQGHGGSNRHSRDYPRKRHRDDDRHSHDFSKRTSDHDSRRNSDHDS  227

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  228  RPEKNPRFR  236


 Score =   138 bits (348),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRD+RF GTQE+FE ALL S TVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDKRFPGTQEDFEHALLTSMTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_006372745.1| hypothetical protein POPTR_0017s04640g [Populus trichocarpa]
 gb|ERP50542.1| hypothetical protein POPTR_0017s04640g [Populus trichocarpa]
Length=255

 Score =   180 bits (456),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 107/131 (82%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQRQLVDYGTGSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQQELEAQRQLVDYGTGSLGS  167

Query  450  FPPVM-APQYGRQGG---HGGSYRHGRDY-YRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            FPPVM  P YGR+GG   HGGS R   DY +RKRHREDDR   + SKR    E  R+ D 
Sbjct  168  FPPVMPPPHYGRRGGIHNHGGSLRQSGDYHHRKRHREDDRPPRESSKRTSDHESRRNFDP  227

Query  285  EARPEKNPRFR  253
            ++RPEKNPRFR
Sbjct  228  DSRPEKNPRFR  238


 Score =   137 bits (344),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G QEEFE+AL  STTVY+GNMSFY+TEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    TKLSAYRDRRFPGNQEEFEQALQTSTTVYIGNMSFYSTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_011029071.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Populus 
euphratica]
Length=255

 Score =   179 bits (455),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 106/131 (81%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQRQLVDYGTGSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQQELEAQRQLVDYGTGSLGS  167

Query  450  FPPVM-APQYGRQGG---HGGSYRHGRDY-YRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            FPPVM  P YGR+GG   H GS+R   DY +RKRHREDDR   D SKR    E  R+ D 
Sbjct  168  FPPVMPPPHYGRRGGGHNHSGSHRQSGDYHHRKRHREDDRPPRDSSKRTSDHESRRNFDP  227

Query  285  EARPEKNPRFR  253
            + RPEKNPRFR
Sbjct  228  DTRPEKNPRFR  238


 Score =   137 bits (345),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G QEEFE+AL  STTVY+GNMSFY+TEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    TKLSAYRDRRFPGNQEEFEQALQTSTTVYIGNMSFYSTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>gb|AIX10951.1| nuclear cap-binding protein subunit 2-like protein [Gardenia 
jasminoides]
Length=258

 Score =   184 bits (466),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 110/134 (82%), Gaps = 8/134 (6%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDY-----GT  466
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDP RGGYGKLVQ+ELEAQRQLVDY     G 
Sbjct  108  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPARGGYGKLVQRELEAQRQLVDYNAGSIGA  167

Query  465  GSLGNFPPVMAPQYGRQG---GHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRD  295
            GSL +FPPVM PQYGR G   G+GGS+R GRDY+RKR+RED+R   ++SKR +  E  R 
Sbjct  168  GSLASFPPVMPPQYGRHGGQHGYGGSHRQGRDYHRKRYREDERRGPEFSKRNFDHESRRS  227

Query  294  SDHEARPEKNPRFR  253
            SDH++RPEKNP+FR
Sbjct  228  SDHDSRPEKNPQFR  241


 Score =   132 bits (332),  Expect(2) = 5e-77, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+S YRDRRF G+QEEFE+ALLKSTTVYVGNMSFYTTEEQV ELF RAGEIK+I+MGLD
Sbjct  9    AKLSQYRDRRFPGSQEEFEQALLKSTTVYVGNMSFYTTEEQVCELFFRAGEIKRIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVV  81



>gb|KJB31634.1| hypothetical protein B456_005G199600 [Gossypium raimondii]
Length=253

 Score =   174 bits (440),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 111/129 (86%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF+EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYG GSLG+
Sbjct  108  DFDWGFVEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGAGSLGS  167

Query  450  FPPVMAP---QYGRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPVMAP   ++G   GHGGSYRHGRDY+RKRHR+DD +  + SKR    E  R SDH+A
Sbjct  168  FPPVMAPHYGRHGGGHGHGGSYRHGRDYHRKRHRDDDHYARESSKRNSDHESRRASDHDA  227

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  228  RPEKNPRFR  236


 Score =   141 bits (355),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G+QEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRRFNGSQEEFEQALLTSTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_006591867.1| PREDICTED: uncharacterized protein LOC100789535 isoform X1 [Glycine 
max]
Length=253

 Score =   172 bits (436),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 109/129 (84%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELE QRQLVDYGTGSLG+
Sbjct  108  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEVQRQLVDYGTGSLGS  167

Query  450  FPPVMAPQY---GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPV+   Y   G   GHGGS+RHGRDYYRKRHR+DDRH  + SKR    E  R++DHE+
Sbjct  168  FPPVIPTSYGRHGGGHGHGGSHRHGRDYYRKRHRDDDRHIHESSKRNSDHESRRNTDHES  227

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  228  RPEKNPRFR  236


 Score =   142 bits (357),  Expect(2) = 2e-76, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SKISAYRDRRF GTQEEFE ALL STTVYVGNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKISAYRDRRFPGTQEEFEHALLTSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_011466924.1| PREDICTED: nuclear cap-binding protein subunit 2 [Fragaria vesca 
subsp. vesca]
Length=254

 Score =   175 bits (443),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 107/131 (82%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQR LVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEAQRTLVDYGTGSLGT  167

Query  450  FPPVMAPQY----GRQGGHGGSYRHGR-DYYRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            FPPVM P +    G    HGGS+RHGR D++RKRHR+DDR   + SKR    E  ++SDH
Sbjct  168  FPPVMPPPHYGRQGGGNNHGGSHRHGRADFHRKRHRDDDRQSYENSKRSSNYESRKNSDH  227

Query  285  EARPEKNPRFR  253
            ++RPEKNPRFR
Sbjct  228  DSRPEKNPRFR  238


 Score =   137 bits (346),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+S YRDRRF G+QEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    AKLSQYRDRRFPGSQEEFEQALLSSTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>gb|KJB31636.1| hypothetical protein B456_005G199600, partial [Gossypium raimondii]
Length=307

 Score =   171 bits (433),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 104/133 (78%), Gaps = 7/133 (5%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF+EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYG GSLG+
Sbjct  158  DFDWGFVEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGAGSLGS  217

Query  450  FPPVMAPQYGRQGGHGGSYRH-------GRDYYRKRHREDDRHRLDYSKRVYRREPVRDS  292
            FPPVMAP YGR GG  G             DY+RKRHR+DD +  + SKR    E  R S
Sbjct  218  FPPVMAPHYGRHGGGHGHGGSYRHGRGITSDYHRKRHRDDDHYARESSKRNSDHESRRAS  277

Query  291  DHEARPEKNPRFR  253
            DH+ARPEKNPRFR
Sbjct  278  DHDARPEKNPRFR  290


 Score =   141 bits (356),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G+QEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  59   AKLSAYRDRRFNGSQEEFEQALLTSTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  118

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  119  KNSKTPCGFCFVL  131



>ref|XP_006447223.1| hypothetical protein CICLE_v10016365mg [Citrus clementina]
 ref|XP_006469933.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Citrus 
sinensis]
 gb|ESR60463.1| hypothetical protein CICLE_v10016365mg [Citrus clementina]
Length=253

 Score =   171 bits (432),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 109/129 (84%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQRQLVDYGTGSL +
Sbjct  108  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEAQRQLVDYGTGSLNS  167

Query  450  FPPVMAPQY---GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            F PVM P+Y   G   GHGGS+RHGRDY RKRHREDDRH  + SKR    E  R+SDH++
Sbjct  168  FQPVMQPRYGRHGGGHGHGGSHRHGRDYQRKRHREDDRHAHETSKRSADFESRRNSDHDS  227

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  228  RPEKNPRFR  236


 Score =   141 bits (355),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            K+SAYRDRRF GTQEEFEEALL STTVYVGNMSFYTTEEQ+YELFSRAGEIKKI+MGLDK
Sbjct  10   KLSAYRDRRFPGTQEEFEEALLASTTVYVGNMSFYTTEEQIYELFSRAGEIKKIIMGLDK  69

Query  734  NSRTPCGFCFVI  699
            NS+TPCGFCF +
Sbjct  70   NSKTPCGFCFAL  81



>ref|XP_007198839.1| hypothetical protein PRUPE_ppa010346mg [Prunus persica]
 gb|EMJ00038.1| hypothetical protein PRUPE_ppa010346mg [Prunus persica]
Length=253

 Score =   173 bits (438),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 103/130 (79%), Gaps = 4/130 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQR LVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEAQRTLVDYGTGSLGT  167

Query  450  FPPVMAPQYGRQGGHGGSYRHGR----DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            FPPVM P YGR GG        R    DY+RKRHR+DDRH  + SKR    E  ++SDHE
Sbjct  168  FPPVMPPHYGRHGGGHNHGGTHRPGRGDYHRKRHRDDDRHSYESSKRNSDYESRKNSDHE  227

Query  282  ARPEKNPRFR  253
            +RPEKNPRFR
Sbjct  228  SRPEKNPRFR  237


 Score =   138 bits (347),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF G QEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKLSQYRDRRFPGPQEEFEQALLASTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_008229021.1| PREDICTED: nuclear cap-binding protein subunit 2 [Prunus mume]
Length=253

 Score =   173 bits (438),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 103/130 (79%), Gaps = 4/130 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQR LVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEAQRTLVDYGTGSLGT  167

Query  450  FPPVMAPQYGRQGGHGGSYRHGR----DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            FPPVM P YGR GG        R    DY+RKRHR+DDRH  + SKR    E  ++SDHE
Sbjct  168  FPPVMPPHYGRHGGGHNHGGTHRPGRGDYHRKRHRDDDRHSYESSKRNSDYESRKNSDHE  227

Query  282  ARPEKNPRFR  253
            +RPEKNPRFR
Sbjct  228  SRPEKNPRFR  237


 Score =   137 bits (346),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF G+QE+FE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKLSQYRDRRFPGSQEDFEQALLASTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_006594834.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Glycine 
max]
Length=255

 Score =   171 bits (434),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 108/131 (82%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELE QRQLVDYG GSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEVQRQLVDYGAGSLGS  167

Query  450  FPPVMAPQY-----GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            FPPV+   Y     G   GHGGS+RHGRDYYRKRHR+D+RH  + SKR    E  R++DH
Sbjct  168  FPPVIPTSYGRHGGGGGHGHGGSHRHGRDYYRKRHRDDERHTHESSKRTSDHESRRNTDH  227

Query  285  EARPEKNPRFR  253
            E+RPEKNPRFR
Sbjct  228  ESRPEKNPRFR  238


 Score =   139 bits (349),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SKISAYRDRRF GTQEEFE AL+ STTVYVGNMSFYTTEEQVYELFSR GEIKKI+MGLD
Sbjct  9    SKISAYRDRRFPGTQEEFEHALVTSTTVYVGNMSFYTTEEQVYELFSRTGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_007149811.1| hypothetical protein PHAVU_005G100900g [Phaseolus vulgaris]
 gb|ESW21805.1| hypothetical protein PHAVU_005G100900g [Phaseolus vulgaris]
Length=257

 Score =   171 bits (433),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 109/133 (82%), Gaps = 7/133 (5%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELE QRQLVDYGTGSLG+
Sbjct  108  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEVQRQLVDYGTGSLGS  167

Query  450  FPPVMAPQY-------GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDS  292
            FPPV+   Y       G   GHGGS+RHGRDYYRKRHR+DDRH  + SKR    +  R++
Sbjct  168  FPPVIPSSYGRHGGGHGHGHGHGGSHRHGRDYYRKRHRDDDRHTHESSKRTSDHDSRRNT  227

Query  291  DHEARPEKNPRFR  253
            DHE+RPEKNPRFR
Sbjct  228  DHESRPEKNPRFR  240


 Score =   139 bits (350),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF GTQE+FE ALL STTVYVGNMSFYTTEEQVYELF+RAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFPGTQEDFEHALLTSTTVYVGNMSFYTTEEQVYELFTRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>gb|KJB31635.1| hypothetical protein B456_005G199600, partial [Gossypium raimondii]
Length=306

 Score =   169 bits (427),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 104/132 (79%), Gaps = 6/132 (5%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF+EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYG GSLG+
Sbjct  158  DFDWGFVEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGAGSLGS  217

Query  450  FPPVMAPQYGRQGGHGGSYRH-----GRDYY-RKRHREDDRHRLDYSKRVYRREPVRDSD  289
            FPPVMAP YGR GG  G         G  YY RKRHR+DD +  + SKR    E  R SD
Sbjct  218  FPPVMAPHYGRHGGGHGHGGSYRHGRGITYYHRKRHRDDDHYARESSKRNSDHESRRASD  277

Query  288  HEARPEKNPRFR  253
            H+ARPEKNPRFR
Sbjct  278  HDARPEKNPRFR  289


 Score =   141 bits (355),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G+QEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  59   AKLSAYRDRRFNGSQEEFEQALLTSTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  118

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  119  KNSKTPCGFCFVL  131



>ref|XP_010441918.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Camelina 
sativa]
Length=254

 Score =   174 bits (442),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP RGGYGKLVQKELEAQRQLVDYGTGSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPARGGYGKLVQKELEAQRQLVDYGTGSLGS  167

Query  450  FPPVMAPQYGRQGGH--GGSYRHGR--DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            +P      YGR+GG+  GGS R GR  DY+RKR R+DDR+  D S+R    E  RD+D +
Sbjct  168  YPQAAPSNYGRRGGYNQGGSNRQGRGGDYHRKRQRDDDRYGRDNSRRNTDHESRRDTDQD  227

Query  282  ARPEKNPRFR  253
             RPEKNPRFR
Sbjct  228  MRPEKNPRFR  237


 Score =   135 bits (340),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEF+EAL  STTVY+GN+SFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRRFSGTQEEFDEALRTSTTVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_010441915.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Camelina 
sativa]
 ref|XP_010441916.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Camelina 
sativa]
 ref|XP_010441917.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Camelina 
sativa]
Length=255

 Score =   174 bits (441),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 104/131 (79%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP RGGYGKLVQKELEAQRQLVDYGTGSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPARGGYGKLVQKELEAQRQLVDYGTGSLGS  167

Query  450  FPPVMAPQYGRQGGH--GGSYRHGR---DYYRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            +P      YGR+GG+  GGS R GR   DY+RKR R+DDR+  D S+R    E  RD+D 
Sbjct  168  YPQAAPSNYGRRGGYNQGGSNRQGRGGGDYHRKRQRDDDRYGRDNSRRNTDHESRRDTDQ  227

Query  285  EARPEKNPRFR  253
            + RPEKNPRFR
Sbjct  228  DMRPEKNPRFR  238


 Score =   135 bits (339),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEF+EAL  STTVY+GN+SFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRRFSGTQEEFDEALRTSTTVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_010481768.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Camelina 
sativa]
 ref|XP_010494424.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Camelina 
sativa]
Length=254

 Score =   174 bits (441),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 104/130 (80%), Gaps = 4/130 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP RGGYGKLVQKELEAQRQLVDYGTGSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPARGGYGKLVQKELEAQRQLVDYGTGSLGS  167

Query  450  FPPVMAPQYGRQGGH--GGSYRHGR--DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            +P      YGR+GG+  GGS R GR  DY+RKR R+DDR+  D S+R    E  RD+D +
Sbjct  168  YPQAAPSNYGRRGGYNQGGSNRQGRGGDYHRKRQRDDDRYGRDNSRRNTDHENRRDTDQD  227

Query  282  ARPEKNPRFR  253
             RPEKNPRFR
Sbjct  228  MRPEKNPRFR  237


 Score =   135 bits (339),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEF+EAL  STTVY+GN+SFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRRFSGTQEEFDEALRTSTTVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_011047689.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Populus 
euphratica]
 ref|XP_011047690.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Populus 
euphratica]
Length=255

 Score =   172 bits (437),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 104/131 (79%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELE QRQLVDYG GSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEVQRQLVDYGAGSLGS  167

Query  450  FPPVM-APQYGRQGG---HGGSYRHGRDYY-RKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            FP VM  P YGR+GG   +G S R GRDY  RKR+REDDR   + SKR    E  R+ D 
Sbjct  168  FPAVMPPPHYGRRGGGQNYGSSNRQGRDYLQRKRNREDDRQPRESSKRTSDHESRRNFDP  227

Query  285  EARPEKNPRFR  253
            ++RPEKNPRFR
Sbjct  228  DSRPEKNPRFR  238


 Score =   136 bits (343),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G QEEFE+AL  STTVY+GNMSFY+TEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    TKLSAYRDRRFPGNQEEFEQALQTSTTVYIGNMSFYSTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_002309756.2| hypothetical protein POPTR_0007s01170g [Populus trichocarpa]
 gb|EEE90206.2| hypothetical protein POPTR_0007s01170g [Populus trichocarpa]
Length=304

 Score =   171 bits (433),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 104/131 (79%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELE QRQLVDYG GSLG+
Sbjct  157  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEVQRQLVDYGAGSLGS  216

Query  450  FPPVM-APQYGRQGG---HGGSYRHGRDYY-RKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            FP VM  P +GR+GG   +G S R GRDY  RKR+REDD+   + SKR    E  R+ D 
Sbjct  217  FPAVMPPPHFGRRGGGQNYGSSNRQGRDYLQRKRNREDDQQPRESSKRTSDHESRRNFDP  276

Query  285  EARPEKNPRFR  253
            ++RPEKNPRFR
Sbjct  277  DSRPEKNPRFR  287


 Score =   135 bits (341),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G QEEFE AL  +TTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  58   TKLSAYRDRRFPGNQEEFEHALQTATTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  117

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  118  KNSKTPCGFCFVL  130



>gb|ABK96113.1| unknown [Populus trichocarpa]
Length=255

 Score =   170 bits (430),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 104/131 (79%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELE QRQLVDYG GSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEVQRQLVDYGAGSLGS  167

Query  450  FPPVM-APQYGRQGG---HGGSYRHGRDYY-RKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            FP VM  P +GR+GG   +G S R GRDY  RKR+REDD+   + SKR    E  R+ D 
Sbjct  168  FPAVMPPPHFGRRGGGQNYGSSNRQGRDYLQRKRNREDDQQPRESSKRTSDHESRRNFDP  227

Query  285  EARPEKNPRFR  253
            ++RPEKNPRFR
Sbjct  228  DSRPEKNPRFR  238


 Score =   136 bits (342),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G QEEFE AL  +TTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    TKLSAYRDRRFPGNQEEFEHALQTATTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_006280871.1| hypothetical protein CARUB_v10026861mg, partial [Capsella rubella]
 gb|EOA13769.1| hypothetical protein CARUB_v10026861mg, partial [Capsella rubella]
Length=301

 Score =   171 bits (434),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 103/131 (79%), Gaps = 5/131 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP RGGYGKLVQKELEAQRQLVDYGTGSLG+
Sbjct  154  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPARGGYGKLVQKELEAQRQLVDYGTGSLGS  213

Query  450  FPPVMAPQYGRQGGH---GGSYRHGR--DYYRKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            +       YGR+GG+   GGS R GR  DY+RKR R+DDR+  D S+R    E  RD+D 
Sbjct  214  YQQAAPSNYGRRGGYNNQGGSNRQGRGGDYHRKRQRDDDRYGRDNSRRNTDHETRRDTDQ  273

Query  285  EARPEKNPRFR  253
            + RPEKNPRFR
Sbjct  274  DMRPEKNPRFR  284


 Score =   133 bits (335),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEF+EAL  S+TVY+GN+SFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  55   AKLSAYRDRRFSGTQEEFDEALRTSSTVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLD  114

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  115  KNTKTPCGFCFVL  127



>ref|XP_009383469.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Musa acuminata 
subsp. malaccensis]
Length=250

 Score =   169 bits (427),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 103/129 (80%), Gaps = 6/129 (5%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELE+QR+LVDYG G+L  
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELESQRELVDYGAGALSA  167

Query  450  FPPVMAPQYGRQG---GHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            F P M   YGR G   GHGGS+RHGRD YRKR+RED+    + S+R    E  R SDH++
Sbjct  168  FQPPMP--YGRHGGDYGHGGSHRHGRD-YRKRNREDEHSASEMSRRTSGYESRRSSDHDS  224

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  225  RPEKNPRFR  233


 Score =   134 bits (337),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G QEE+E AL  STTVYVGNMSFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRRFPGNQEEYEGALQTSTTVYVGNMSFYTTEEQMYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_010522593.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Tarenaya 
hassleriana]
Length=249

 Score =   166 bits (420),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 108/129 (84%), Gaps = 3/129 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYG GSLG+
Sbjct  108  DFDWGFQEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGAGSLGS  167

Query  450  FPPVMAPQ---YGRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPV+      +G   GHGGSYRHGRD++RKR+R+DDR+  + SKR    E  RDSDH+ 
Sbjct  168  FPPVLPSNYGRHGGGHGHGGSYRHGRDHHRKRYRDDDRYGREPSKRTSDHESRRDSDHDM  227

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  228  RPEKNPRFR  236


 Score =   136 bits (343),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            K+SAYRDRRF GTQEEFEEAL  S+TVY+GNMSFYTTEEQVYELFSRAGEIKKI MGLDK
Sbjct  10   KLSAYRDRRFPGTQEEFEEALRTSSTVYIGNMSFYTTEEQVYELFSRAGEIKKITMGLDK  69

Query  734  NSRTPCGFCFVI  699
            N++TPCGFCFV+
Sbjct  70   NTKTPCGFCFVL  81



>ref|XP_004487199.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Cicer 
arietinum]
Length=278

 Score =   164 bits (415),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 109/154 (71%), Gaps = 28/154 (18%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELE QRQLVDYG GSLG+
Sbjct  108  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEVQRQLVDYGAGSLGS  167

Query  450  FPPVMAPQY---GRQGGHGGSYRHGR-DYYRKRHREDDRHRLDYSKRV----YRREP---  304
            FPPV+   Y   G   GHGGSYRHGR DY RKRHR+DDRH  + SKR      RR P   
Sbjct  168  FPPVIPSSYGRHGGSHGHGGSYRHGRGDYNRKRHRDDDRHTHEPSKRTSDHESRRNPDHE  227

Query  303  -----------------VRDSDHEARPEKNPRFR  253
                              R+SDHE+RPEKNPRFR
Sbjct  228  SRRNPDHESRRNPDHESRRNSDHESRPEKNPRFR  261


 Score =   138 bits (347),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G QEEFE AL+ STTVYVGNMSFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRRFPGNQEEFEHALITSTTVYVGNMSFYTTEEQIYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_010522592.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Tarenaya 
hassleriana]
Length=250

 Score =   164 bits (414),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 103/130 (79%), Gaps = 4/130 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYG GSLG+
Sbjct  108  DFDWGFQEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGAGSLGS  167

Query  450  FPPVMAPQYGRQGGHGGSYRHGR----DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            FPPV+   YGR GG  G     R    D++RKR+R+DDR+  + SKR    E  RDSDH+
Sbjct  168  FPPVLPSNYGRHGGGHGHGGSYRHGRGDHHRKRYRDDDRYGREPSKRTSDHESRRDSDHD  227

Query  282  ARPEKNPRFR  253
             RPEKNPRFR
Sbjct  228  MRPEKNPRFR  237


 Score =   136 bits (342),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            K+SAYRDRRF GTQEEFEEAL  S+TVY+GNMSFYTTEEQVYELFSRAGEIKKI MGLDK
Sbjct  10   KLSAYRDRRFPGTQEEFEEALRTSSTVYIGNMSFYTTEEQVYELFSRAGEIKKITMGLDK  69

Query  734  NSRTPCGFCFVI  699
            N++TPCGFCFV+
Sbjct  70   NTKTPCGFCFVL  81



>gb|EYU22773.1| hypothetical protein MIMGU_mgv1a012251mg [Erythranthe guttata]
Length=256

 Score =   160 bits (405),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 107/136 (79%), Gaps = 14/136 (10%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYG GSLG+
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGAGSLGS  167

Query  450  FPPVMAPQ-----YGRQGGHGGSYRHGR-DYYRKRHREDDRHRLDYSKR----VYRREPV  301
            F P++AP      +G   GHGG+ RHGR D+ RKR REDDR   D+++R    VYRR P 
Sbjct  168  FQPILAPTYGGGRHGGNYGHGGNNRHGRGDFPRKRQREDDRRGPDFTRRKSDFVYRRNP-  226

Query  300  RDSDHEARPEKNPRFR  253
               D+E RPEKNPRFR
Sbjct  227  ---DNEPRPEKNPRFR  239


 Score =   139 bits (349),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEF+EALL STT+YVGNMSFYTTEEQVYELF+RAGEIKKIVMGLD
Sbjct  9    NKLSAYRDRRFSGTQEEFDEALLNSTTIYVGNMSFYTTEEQVYELFTRAGEIKKIVMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN +TPCGFCF++
Sbjct  69   KNGKTPCGFCFIM  81



>ref|XP_004137136.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Cucumis 
sativus]
 ref|XP_004154724.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Cucumis 
sativus]
Length=251

 Score =   163 bits (413),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 122/145 (84%), Gaps = 3/145 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLG+
Sbjct  108  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGS  167

Query  450  FPPVMAPQY-GRQGGHGGSYRHGRDY-YRKRHREDDRHRLDYSKRVYRREPVRDSDHEAR  277
              PVM PQY    G HG   RHGRDY +RKR+R+DDRH  + SKR    E  R+S++E+R
Sbjct  168  MAPVM-PQYGKHGGSHGHGNRHGRDYHHRKRYRDDDRHAHESSKRTSDYESRRNSNYESR  226

Query  276  PEKNPRFResgdsdeedddDQKQSH  202
            PEKNPRFRESGDSDEEDDDD+KQ H
Sbjct  227  PEKNPRFRESGDSDEEDDDDRKQRH  251


 Score =   134 bits (336),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+S YRDRRF G+Q+EFE AL  STTVYVGNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    TKLSIYRDRRFHGSQDEFEVALQTSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_008464581.1| PREDICTED: nuclear cap-binding protein subunit 2 [Cucumis melo]
Length=251

 Score =   162 bits (411),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 124/145 (86%), Gaps = 3/145 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLG+
Sbjct  108  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGS  167

Query  450  FPPVMAPQYGR-QGGHGGSYRHGRDY-YRKRHREDDRHRLDYSKRVYRREPVRDSDHEAR  277
              PVM  QYG+  G HG  +RHGRDY +RKR+R+DDRH  + SKR    E  R+S++E+R
Sbjct  168  MAPVMT-QYGKHGGSHGHGHRHGRDYHHRKRYRDDDRHAHESSKRTSDYESRRNSNYESR  226

Query  276  PEKNPRFResgdsdeedddDQKQSH  202
            PEKNPRFRESGDSDEEDDDD+KQ H
Sbjct  227  PEKNPRFRESGDSDEEDDDDRKQRH  251


 Score =   134 bits (338),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+S YRDRRF G+Q+EFE AL  STTVYVGNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    TKLSVYRDRRFHGSQDEFEVALQTSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_009101729.1| PREDICTED: nuclear cap-binding protein subunit 2 [Brassica rapa]
 ref|XP_009101730.1| PREDICTED: nuclear cap-binding protein subunit 2 [Brassica rapa]
Length=260

 Score =   160 bits (404),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 101/137 (74%), Gaps = 11/137 (8%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP RGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPARGGYGKLVQKELEAQRQLVDYGTGSLGG  167

Query  450  FPPVMAPQ---------YGRQGGHGGSYRHGR--DYYRKRHREDDRHRLDYSKRVYRREP  304
              P  AP           G   G GGS RHGR  D++RKR R+DDR+  D S+R    E 
Sbjct  168  SYPAPAPSNYERRGGPRGGGGYGQGGSNRHGRGGDFHRKRQRDDDRYGRDNSRRNSDHET  227

Query  303  VRDSDHEARPEKNPRFR  253
             RDSDH+ RPEKNPRFR
Sbjct  228  RRDSDHDMRPEKNPRFR  244


 Score =   135 bits (341),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEFEEAL  S+TVY+GN+SFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRRFSGTQEEFEEALRTSSTVYIGNVSFYTTEEQIYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_002863606.1| cap-binding protein 20 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39865.1| cap-binding protein 20 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   159 bits (401),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 100/134 (75%), Gaps = 9/134 (7%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP RGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPARGGYGKLVQKELEAQRQLVDYGTGSLGA  167

Query  450  FPPVMAPQYGRQGGHGGSY-------RHGR-DYYRKRHREDDRHRLDYSKRVYRREPVRD  295
            +P   AP     G  GG         RHGR DY+RKR R+DDR+  D S+R    E  RD
Sbjct  168  YPQA-APSNYGNGRRGGGNYGQGGPNRHGRGDYHRKRQRDDDRYGRDNSRRNTDHESRRD  226

Query  294  SDHEARPEKNPRFR  253
            +DH+ RPEKNPRFR
Sbjct  227  TDHDMRPEKNPRFR  240


 Score =   135 bits (341),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEF+EAL  STTVY+GN+SFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRRFSGTQEEFDEALRASTTVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|NP_001242001.1| uncharacterized protein LOC100789535 [Glycine max]
 gb|ACU24095.1| unknown [Glycine max]
Length=235

 Score =   150 bits (379),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 99/121 (82%), Gaps = 11/121 (9%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELE QRQLVDYGTGSLG+
Sbjct  108  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEVQRQLVDYGTGSLGS  167

Query  450  FPPVMAPQY---GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPV+   Y   G   GHGGS+RHGRDYYRKRHR+DDRH  + SK        R+SDHE+
Sbjct  168  FPPVIPTSYGRHGGGHGHGGSHRHGRDYYRKRHRDDDRHIHESSK--------RNSDHES  219

Query  279  R  277
            R
Sbjct  220  R  220


 Score =   142 bits (358),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SKISAYRDRRF GTQEEFE ALL STTVYVGNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKISAYRDRRFPGTQEEFEHALLTSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_006380277.1| hypothetical protein POPTR_0007s01170g [Populus trichocarpa]
 gb|ERP58074.1| hypothetical protein POPTR_0007s01170g [Populus trichocarpa]
Length=318

 Score =   157 bits (398),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 97/124 (78%), Gaps = 5/124 (4%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELE QRQLVDYG GSLG+
Sbjct  157  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEVQRQLVDYGAGSLGS  216

Query  450  FPPVM-APQYGRQGG---HGGSYRHGRDYY-RKRHREDDRHRLDYSKRVYRREPVRDSDH  286
            FP VM  P +GR+GG   +G S R GRDY  RKR+REDD+   + SKR    E  R+ D 
Sbjct  217  FPAVMPPPHFGRRGGGQNYGSSNRQGRDYLQRKRNREDDQQPRESSKRTSDHESRRNFDP  276

Query  285  EARP  274
            ++RP
Sbjct  277  DSRP  280


 Score =   134 bits (338),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G QEEFE AL  +TTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  58   TKLSAYRDRRFPGNQEEFEHALQTATTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  117

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  118  KNSKTPCGFCFVL  130



>ref|XP_009413394.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Musa acuminata 
subsp. malaccensis]
Length=247

 Score =   166 bits (420),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 102/126 (81%), Gaps = 3/126 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQR+LVDYG G+LG 
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEAQRELVDYGAGALGA  167

Query  450  FPPVMAPQYGRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEARPE  271
            F P    QYG+ G +G S+RHGRD YRKR+RED++   + S+R    E  R+ +H+ RPE
Sbjct  168  FQP--PTQYGKHGVYGDSHRHGRD-YRKRYREDEQSASEMSRRTSGYESRRNPEHDLRPE  224

Query  270  KNPRFR  253
            KNPRFR
Sbjct  225  KNPRFR  230


 Score =   126 bits (316),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+S YRD+RF+G QEE+E  L  STTVY+GNMSFYTTEEQVYELF+RAGEIKKI+MGL+
Sbjct  9    AKLSVYRDKRFRGNQEEYERVLQASTTVYIGNMSFYTTEEQVYELFTRAGEIKKIIMGLE  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>gb|KHG20168.1| Nuclear cap-binding subunit 2 -like protein [Gossypium arboreum]
Length=344

 Score =   150 bits (379),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 101/147 (69%), Gaps = 21/147 (14%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP------------------GRGGYGKLVQK  505
            DFDWGF+EGRQWGRG+SGGQVRDEYRTDYDP                         ++QK
Sbjct  181  DFDWGFVEGRQWGRGRSGGQVRDEYRTDYDPDILSVVGLEFNALSFLSYSETNLPCIIQK  240

Query  504  ELEAQRQLVDYGTGSLGNFPPVMAPQYGRQGGHGGSYR---HGRDYYRKRHREDDRHRLD  334
            ELEAQRQLVDYG GSLG+FPPVMAP YGR GG  G      HGRDY+RKRHR+DDR+  +
Sbjct  241  ELEAQRQLVDYGAGSLGSFPPVMAPHYGRHGGGHGHGGSYRHGRDYHRKRHRDDDRYARE  300

Query  333  YSKRVYRREPVRDSDHEARPEKNPRFR  253
             SKR    E  R SDH+ARPEKNPRFR
Sbjct  301  SSKRNSDHESRRASDHDARPEKNPRFR  327


 Score =   141 bits (355),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF G+QEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  82   AKLSAYRDRRFNGSQEEFEQALLTSTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  141

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  142  KNSKTPCGFCFVL  154



>ref|NP_199233.1| nuclear cap-binding protein subunit 20 [Arabidopsis thaliana]
 ref|NP_001078705.1| nuclear cap-binding protein subunit 20 [Arabidopsis thaliana]
 sp|Q9XFD1.1|NCBP2_ARATH RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=AtCBP20 [Arabidopsis thaliana]
 gb|AAD29697.1|AF140219_1 nuclear cap-binding protein [Arabidopsis thaliana]
 dbj|BAB10987.1| nuclear cap-binding protein; CBP20 [Arabidopsis thaliana]
 gb|AAO44079.1| At5g44200 [Arabidopsis thaliana]
 dbj|BAE99827.1| nuclear cap-binding protein [Arabidopsis thaliana]
 gb|AED95073.1| nuclear cap-binding protein subunit 20 [Arabidopsis thaliana]
 gb|AED95074.1| nuclear cap-binding protein subunit 20 [Arabidopsis thaliana]
Length=257

 Score =   156 bits (394),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 100/134 (75%), Gaps = 9/134 (7%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP RGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPARGGYGKLVQKELEAQRQLVDYGTGSLGA  167

Query  450  FPPVMAPQ-------YGRQGGHGGSYRHGR-DYYRKRHREDDRHRLDYSKRVYRREPVRD  295
            +P   AP         G   G GG  RHGR DY+RKR R+DDR+  D S+R    E  RD
Sbjct  168  YPQA-APTNYGNGRRGGGNYGQGGQNRHGRGDYHRKRQRDDDRYGRDNSRRNTDHESRRD  226

Query  294  SDHEARPEKNPRFR  253
            +D + RPEKNPRFR
Sbjct  227  TDSDMRPEKNPRFR  240


 Score =   135 bits (340),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEF+EAL  STTVY+GN+SFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRRFSGTQEEFDEALRASTTVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_002517864.1| 20 kD nuclear cap binding protein, putative [Ricinus communis]
 gb|EEF44382.1| 20 kD nuclear cap binding protein, putative [Ricinus communis]
Length=255

 Score =   153 bits (386),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 103/132 (78%), Gaps = 7/132 (5%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPG---RGGYGKLVQKELEAQRQLVDYGTGS  460
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP     GGYGKLVQ+ELE QRQLVDYG GS
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPDILFLGGYGKLVQRELE-QRQLVDYGAGS  166

Query  459  LGNFPPVM-APQYGRQGGHGGSY--RHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSD  289
            LG+FPPVM  PQYGR GG G     RHGRDY+RKR R+DDR   + S+R    E  R++D
Sbjct  167  LGSFPPVMPPPQYGRHGGSGHGGFQRHGRDYHRKRFRDDDRQAREPSRRTSDHESRRNND  226

Query  288  HEARPEKNPRFR  253
             ++RPEKNPRFR
Sbjct  227  PDSRPEKNPRFR  238


 Score =   137 bits (344),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDR+F G QEEFE ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRKFPGNQEEFEHALLTSTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>gb|KEH39183.1| nuclear cap-binding protein subunit 2 [Medicago truncatula]
Length=259

 Score =   154 bits (390),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 102/135 (76%), Gaps = 9/135 (7%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELE QR LVDYGTGSLG+
Sbjct  108  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEVQRHLVDYGTGSLGS  167

Query  450  FPPVMAPQYGRQGGHGGSYRHGR----DYYRKRHREDDRHRLDYSKRVYRREPVR-----  298
            FPPV+   YGR GG  G     R    DY RKR+R+DDR+  + SKR    E  R     
Sbjct  168  FPPVIPSSYGRHGGGHGHGGSYRHGRGDYQRKRYRDDDRYTHEPSKRTSDHESRRNSDHK  227

Query  297  DSDHEARPEKNPRFR  253
            +SDHE+RPEKNPRFR
Sbjct  228  NSDHESRPEKNPRFR  242


 Score =   135 bits (340),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF G QEEFE AL  STTVYVGNMSFYTTEEQ+YELF+RAGEIKKI+MGLD
Sbjct  9    AKISAYRDRRFPGNQEEFEHALKTSTTVYVGNMSFYTTEEQIYELFTRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_006403129.1| hypothetical protein EUTSA_v10003260mg [Eutrema salsugineum]
 gb|ESQ44582.1| hypothetical protein EUTSA_v10003260mg [Eutrema salsugineum]
Length=257

 Score =   152 bits (384),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 96/133 (72%), Gaps = 7/133 (5%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP RGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPARGGYGKLVQKELEAQRQLVDYGTGSLGA  167

Query  450  FPPVMAPQ-------YGRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDS  292
            +P              G   G     R G DY+RKR R+DDR+  + S+R   +E  R++
Sbjct  168  YPAAAQSNYGRRGGGGGYGQGGNRHGRGGGDYHRKRQRDDDRYGRENSRRNSDQESRRET  227

Query  291  DHEARPEKNPRFR  253
            DH+ RPEKNPRFR
Sbjct  228  DHDMRPEKNPRFR  240


 Score =   134 bits (338),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEF+EAL  S+TVY+GN+SFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRRFSGTQEEFDEALRTSSTVYIGNVSFYTTEEQIYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>gb|KGN53785.1| hypothetical protein Csa_4G129020 [Cucumis sativus]
Length=257

 Score =   153 bits (386),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 120/151 (79%), Gaps = 9/151 (6%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPG------RGGYGKLVQKELEAQRQLVDYG  469
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDP        GGYGKLVQKELEAQRQLVDYG
Sbjct  108  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPDILFSFQEGGYGKLVQKELEAQRQLVDYG  167

Query  468  TGSLGNFPPVMAPQY-GRQGGHGGSYRHGRDY-YRKRHREDDRHRLDYSKRVYRREPVRD  295
            TGSLG+  PVM PQY    G HG   RHGRDY +RKR+R+DDRH  + SKR    E  R+
Sbjct  168  TGSLGSMAPVM-PQYGKHGGSHGHGNRHGRDYHHRKRYRDDDRHAHESSKRTSDYESRRN  226

Query  294  SDHEARPEKNPRFResgdsdeedddDQKQSH  202
            S++E+RPEKNPRFRESGDSDEEDDDD+KQ H
Sbjct  227  SNYESRPEKNPRFRESGDSDEEDDDDRKQRH  257


 Score =   134 bits (336),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+S YRDRRF G+Q+EFE AL  STTVYVGNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    TKLSIYRDRRFHGSQDEFEVALQTSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_010904911.1| PREDICTED: nuclear cap-binding protein subunit 2 [Elaeis guineensis]
Length=254

 Score =   157 bits (397),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 102/129 (79%), Gaps = 4/129 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQ+ELEAQRQLVDYG GSLG 
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQRELEAQRQLVDYGAGSLGA  167

Query  450  FPPVMAPQYGRQGGHGGS---YRHGRDYYRKRHREDD-RHRLDYSKRVYRREPVRDSDHE  283
            F P ++  YGR GG  G    +RHGRDY RKR+R+DD R   + S+R    E  R SDH+
Sbjct  168  FQPHISSHYGRHGGDRGHGGLHRHGRDYPRKRYRDDDERSAPEMSRRTSDYESRRTSDHD  227

Query  282  ARPEKNPRF  256
            +RPEKNPRF
Sbjct  228  SRPEKNPRF  236


 Score =   129 bits (324),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            K+S YRDRRF GTQEE+  AL  STTVYVGN+SFYTTEEQVYELFSRAGEIKKI+MGLDK
Sbjct  10   KLSVYRDRRFLGTQEEYVHALQTSTTVYVGNLSFYTTEEQVYELFSRAGEIKKIIMGLDK  69

Query  734  NSRTPCGFCFVI  699
            N++TPCGFCFV+
Sbjct  70   NTKTPCGFCFVL  81



>ref|XP_008809996.1| PREDICTED: nuclear cap-binding protein subunit 2 [Phoenix dactylifera]
Length=254

 Score =   155 bits (392),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 102/129 (79%), Gaps = 4/129 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQ+ELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQRELEAQRQLVDYGTGSLGA  167

Query  450  FPPVMAPQYGRQGGHGGS---YRHGRDYYRKRHREDD-RHRLDYSKRVYRREPVRDSDHE  283
            F P M   YGR GG  G    +R  RDY+RKR+R+DD R   + S+R+   E  R SD++
Sbjct  168  FQPHMPSHYGRHGGDRGHGGLHRQSRDYHRKRYRDDDERSAPEMSRRMSDYESRRTSDYD  227

Query  282  ARPEKNPRF  256
            +RPEKNPRF
Sbjct  228  SRPEKNPRF  236


 Score =   131 bits (329),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF G+QEE+E AL  STTVY+GN+SFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  9    SKVSAYRDRRFPGSQEEYEHALQTSTTVYLGNLSFYTTEEQIYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGF FV+
Sbjct  69   KNTKTPCGFSFVL  81



>emb|CDX94763.1| BnaC07g17720D [Brassica napus]
Length=301

 Score =   150 bits (380),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 101/141 (72%), Gaps = 15/141 (11%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPG--------RGGYGKLVQKELEAQRQLVD  475
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP           GYGKLVQKELEAQRQLVD
Sbjct  145  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPDILSVVILLLSGYGKLVQKELEAQRQLVD  204

Query  474  YGTGSLGNFPPVMAP-QYGRQ----GGHGGSYRHGR--DYYRKRHREDDRHRLDYSKRVY  316
            YGTGSLG   P  AP  Y R+     G GGS RHGR  D++RKR R+DDR+  D ++R  
Sbjct  205  YGTGSLGGSYPAPAPSNYERRGGGGYGQGGSNRHGRGGDFHRKRQRDDDRYGHDNTRRNS  264

Query  315  RREPVRDSDHEARPEKNPRFR  253
              E  RDSDHE RPEKNPRFR
Sbjct  265  DHETRRDSDHEMRPEKNPRFR  285


 Score =   135 bits (339),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEF+EAL  S+TVY+GN+SFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  46   AKLSAYRDRRFSGTQEEFDEALRTSSTVYIGNVSFYTTEEQIYELFSRAGEIKKIIMGLD  105

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  106  KNTKTPCGFCFVL  118



>emb|CDY22302.1| BnaA06g36240D [Brassica napus]
Length=270

 Score =   148 bits (374),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 100/147 (68%), Gaps = 21/147 (14%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGR----------GGYGKLVQKELEAQRQL  481
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP            GGYGKLVQKELEAQRQL
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPDILSVVILFCLDGGYGKLVQKELEAQRQL  167

Query  480  VDYGTGSLGNFPPVMAPQ---------YGRQGGHGGSYRHGR--DYYRKRHREDDRHRLD  334
            VDYGTGSLG   P  AP           G   G GGS RHGR  D++RKR R+DDR+  D
Sbjct  168  VDYGTGSLGGSYPAPAPSNYERRGGPRGGGGYGQGGSNRHGRGGDFHRKRQRDDDRYGRD  227

Query  333  YSKRVYRREPVRDSDHEARPEKNPRFR  253
             S+R    E  RDSDH+ RPEKNPRFR
Sbjct  228  NSRRNSDHETRRDSDHDMRPEKNPRFR  254


 Score =   135 bits (339),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEEFEEAL  S+TVY+GN+SFYTTEEQ+YELFSRAGEIKKI+MGLD
Sbjct  9    AKLSAYRDRRFSGTQEEFEEALRTSSTVYIGNVSFYTTEEQIYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>gb|KDP24088.1| hypothetical protein JCGZ_25745 [Jatropha curcas]
Length=252

 Score =   148 bits (374),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 105/129 (81%), Gaps = 4/129 (3%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELE QRQLVDYG GSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELE-QRQLVDYGAGSLGT  166

Query  450  FPPVMAP---QYGRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            FPPVMAP   ++G   GHGG  RHGRD +RKRHR+DDR   + S+R    E  R+SD ++
Sbjct  167  FPPVMAPHYGRHGGNHGHGGYNRHGRDLHRKRHRDDDRRPHESSRRASDHESRRNSDPDS  226

Query  279  RPEKNPRFR  253
            RPEKNPRFR
Sbjct  227  RPEKNPRFR  235


 Score =   134 bits (338),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDR+F G+QEEFE AL  STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRKFPGSQEEFEYALATSTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>ref|XP_007043673.1| CAP-binding protein 20 isoform 1 [Theobroma cacao]
 gb|EOX99504.1| CAP-binding protein 20 isoform 1 [Theobroma cacao]
Length=309

 Score =   140 bits (354),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDR+F GTQEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  26   AKLSAYRDRKFSGTQEEFEQALLNSTTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  85

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  86   KNSKTPCGFCFVL  98


 Score =   137 bits (345),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 98/168 (58%), Gaps = 42/168 (25%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRD---------------------------------EYRT  550
            DFDWGF+EGRQWGRG+SGGQV                                     + 
Sbjct  125  DFDWGFVEGRQWGRGRSGGQVSSFVVPAILLVSDQMHILRKTRIVLAFGIGTSCFGLVKD  184

Query  549  DYDPGR------GGYGKLVQKELEAQRQLVDYGTGSLGNFPPVMAPQY---GRQGGHGGS  397
            D+D         GGYGKLVQ+ELEAQRQLVDYG GSLG+FPPVM P Y   G   GH  S
Sbjct  185  DWDAVAKVLFLIGGYGKLVQRELEAQRQLVDYGAGSLGSFPPVMPPHYGRHGGGHGHRSS  244

Query  396  YRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEARPEKNPRFR  253
            YR GRDY RKRHR+DDR+    SKR    E  R+SD+++RPEKNPRFR
Sbjct  245  YRQGRDYNRKRHRDDDRYAHGSSKRTSDHEFRRNSDNDSRPEKNPRFR  292



>ref|XP_006647502.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Oryza 
brachyantha]
Length=241

 Score =   141 bits (356),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 92/130 (71%), Gaps = 18/130 (14%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQKELEAQR+LVDYGTG+   
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQKELEAQRELVDYGTGA---  164

Query  450  FPPVMAPQY---GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            F P   PQY    R+ G+G SYR+ RDY RKR+R D            +R P  DS  + 
Sbjct  165  FQPNAPPQYDRGDRKRGYGDSYRNDRDYQRKRYRND-----------AQRAPDSDSKRDT  213

Query  279  R-PEKNPRFR  253
               EKNPRFR
Sbjct  214  NDSEKNPRFR  223


 Score =   135 bits (341),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF GTQEE+E AL  STTVYVGNMSFYTTEEQ YELF+RAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFSGTQEEYEAALQASTTVYVGNMSFYTTEEQAYELFTRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCF++
Sbjct  69   KNSKTPCGFCFIL  81



>gb|AIN39831.1| hypothetical protein [Zoysia matrella]
Length=241

 Score =   140 bits (353),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 92/129 (71%), Gaps = 16/129 (12%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQKELE QR+LVDYG    G+
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQKELETQRELVDYG----GS  163

Query  450  FPPVMAPQY---GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            F P   P Y    R+ G+G SYR+ RDY RKR+R DDR   + S    RR P  DS    
Sbjct  164  FQPNAPPPYERGERKRGYGDSYRNDRDYQRKRYRNDDRSTSEGS----RRAPDSDS----  215

Query  279  RPEKNPRFR  253
              EKNPRFR
Sbjct  216  -AEKNPRFR  223


 Score =   135 bits (340),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEE+E AL  STTVY+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    NKLSAYRDRRFPGTQEEYEAALQASTTVYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|NP_001147247.1| LOC100280855 [Zea mays]
 gb|ACG26349.1| nuclear cap-binding protein subunit 2 [Zea mays]
 gb|ACL53440.1| unknown [Zea mays]
 gb|AFW62949.1| nuclear cap-binding protein subunit 2 [Zea mays]
Length=242

 Score =   139 bits (350),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF+GTQEE+E ALL STT+Y+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFKGTQEEYEAALLASTTLYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81


 Score =   135 bits (339),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 90/130 (69%), Gaps = 17/130 (13%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+V +ELEAQR+LVDYG    G+
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVLRELEAQRELVDYG----GS  163

Query  450  FPPVMAPQYGRQG---GHGGSYRHGR-DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            F P   P Y R     GHG S+R+ R DY RKR+R DDR   + SKR    +P       
Sbjct  164  FQPNAPPPYERSERKRGHGDSHRNDRGDYQRKRYRNDDRSAPEESKRAPDSDPA------  217

Query  282  ARPEKNPRFR  253
               EKNPRFR
Sbjct  218  ---EKNPRFR  224



>gb|AFW62948.1| hypothetical protein ZEAMMB73_103683 [Zea mays]
Length=248

 Score =   139 bits (349),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF+GTQEE+E ALL STT+Y+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFKGTQEEYEAALLASTTLYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81


 Score =   134 bits (337),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 91/130 (70%), Gaps = 11/130 (8%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+V +ELEAQR+LVDYG    G+
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVLRELEAQRELVDYG----GS  163

Query  450  FPPVMAPQYGRQG---GHGGSYRHGR-DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            F P   P Y R     GHG S+R+ R DY RKR+R DDR   + SKR    +P   +   
Sbjct  164  FQPNAPPPYERSERKRGHGDSHRNDRGDYQRKRYRNDDRSAPEESKRAPDSDPAVLALF-  222

Query  282  ARPEKNPRFR  253
               EKNPRFR
Sbjct  223  --LEKNPRFR  230



>ref|XP_004953081.1| PREDICTED: nuclear cap-binding protein subunit 2-like isoform 
X4 [Setaria italica]
Length=242

 Score =   137 bits (345),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF GTQEE+E AL  STTVY+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFNGTQEEYEAALQASTTVYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81


 Score =   135 bits (341),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 91/130 (70%), Gaps = 17/130 (13%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQKELEAQR+LVDYG    G 
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQKELEAQRELVDYG----GA  163

Query  450  FPPVMAPQY---GRQGGHGGSYRHGR-DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            F P   P Y    R+ G+G SYR+ R DY RKR+R DDR   + S+R    +P       
Sbjct  164  FQPNAPPPYERGERKRGYGDSYRNDRGDYQRKRNRNDDRSAPEGSRRAPDSDPA------  217

Query  282  ARPEKNPRFR  253
               EKNPRFR
Sbjct  218  ---EKNPRFR  224



>ref|NP_001047412.1| Os02g0612300 [Oryza sativa Japonica Group]
 sp|Q84L14.1|NCBP2_ORYSJ RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Oryza sativa Japonica Group]
 gb|AAP33448.1| cap-binding protein CBP20 [Oryza sativa Japonica Group]
 dbj|BAD19690.1| cap-binding protein CBP20 [Oryza sativa Japonica Group]
 dbj|BAF09326.1| Os02g0612300 [Oryza sativa Japonica Group]
 dbj|BAG95116.1| unnamed protein product [Oryza sativa Japonica Group]
Length=243

 Score =   140 bits (353),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 93/129 (72%), Gaps = 14/129 (11%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQKELEAQR+LVDYG    G 
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQKELEAQRELVDYG----GA  163

Query  450  FPPVMAPQY---GRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEA  280
            F P   PQY    R+ G+G SYR+ RDY RKR+R D+R     S+R    E  RD+    
Sbjct  164  FQPNAPPQYDRGDRKRGYGDSYRNDRDYQRKRYRNDERS----SQRAPDSEFKRDA---I  216

Query  279  RPEKNPRFR  253
              EKNPRFR
Sbjct  217  DSEKNPRFR  225


 Score =   132 bits (332),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRRF GTQEE+E AL  S TVYVGNMSFYTTEEQ YELFSRAGEI+KI+MGLD
Sbjct  9    TKLSAYRDRRFTGTQEEYEAALQASVTVYVGNMSFYTTEEQAYELFSRAGEIRKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCF++
Sbjct  69   KNSKTPCGFCFIL  81



>ref|XP_004953080.1| PREDICTED: nuclear cap-binding protein subunit 2-like isoform 
X3 [Setaria italica]
Length=265

 Score =   137 bits (344),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF GTQEE+E AL  STTVY+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  32   SKLSAYRDRRFNGTQEEYEAALQASTTVYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  91

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  92   KNSKTPCGFCFVL  104


 Score =   135 bits (340),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 91/130 (70%), Gaps = 17/130 (13%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQKELEAQR+LVDYG    G 
Sbjct  131  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQKELEAQRELVDYG----GA  186

Query  450  FPPVMAPQY---GRQGGHGGSYRHGR-DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            F P   P Y    R+ G+G SYR+ R DY RKR+R DDR   + S+R    +P       
Sbjct  187  FQPNAPPPYERGERKRGYGDSYRNDRGDYQRKRNRNDDRSAPEGSRRAPDSDPA------  240

Query  282  ARPEKNPRFR  253
               EKNPRFR
Sbjct  241  ---EKNPRFR  247



>ref|XP_002454163.1| hypothetical protein SORBIDRAFT_04g025800 [Sorghum bicolor]
 gb|EES07139.1| hypothetical protein SORBIDRAFT_04g025800 [Sorghum bicolor]
Length=242

 Score =   137 bits (344),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF+GTQEE+E  LL STT+Y+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFKGTQEEYEATLLASTTLYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81


 Score =   135 bits (339),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 92/130 (71%), Gaps = 17/130 (13%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQ+ELEAQR+LVDYG    G+
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQRELEAQRELVDYG----GS  163

Query  450  FPPVMAPQY---GRQGGHGGSYRHGR-DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            F P   P Y    R+ G+G S+R+ R DY RKR+R DDR   + SKR    +P       
Sbjct  164  FQPNAPPPYERGERKRGYGDSHRNDRGDYQRKRYRNDDRSAPEESKRAPDSDPA------  217

Query  282  ARPEKNPRFR  253
               EKNPRFR
Sbjct  218  ---EKNPRFR  224



>gb|ACO90183.1| nuclear cap-binding protein 20 [Nicotiana tabacum]
Length=171

 Score =   141 bits (355),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF GTQEEFE+ALLK+TTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  9    AKISAYRDRRFPGTQEEFEDALLKATTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN +TPCGFCFV+
Sbjct  69   KNCKTPCGFCFVM  81


 Score =   127 bits (318),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGA  167

Query  450  FPPV  439
            +PPV
Sbjct  168  YPPV  171



>ref|XP_003575342.1| PREDICTED: nuclear cap-binding protein subunit 2 [Brachypodium 
distachyon]
Length=240

 Score =   134 bits (338),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF GTQEEFE ALL S TVYVGNMSFYTTEEQ YELF+RAGEIKKI+MGLD
Sbjct  9    SKLSVYRDRRFSGTQEEFEAALLASLTVYVGNMSFYTTEEQAYELFTRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81


 Score =   133 bits (334),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 86/129 (67%), Gaps = 17/129 (13%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQKELEAQR+LVDYG G   N
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQKELEAQRELVDYGVGFQTN  167

Query  450  FPPVMAPQYGRQG-GHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDS--DHEA  280
             P    PQY R     G S R+ RDY R+R   D          + RR P  DS  D   
Sbjct  168  AP----PQYDRADRKRGYSDRNDRDYQRRRSAPD----------MSRRAPDSDSRKDANQ  213

Query  279  RPEKNPRFR  253
             PEKNPRFR
Sbjct  214  EPEKNPRFR  222



>gb|ACA24134.1| cap-binding protein CBP20 [Lolium temulentum]
Length=231

 Score =   135 bits (341),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF GTQEEFE ALL S TVYVGNMSFY+TEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSVYRDRRFPGTQEEFEAALLASLTVYVGNMSFYSTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN+RTPCGFCFV+
Sbjct  69   KNTRTPCGFCFVL  81


 Score =   131 bits (330),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 85/129 (66%), Gaps = 17/129 (13%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQKELEAQR+LVDYG G   N
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQKELEAQRELVDYGVGFQTN  167

Query  450  FPPVMAPQYGRQG-GHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDS--DHEA  280
             P    PQ+ R     G S R+ RDY R+R   D            RR P  DS  D   
Sbjct  168  AP----PQFDRADRKRGYSDRNDRDYQRRRSGPD----------TSRRAPDSDSRRDANQ  213

Query  279  RPEKNPRFR  253
             PEKNPRFR
Sbjct  214  EPEKNPRFR  222



>ref|NP_001150096.1| LOC100283725 [Zea mays]
 gb|ACG37816.1| nuclear cap-binding protein subunit 2 [Zea mays]
Length=243

 Score =   133 bits (334),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAY+DRRF+GTQEE+E  L  STT+Y+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYKDRRFKGTQEEYEATLHASTTLYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81


 Score =   130 bits (328),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 92/131 (70%), Gaps = 18/131 (14%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQ+ELEAQR+LVDYG    G+
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQRELEAQRELVDYG----GS  163

Query  450  FPPVMAPQY---GRQGGHGGSYRHGR-DYYRKRHR-EDDRHRLDYSKRVYRREPVRDSDH  286
            F P   P Y    R+ G+G S+R+ R DY RKR+R  DDR   + SKR    +P      
Sbjct  164  FQPNAPPPYERGERKRGYGDSHRNDRGDYQRKRYRSSDDRSAPEESKRAPDSDPA-----  218

Query  285  EARPEKNPRFR  253
                EKNPRFR
Sbjct  219  ----EKNPRFR  225



>gb|ACL83596.1| CBP20 [Hordeum vulgare]
 dbj|BAJ86751.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=241

 Score =   134 bits (338),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF GTQEEFE ALL S TVYVGNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSVYRDRRFPGTQEEFEGALLASLTVYVGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCF++
Sbjct  69   KNTKTPCGFCFIL  81


 Score =   127 bits (319),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 87/126 (69%), Gaps = 10/126 (8%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQKELEAQR+LVDYG G   N
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQKELEAQRELVDYGVGFQTN  167

Query  450  FPPVMAPQYGRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEARPE  271
             PP    +  R+ G+G     G DY R+R         D ++R    +  RD++ E  PE
Sbjct  168  APPQF-DRADRKRGYGDRNDRG-DYQRRRSAP------DMARRATDSDSKRDANQE--PE  217

Query  270  KNPRFR  253
            KNPRFR
Sbjct  218  KNPRFR  223



>gb|AFW72309.1| hypothetical protein ZEAMMB73_547300, partial [Zea mays]
Length=215

 Score =   134 bits (337),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF+GTQEE+E  L  STT+Y+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFKGTQEEYEATLHASTTLYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81


 Score =   123 bits (308),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 83/109 (76%), Gaps = 9/109 (8%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQ+ELEAQR+LVDYG    G+
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQRELEAQRELVDYG----GS  163

Query  450  FPPVMAPQY---GRQGGHGGSYRHGR-DYYRKRHR-EDDRHRLDYSKRV  319
            F P   P Y    R+ G+G S+R+ R DY RKR+R  DDR   + SKR 
Sbjct  164  FQPNAPPPYERGERKRGYGDSHRNDRGDYQRKRYRSSDDRSAPEESKRA  212



>ref|XP_004953078.1| PREDICTED: nuclear cap-binding protein subunit 2-like isoform 
X1 [Setaria italica]
Length=338

 Score =   136 bits (342),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF GTQEE+E AL  STTVY+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  32   SKLSAYRDRRFNGTQEEYEAALQASTTVYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  91

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  92   KNSKTPCGFCFVL  104


 Score =   116 bits (290),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 68/86 (79%), Gaps = 7/86 (8%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQKELEAQR+LVDYG    G 
Sbjct  131  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQKELEAQRELVDYG----GA  186

Query  450  FPPVMAPQY---GRQGGHGGSYRHGR  382
            F P   P Y    R+ G+G SYR+ R
Sbjct  187  FQPNAPPPYERGERKRGYGDSYRNDR  212



>ref|XP_004953079.1| PREDICTED: nuclear cap-binding protein subunit 2-like isoform 
X2 [Setaria italica]
Length=315

 Score =   136 bits (342),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF GTQEE+E AL  STTVY+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFNGTQEEYEAALQASTTVYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81


 Score =   116 bits (290),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 68/86 (79%), Gaps = 7/86 (8%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQKELEAQR+LVDYG    G 
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQKELEAQRELVDYG----GA  163

Query  450  FPPVMAPQY---GRQGGHGGSYRHGR  382
            F P   P Y    R+ G+G SYR+ R
Sbjct  164  FQPNAPPPYERGERKRGYGDSYRNDR  189



>gb|ABR26569.1| cap-binding protein CPB20 [Lolium perenne]
Length=218

 Score =   134 bits (336),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF GTQEEFE ALL S TVYVGNMSFY+TEEQ YELFSRAGEIKKI+MGLD
Sbjct  3    SKLSVYRDRRFTGTQEEFEAALLASLTVYVGNMSFYSTEEQAYELFSRAGEIKKIIMGLD  62

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  63   KNTKTPCGFCFVL  75


 Score =   116 bits (291),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 84/129 (65%), Gaps = 17/129 (13%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPG GGYGK+VQKELEAQR+LVDYG G   N
Sbjct  102  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGGGGYGKMVQKELEAQRELVDYGVGFQTN  161

Query  450  FPPVMAPQYGRQG-GHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDS--DHEA  280
             P    PQ+ R     G + R+ RDY R+R   D            RR P  DS  D   
Sbjct  162  AP----PQFDRADRKRGYNDRNDRDYQRRRSGPD----------TSRRAPDSDSRRDANQ  207

Query  279  RPEKNPRFR  253
             PEKNPRFR
Sbjct  208  EPEKNPRFR  216



>gb|EYU22772.1| hypothetical protein MIMGU_mgv1a012251mg [Erythranthe guttata]
Length=216

 Score =   159 bits (401),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 107/136 (79%), Gaps = 14/136 (10%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYG GSLG+
Sbjct  68   DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGAGSLGS  127

Query  450  FPPVMAPQ-----YGRQGGHGGSYRHGR-DYYRKRHREDDRHRLDYSKR----VYRREPV  301
            F P++AP      +G   GHGG+ RHGR D+ RKR REDDR   D+++R    VYRR P 
Sbjct  128  FQPILAPTYGGGRHGGNYGHGGNNRHGRGDFPRKRQREDDRRGPDFTRRKSDFVYRRNP-  186

Query  300  RDSDHEARPEKNPRFR  253
               D+E RPEKNPRFR
Sbjct  187  ---DNEPRPEKNPRFR  199


 Score = 84.7 bits (208),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  821  MSFYTTEEQVYELFSRAGEIKKIVMGLDKNSRTPCGFCFVI  699
            MSFYTTEEQVYELF+RAGEIKKIVMGLDKN +TPCGFCF++
Sbjct  1    MSFYTTEEQVYELFTRAGEIKKIVMGLDKNGKTPCGFCFIM  41



>ref|XP_010112771.1| Nuclear cap-binding protein subunit 2 [Morus notabilis]
 gb|EXC34886.1| Nuclear cap-binding protein subunit 2 [Morus notabilis]
Length=213

 Score =   137 bits (346),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF G+QEEFE+ALL ST VY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  49   SKLSVYRDRRFPGSQEEFEQALLASTIVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  108

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  109  KNSKTPCGFCFVL  121


 Score =   101 bits (251),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 55/72 (76%), Gaps = 9/72 (13%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDE         GGYGKLVQ+ELEAQRQLVDYG GSLG+
Sbjct  148  DFDWGFQEGRQWGRGRSGGQVRDE---------GGYGKLVQRELEAQRQLVDYGAGSLGS  198

Query  450  FPPVMAPQYGRQ  415
            F PVM P    Q
Sbjct  199  FLPVMPPHCKLQ  210



>gb|ABK25999.1| unknown [Picea sitchensis]
Length=235

 Score =   131 bits (330),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            ISAYRDRRF GTQEEFE AL  S TVYVGN+SFYTTEEQVYELFSRAGE+KK++MGLDKN
Sbjct  11   ISAYRDRRFNGTQEEFEHALRTSITVYVGNLSFYTTEEQVYELFSRAGEVKKLIMGLDKN  70

Query  731  SRTPCGFCFVI  699
            ++TPCGFCFV+
Sbjct  71   TKTPCGFCFVL  81


 Score = 97.1 bits (240),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 85/128 (66%), Gaps = 15/128 (12%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVD-YGTGSLG  454
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP RGG+GK+VQK+LE  R  ++  G+   G
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPARGGFGKVVQKDLEVHRPPIEPVGSFHSG  167

Query  453  NFPPVMAPQYGRQGGHGGSYRHGRDYYRKRHR-EDDRHRLDYSKRVYRREPVRDSDHEAR  277
            +         G  GGHGGS+RHGR+  RKR+R EDDR   D SKR             +R
Sbjct  168  SSNSHYGGHGGGYGGHGGSHRHGRESGRKRYRSEDDRPPTDVSKR-------------SR  214

Query  276  PEKNPRFR  253
             EKNPRFR
Sbjct  215  QEKNPRFR  222



>ref|XP_010260317.1| PREDICTED: nuclear cap-binding protein subunit 2 [Nelumbo nucifera]
 ref|XP_010260318.1| PREDICTED: nuclear cap-binding protein subunit 2 [Nelumbo nucifera]
 ref|XP_010260319.1| PREDICTED: nuclear cap-binding protein subunit 2 [Nelumbo nucifera]
 ref|XP_010260320.1| PREDICTED: nuclear cap-binding protein subunit 2 [Nelumbo nucifera]
Length=252

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 106/128 (83%), Gaps = 2/128 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELEAQRQLVDYG GSLG 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEAQRQLVDYGAGSLGA  167

Query  450  FPPVMAPQYG--RQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEAR  277
            FPPVM   Y      GHGGS+RHGRDY+RKR+REDDRH  D SKR    E  R SDHE+R
Sbjct  168  FPPVMPSHYARHGGQGHGGSHRHGRDYHRKRYREDDRHASDVSKRSSDHESRRASDHESR  227

Query  276  PEKNPRFR  253
            PEKNPRFR
Sbjct  228  PEKNPRFR  235


 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 87/126 (69%), Gaps = 15/126 (12%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF G+QEEFE AL  STTVYVGNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFPGSQEEFEHALQTSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI--GKGTRE---------VLKDEQVITNFK*FSYQILIGVSW-KADSG  594
            KN++TPCGFCFVI   +G  E         +L D  +  +   F +    G  W +  SG
Sbjct  69   KNTKTPCGFCFVIYYSRGDAEDTVKYVSGTILDDRPIRVD---FDWGFQEGRQWGRGRSG  125

Query  593  VAVKVE  576
              V+ E
Sbjct  126  GQVRDE  131



>gb|ACG49204.1| nuclear cap-binding protein subunit 2 [Zea mays]
 gb|AFW62945.1| nuclear cap-binding protein subunit 2 [Zea mays]
Length=202

 Score =   134 bits (337),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 90/130 (69%), Gaps = 17/130 (13%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+V +ELEAQR+LVDYG    G+
Sbjct  68   DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVLRELEAQRELVDYG----GS  123

Query  450  FPPVMAPQYGRQG---GHGGSYRHGR-DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            F P   P Y R     GHG S+R+ R DY RKR+R DDR   + SKR    +P       
Sbjct  124  FQPNAPPPYERSERKRGHGDSHRNDRGDYQRKRYRNDDRSAPEESKRAPDSDPA------  177

Query  282  ARPEKNPRFR  253
               EKNPRFR
Sbjct  178  ---EKNPRFR  184


 Score = 86.7 bits (213),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 40/41 (98%), Gaps = 0/41 (0%)
 Frame = -2

Query  821  MSFYTTEEQVYELFSRAGEIKKIVMGLDKNSRTPCGFCFVI  699
            MSFYTTEEQ YELFSRAGEIKKI+MGLDKNS+TPCGFCFV+
Sbjct  1    MSFYTTEEQAYELFSRAGEIKKIIMGLDKNSKTPCGFCFVL  41



>gb|AAT07459.1| cap-binding protein [Mirabilis jalapa]
Length=147

 Score =   136 bits (342),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF G QEEFEEAL KSTT+Y+GNMSFYTTEEQVYELFSR GEIKKI MGLD
Sbjct  9    TKISAYRDRRFPGNQEEFEEALKKSTTLYIGNMSFYTTEEQVYELFSRVGEIKKITMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81


 Score = 83.6 bits (205),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLV  511
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLV
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLV  147



>ref|XP_010694058.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Beta vulgaris 
subsp. vulgaris]
Length=155

 Score =   128 bits (322),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDRR  G+QEEFEEAL  STTVY+GNMSFYTTEEQ YELFSR GEIKK+ MGLD
Sbjct  9    NKLSAYRDRRLTGSQEEFEEALKSSTTVYIGNMSFYTTEEQDYELFSRVGEIKKMTMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81


 Score = 90.5 bits (223),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQ  490
            DFD GF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGKLVQ+ELE Q
Sbjct  108  DFDCGFQEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKLVQRELEVQ  154



>ref|XP_009774544.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Nicotiana 
sylvestris]
Length=197

 Score =   144 bits (362),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 68/73 (93%), Positives = 72/73 (99%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF GTQEEFE+ALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  62   AKISAYRDRRFSGTQEEFEDALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  121

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  122  KNSKTPCGFCFVM  134


 Score = 66.2 bits (160),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP
Sbjct  161  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDP  191



>gb|KCW47250.1| hypothetical protein EUGRSUZ_K01050 [Eucalyptus grandis]
Length=255

 Score =   139 bits (350),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +K+SAYRDR+F GTQEEFE+ALL STTVY+GNMSFYTTEEQVYELFSRAGE+KKI+MGLD
Sbjct  118  NKLSAYRDRKFSGTQEEFEQALLSSTTVYIGNMSFYTTEEQVYELFSRAGELKKIIMGLD  177

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  178  KNSKTPCGFCFVL  190


 Score = 67.4 bits (163),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP
Sbjct  217  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDP  247



>gb|KDO43068.1| hypothetical protein CISIN_1g037453mg, partial [Citrus sinensis]
Length=216

 Score =   140 bits (352),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            K+SAYRDRRF GTQEEFEEALL STTVYVGNMSFYTTEEQ+YELFSRAGEIKKI+MGLDK
Sbjct  42   KLSAYRDRRFPGTQEEFEEALLASTTVYVGNMSFYTTEEQIYELFSRAGEIKKIIMGLDK  101

Query  734  NSRTPCGFCFVI  699
            NS+TPCGFCF +
Sbjct  102  NSKTPCGFCFAL  113


 Score = 65.9 bits (159),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDP
Sbjct  140  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDP  170



>gb|KHN36662.1| Nuclear cap-binding protein subunit 2 [Glycine soja]
Length=144

 Score =   138 bits (347),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SKISAYRDRRF GTQEEFE AL+ STTVYVGNMSFYTTEEQVYELFSR GEIKKI+MGLD
Sbjct  9    SKISAYRDRRFPGTQEEFEHALVTSTTVYVGNMSFYTTEEQVYELFSRTGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81


 Score = 66.6 bits (161),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDP  138



>emb|CDP10731.1| unnamed protein product [Coffea canephora]
Length=163

 Score =   140 bits (352),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF G+QEEFE+ALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIK+IVMGLD
Sbjct  9    SKLSQYRDRRFTGSQEEFEQALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKRIVMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVM  81


 Score = 64.7 bits (156),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYD 
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDA  138



>gb|ACN28303.1| unknown [Zea mays]
 gb|AFW62947.1| hypothetical protein ZEAMMB73_103683 [Zea mays]
Length=141

 Score =   138 bits (347),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF+GTQEE+E ALL STT+Y+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFKGTQEEYEAALLASTTLYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81


 Score = 66.2 bits (160),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDP  138



>gb|KHN27908.1| Nuclear cap-binding protein subunit 2 [Glycine soja]
Length=258

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 101/134 (75%), Gaps = 8/134 (6%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPG-----RGGYGKLVQKELEAQRQLVDYGT  466
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDP        GYGKLVQKELE QRQLVDYGT
Sbjct  108  DFDWGFQDGRQWGRGRSGGQVRDEYRTDYDPDILLIVECGYGKLVQKELEVQRQLVDYGT  167

Query  465  GSLGNFPPVMAPQYGRQGGHGGSYRHGR---DYYRKRHREDDRHRLDYSKRVYRREPVRD  295
            GSLG+FPPV+   YGR GG  G     R   DYYRKRHR+DDRH  + SKR    E  R+
Sbjct  168  GSLGSFPPVIPTSYGRHGGGHGHGGSHRHGRDYYRKRHRDDDRHIHESSKRNSDHESRRN  227

Query  294  SDHEARPEKNPRFR  253
            +DHE+RPEKNPRFR
Sbjct  228  TDHESRPEKNPRFR  241


 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 93/139 (67%), Gaps = 17/139 (12%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SKISAYRDRRF GTQEEFE ALL STTVYVGNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKISAYRDRRFPGTQEEFEHALLTSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVIGKGTRE-----------VLKDEQVITNFK*FSYQILIGVSW-KADSG  594
            KN++TPCGFCFV+     +           +L D  +  +   F +    G  W +  SG
Sbjct  69   KNTKTPCGFCFVLYYSREDTEDVCKYISGTILDDRPIRVD---FDWGFQDGRQWGRGRSG  125

Query  593  VAVKVEDK--YAMNIALIM  543
              V+ E +  Y  +I LI+
Sbjct  126  GQVRDEYRTDYDPDILLIV  144



>emb|CBI21896.3| unnamed protein product [Vitis vinifera]
Length=144

 Score =   137 bits (345),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRD+RF GTQE+FE ALL S TVY+GNMSFYTTEEQVYELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDKRFPGTQEDFEHALLTSMTVYIGNMSFYTTEEQVYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81


 Score = 66.6 bits (161),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP
Sbjct  108  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDP  138



>gb|KDD72944.1| hypothetical protein H632_c2705p0 [Helicosporidium sp. ATCC 50920]
Length=171

 Score =   121 bits (303),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            IS YRDRRF GTQEEFE  L  STT+YVGN+SFYTTE Q+YE+FSRAG+IK+IVMGLDK 
Sbjct  11   ISQYRDRRFHGTQEEFERCLAASTTIYVGNLSFYTTEHQIYEVFSRAGDIKRIVMGLDKQ  70

Query  731  SRTPCGFCFVI  699
              TPCGFCFV+
Sbjct  71   KLTPCGFCFVV  81


 Score = 80.1 bits (196),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLV  478
             DFDWGF EGRQ+GRG+SGGQVRDEYR DYD GRGGYG L++ EL A++ L+
Sbjct  107  ADFDWGFQEGRQFGRGRSGGQVRDEYRMDYDSGRGGYGNLLRGELIARQNLM  158



>gb|EMS64515.1| Nuclear cap-binding protein subunit 2 [Triticum urartu]
Length=141

 Score =   135 bits (339),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF GTQEEFE ALL S TVYVGNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSVYRDRRFPGTQEEFEAALLASLTVYVGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81


 Score = 66.2 bits (160),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP
Sbjct  108  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDP  138



>gb|EPS58818.1| hypothetical protein M569_15995, partial [Genlisea aurea]
Length=145

 Score =   134 bits (336),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF GTQEE++EAL  STT+YVGNMSFYTTEEQVYELFSRAGEIKK++MGLD
Sbjct  16   SKLSAYRDRRFSGTQEEYDEALQNSTTLYVGNMSFYTTEEQVYELFSRAGEIKKLIMGLD  75

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCF +
Sbjct  76   KNTKTPCGFCFAL  88


 Score = 67.0 bits (162),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP
Sbjct  115  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDP  145



>ref|XP_006838981.1| hypothetical protein AMTR_s00002p00271460 [Amborella trichopoda]
 gb|ERN01550.1| hypothetical protein AMTR_s00002p00271460 [Amborella trichopoda]
Length=166

 Score =   130 bits (326),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAY+DR+F G QEEFE AL  STTVYVGN SFYTTEEQVYELF+RAGEIKKI+MGLD
Sbjct  34   SKLSAYKDRKFPGNQEEFEHALQVSTTVYVGNTSFYTTEEQVYELFARAGEIKKIIMGLD  93

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  94   KNTKTPCGFCFVV  106


 Score = 67.0 bits (162),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP
Sbjct  133  DFDWGFQEGRQWGRGRSGGQVRDEYRTDYDP  163



>ref|XP_011398229.1| Nuclear cap-binding protein subunit 2 [Auxenochlorella protothecoides]
 gb|KFM25336.1| Nuclear cap-binding protein subunit 2 [Auxenochlorella protothecoides]
Length=189

 Score =   117 bits (292),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  908  SAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNS  729
            + YRDRRF GTQEEFEE L +STTVYVGN+SF+TTEEQ+YE+FS+ G+IK+I+MGLD+  
Sbjct  13   AQYRDRRFNGTQEEFEEVLRQSTTVYVGNLSFFTTEEQIYEVFSKTGDIKRIIMGLDRQK  72

Query  728  RTPCGFCFVI  699
             TPCGFCFVI
Sbjct  73   MTPCGFCFVI  82


 Score = 79.0 bits (193),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSL  457
            DFDWGF +GRQ+GRG+SGGQVRDEYR DYD GRGGYG +++ EL A++Q++   +G +
Sbjct  109  DFDWGFRDGRQFGRGRSGGQVRDEYRMDYDSGRGGYGTVLRGELSARQQMLSMLSGGM  166



>ref|XP_009787371.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Nicotiana 
sylvestris]
Length=204

 Score =   145 bits (365),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/73 (93%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDR F GTQEEFE+ALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD
Sbjct  27   AKISAYRDRSFPGTQEEFEDALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  86

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFVI
Sbjct  87   KNSKTPCGFCFVI  99


 Score = 46.2 bits (108),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 30/63 (48%), Gaps = 11/63 (17%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGR WGRG+SGGQ                  L+  EL   R +  +    LG+
Sbjct  126  DFDWGFQEGRYWGRGRSGGQ-----------AISSVVILIVIELSTPRLVHQHLVVFLGS  174

Query  450  FPP  442
             PP
Sbjct  175  MPP  177



>ref|XP_002989180.1| hypothetical protein SELMODRAFT_129288 [Selaginella moellendorffii]
 gb|EFJ09774.1| hypothetical protein SELMODRAFT_129288 [Selaginella moellendorffii]
Length=159

 Score =   125 bits (314),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            +ISAY+DRRF GTQ E+EEAL  S TVYVGN+SFYTTEEQ+YELFSR GEIK+IVMGLDK
Sbjct  10   EISAYKDRRFAGTQVEYEEALQTSVTVYVGNLSFYTTEEQLYELFSRCGEIKRIVMGLDK  69

Query  734  NSRTPCGFCFVI  699
            N++TPCGFCF+I
Sbjct  70   NNKTPCGFCFII  81


 Score = 65.1 bits (157),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDP
Sbjct  108  DFDWGFEDGRQWGRGRSGGQVRDEYRTDYDP  138



>ref|XP_002987302.1| hypothetical protein SELMODRAFT_125790 [Selaginella moellendorffii]
 gb|EFJ11617.1| hypothetical protein SELMODRAFT_125790 [Selaginella moellendorffii]
Length=159

 Score =   125 bits (314),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            +ISAY+DRRF GTQ E+EEAL  S TVYVGN+SFYTTEEQ+YELFSR GEIK+IVMGLDK
Sbjct  10   EISAYKDRRFAGTQVEYEEALQTSVTVYVGNLSFYTTEEQLYELFSRCGEIKRIVMGLDK  69

Query  734  NSRTPCGFCFVI  699
            N++TPCGFCF+I
Sbjct  70   NNKTPCGFCFII  81


 Score = 65.1 bits (157),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF +GRQWGRG+SGGQVRDEYRTDYDP
Sbjct  108  DFDWGFEDGRQWGRGRSGGQVRDEYRTDYDP  138



>ref|XP_005646121.1| cap-binding protein, partial [Coccomyxa subellipsoidea C-169]
 gb|EIE21577.1| cap-binding protein, partial [Coccomyxa subellipsoidea C-169]
Length=145

 Score =   118 bits (295),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            IS YRDRRF GTQE+FE+ L +STT+YVGN+SFYTTEEQ+YE+FSRAG+IK+I+MGLDKN
Sbjct  1    ISQYRDRRFVGTQEDFEKCLRESTTLYVGNLSFYTTEEQIYEVFSRAGDIKRIIMGLDKN  60

Query  731  SRTPCGFCFVI  699
              TPCGF FV+
Sbjct  61   QLTPCGFAFVV  71


 Score = 71.2 bits (173),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 4/48 (8%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQ----VRDEYRTDYDPGRGGYGKLVQKEL  499
            DFDWGF EGRQ+GRG+SGGQ    VRDEYRTD+D GRGGYG +V++EL
Sbjct  98   DFDWGFKEGRQFGRGRSGGQARPLVRDEYRTDWDAGRGGYGNIVKQEL  145



>ref|XP_005846487.1| hypothetical protein CHLNCDRAFT_14225, partial [Chlorella variabilis]
 gb|EFN54385.1| hypothetical protein CHLNCDRAFT_14225, partial [Chlorella variabilis]
Length=148

 Score =   113 bits (282),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            IS Y+DRRF GTQ+EFEE L  STTVYVGN+SF+TTE+Q++E+FS+ G++K+IVMGLDK+
Sbjct  12   ISQYKDRRFCGTQQEFEECLHTSTTVYVGNLSFFTTEDQIFEVFSKVGDVKRIVMGLDKH  71

Query  731  SRTPCGFCFVI  699
              TPCGFCFV+
Sbjct  72   RSTPCGFCFVV  82


 Score = 72.0 bits (175),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLV  511
            DFDWGF+EGRQ+GRG+SGGQVRDEYR D+D GRGGYG ++
Sbjct  109  DFDWGFVEGRQFGRGRSGGQVRDEYRMDFDSGRGGYGSIL  148



>ref|XP_002946588.1| hypothetical protein VOLCADRAFT_79141 [Volvox carteri f. nagariensis]
 gb|EFJ52515.1| hypothetical protein VOLCADRAFT_79141 [Volvox carteri f. nagariensis]
Length=284

 Score =   102 bits (255),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            I+ YRDRRF+G++ ++E AL  STT+YVGN++F T EEQ+Y++F R G IK+IVMGLDK 
Sbjct  8    ITQYRDRRFEGSETDWENALATSTTIYVGNLAFTTREEQLYDVFGRVGHIKRIVMGLDKI  67

Query  731  SRTPCGFCFVI  699
             RTPCGF F I
Sbjct  68   QRTPCGFAFAI  78


 Score = 81.6 bits (200),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQL-VDYGTGSLG  454
            D DWGF+EGRQ+GRG+SGGQVRDE+R DYDPGRGGYGKL+Q E+  Q  + +D G GS  
Sbjct  105  DLDWGFVEGRQYGRGRSGGQVRDEFRQDYDPGRGGYGKLMQAEMMEQMGIGMDAGGGSRQ  164

Query  453  NF  448
            +F
Sbjct  165  DF  166



>ref|XP_005178552.2| PREDICTED: nuclear cap-binding protein subunit 2B [Musca domestica]
Length=154

 Score =   107 bits (268),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E E +L +STT+YVGNMSFYTTEEQ++ELFSR GE+++I+MGLDK
Sbjct  7    ELSSYRDQHFKGSRSEQERSLKESTTLYVGNMSFYTTEEQIHELFSRCGEVRRIIMGLDK  66

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  67   YKKTPCGFCFV  77


 Score = 75.9 bits (185),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEA  493
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+ ++LE 
Sbjct  105  DWDAGFVEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKLEI  150



>gb|ELT96352.1| hypothetical protein CAPTEDRAFT_149941 [Capitella teleta]
Length=154

 Score =   108 bits (270),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            + +SAYRD+ F+G + E E+ALL STT+Y+GN+SF+T EEQ++ELFSRAG++K+I+MGLD
Sbjct  10   AALSAYRDQHFRGNRIEQEKALLTSTTLYIGNLSFFTAEEQIHELFSRAGDVKRIIMGLD  69

Query  737  KNSRTPCGFCFV  702
            K  +TPCGFCFV
Sbjct  70   KYRKTPCGFCFV  81


 Score = 74.3 bits (181),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEA  493
             D+D GF EGRQ+GRGKSGGQVRDEYRTD+D GRGGYGK++Q+++  
Sbjct  108  TDWDAGFKEGRQYGRGKSGGQVRDEYRTDFDTGRGGYGKMIQQKITT  154



>gb|AFW62946.1| hypothetical protein ZEAMMB73_103683 [Zea mays]
Length=92

 Score =   138 bits (347),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF+GTQEE+E ALL STT+Y+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFKGTQEEYEAALLASTTLYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVL  81



>ref|XP_004335873.1| RNA recognition domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR13860.1| RNA recognition domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=244

 Score =   107 bits (267),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            ++ S Y+D RF+G+QE+++  L KSTT YVGN+SFYTTEEQ+Y LFS+ GEIK+I+MGLD
Sbjct  9    AQQSTYKDVRFEGSQEDWDALLNKSTTFYVGNLSFYTTEEQIYALFSKCGEIKRIIMGLD  68

Query  737  KNSRTPCGFCFV  702
            + S+TPCGFCFV
Sbjct  69   RVSKTPCGFCFV  80


 Score = 74.3 bits (181),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 67/125 (54%), Gaps = 7/125 (6%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            D+D GF E RQ+GRGKSGGQVRDEYRTDYDPGRGGYGK  Q+  E  RQL      +   
Sbjct  108  DWDIGFKELRQYGRGKSGGQVRDEYRTDYDPGRGGYGKQTQR--EETRQLQTPFLHATTA  165

Query  450  FPPVMAPQYGRQGGHGGSYRHGRDYYRKRHREDDRHRLDYSKRVYRREPVRDSDHEARPE  271
            + P   P     G      R  +D  R+  R   R R +  +    +  V+    E R E
Sbjct  166  YDPNSLPAQSESGASPYKPRDDKD--REPDRGTKRRRYEEEEEPKGQPLVK---REEREE  220

Query  270  KNPRF  256
            KNPRF
Sbjct  221  KNPRF  225



>ref|XP_009594973.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Nicotiana 
tomentosiformis]
Length=115

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +KISAYRDRRF GTQEEFE+ALLK TTVYVGNMSFYTTEEQVYELFSRAGEIKKIVM  D
Sbjct  9    AKISAYRDRRFPGTQEEFEDALLKLTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMEQD  68

Query  737  KNSRTPCGFCFVI  699
            KNS+TPCGFCFV+
Sbjct  69   KNSKTPCGFCFVM  81



>ref|XP_011176485.1| PREDICTED: nuclear cap-binding protein subunit 2 [Bactrocera 
cucurbitae]
Length=155

 Score =   104 bits (260),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S+YRD+ F+G++ E E +L +S T+YVGN+SFYTTEEQ++ELFSR GE+++IVMGLDK 
Sbjct  8    LSSYRDQHFKGSRSEQERSLRESCTLYVGNLSFYTTEEQIHELFSRCGEVRRIVMGLDKY  67

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  68   KKTPCGFCFV  77


 Score = 75.1 bits (183),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+Q+++
Sbjct  105  DWDAGFIEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLQQKI  148



>gb|ACN34918.1| unknown [Zea mays]
 gb|AFW62950.1| hypothetical protein ZEAMMB73_103683 [Zea mays]
Length=273

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 71/74 (96%), Gaps = 0/74 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+SAYRDRRF+GTQEE+E ALL STT+Y+GNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSAYRDRRFKGTQEEYEAALLASTTLYIGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVIG  696
            KNS+TPCGFCFV+G
Sbjct  69   KNSKTPCGFCFVLG  82


 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 90/130 (69%), Gaps = 17/130 (13%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+V +ELEAQR+LVDYG    G+
Sbjct  139  DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVLRELEAQRELVDYG----GS  194

Query  450  FPPVMAPQYGRQG---GHGGSYRHGR-DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            F P   P Y R     GHG S+R+ R DY RKR+R DDR   + SKR    +P       
Sbjct  195  FQPNAPPPYERSERKRGHGDSHRNDRGDYQRKRYRNDDRSAPEESKRAPDSDPA------  248

Query  282  ARPEKNPRFR  253
               EKNPRFR
Sbjct  249  ---EKNPRFR  255



>ref|XP_004518120.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Ceratitis 
capitata]
Length=155

 Score =   104 bits (260),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S+YRD+ F+G++ E E +L  S T+YVGN+SFYTTEEQ++ELFSR GE+++IVMGLDK 
Sbjct  8    LSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELFSRCGEVRRIVMGLDKY  67

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  68   KKTPCGFCFV  77


 Score = 75.1 bits (183),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+Q+++
Sbjct  105  DWDAGFIEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLQQKI  148



>ref|XP_002166119.2| PREDICTED: nuclear cap-binding protein subunit 2-like [Hydra 
vulgaris]
Length=169

 Score =   107 bits (268),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +SAYRD+ F+GT+ E E  L  STT+YVGN+SFYT+EEQ+YELFS++G++K+I+MGLD+ 
Sbjct  14   LSAYRDQHFKGTRAELERKLETSTTLYVGNLSFYTSEEQIYELFSKSGDVKRIIMGLDRV  73

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  74   KKTPCGFCFV  83


 Score = 71.6 bits (174),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF EGRQ+GRG+SGGQVRDEYR DYDPGRGGYGKL Q
Sbjct  110  SDWDAGFEEGRQYGRGRSGGQVRDEYRNDYDPGRGGYGKLAQ  151



>ref|XP_009031866.1| hypothetical protein HELRODRAFT_91084 [Helobdella robusta]
 gb|ESN89998.1| hypothetical protein HELRODRAFT_91084 [Helobdella robusta]
Length=162

 Score =   105 bits (261),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G + E EE LL S+T+Y+GN+SFYT EEQ++ELFS+AG++K+I+MGLDK
Sbjct  20   ELSSYRDQHFKGNRHEQEEKLLISSTLYIGNLSFYTCEEQIHELFSQAGDVKRIIMGLDK  79

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  80   FKKTPCGFCFV  90


 Score = 74.3 bits (181),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF+EGRQ+GRGKSGGQVRDEYR DYD GRGGYGKLVQ+ +
Sbjct  117  TDWDAGFIEGRQFGRGKSGGQVRDEYRNDYDDGRGGYGKLVQQRI  161



>ref|XP_011208204.1| PREDICTED: nuclear cap-binding protein subunit 2 [Bactrocera 
dorsalis]
Length=155

 Score =   103 bits (258),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S+YRD+ F+G++ + E +L +S T+YVGN+SFYTTEEQ++ELFSR GE+++IVMGLDK 
Sbjct  8    LSSYRDQHFKGSRSDQERSLRESCTLYVGNLSFYTTEEQIHELFSRCGEVRRIVMGLDKY  67

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  68   KKTPCGFCFV  77


 Score = 75.1 bits (183),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+Q+++
Sbjct  105  DWDAGFIEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLQQKI  148



>ref|XP_011421116.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Crassostrea 
gigas]
 gb|EKC37293.1| Nuclear cap-binding protein subunit 2 [Crassostrea gigas]
Length=162

 Score =   106 bits (265),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +SAYRD+ F+G++ E E+ALL S+T+YVGN+S+YTTEEQ++ELF + G+IK+IVMGLDK 
Sbjct  15   LSAYRDQHFKGSRTEQEKALLTSSTLYVGNLSYYTTEEQIHELFGKCGDIKRIVMGLDKV  74

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  75   KKTPCGFCFV  84


 Score = 72.0 bits (175),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQR  487
             D+D GF EGRQ+GRGKSGGQVRDEYRTDYD GRGGYGK++  ++   R
Sbjct  111  TDWDHGFKEGRQYGRGKSGGQVRDEYRTDYDEGRGGYGKIIATKITQSR  159



>ref|XP_010622332.1| PREDICTED: nuclear cap-binding protein subunit 2 [Fukomys damarensis]
Length=166

 Score =   105 bits (261),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK 
Sbjct  17   LSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKM  76

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  77   KKTACGFCFV  86


 Score = 73.6 bits (179),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQL  481
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK++   R L
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQKQVMTPRCL  163



>gb|EFA03363.1| hypothetical protein TcasGA2_TC013348 [Tribolium castaneum]
Length=161

 Score =   103 bits (258),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+GT+ E +  L  STT+YVGN+SFYTTEEQ+YELFS+ G+I+++VMGLDK
Sbjct  10   ELSSYRDQHFKGTRAEQDRLLRLSTTLYVGNLSFYTTEEQIYELFSKCGDIRRVVMGLDK  69

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  70   YKKTPCGFCFV  80


 Score = 74.7 bits (182),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGK++Q+++
Sbjct  107  TDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDSGRGGYGKIIQQKM  151



>ref|XP_002160076.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Hydra 
vulgaris]
Length=160

 Score =   107 bits (266),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +SAYRD+ F+GT+ + E+ L  STT+YVGN+SFYT+EEQ+YELFS++G+IK+I+MGLD+ 
Sbjct  5    LSAYRDQHFKGTRADLEKKLETSTTLYVGNLSFYTSEEQIYELFSKSGDIKRIIMGLDRI  64

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  65   KKTPCGFCFV  74


 Score = 71.6 bits (174),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D GF EGRQ+GRG+SGGQVRDEYR DYDPGRGGYGKL Q+
Sbjct  101  SDWDAGFEEGRQYGRGRSGGQVRDEYRNDYDPGRGGYGKLAQE  143



>ref|XP_003745498.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Metaseiulus 
occidentalis]
Length=152

 Score =   102 bits (254),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +SAYRD+ F+G++ E E  L  STT+YVGN+SFYTTEEQ++ELF R G++K+++MGLD+ 
Sbjct  8    LSAYRDQHFKGSRAEQERLLRTSTTLYVGNLSFYTTEEQIFELFDRCGDVKRVIMGLDRF  67

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  68   QKTPCGFCFV  77


 Score = 75.9 bits (185),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQ  490
             D+D GF+EGRQ+GRGKSGGQVRDEYR D+D GRGGYGKL+Q+++EA 
Sbjct  104  TDWDAGFIEGRQYGRGKSGGQVRDEYRNDFDSGRGGYGKLLQQKVEAN  151



>gb|EDK97761.1| nuclear cap binding protein subunit 2, isoform CRA_b [Mus musculus]
Length=200

 Score =   105 bits (262),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSEYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 72.4 bits (176),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 48/71 (68%), Gaps = 8/71 (11%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK-ELEAQRQLVDYGTGSL  457
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK   EA +      T S 
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYREDYDAGRGGYGKLAQKHTTEAMK------TSSP  166

Query  456  GNF-PPVMAPQ  427
            G+  PP  A +
Sbjct  167  GSIQPPAAATE  177



>gb|ENN74806.1| hypothetical protein YQE_08579, partial [Dendroctonus ponderosae]
 gb|ERL91700.1| hypothetical protein D910_09027 [Dendroctonus ponderosae]
Length=159

 Score =   102 bits (253),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S+YRD+ F+GT+ E ++ L  S+T YVGN+SFYTTEEQ+YELFS+ G++K+I+MGLDK 
Sbjct  10   LSSYRDQHFKGTRAEQDKLLRVSSTFYVGNLSFYTTEEQIYELFSKCGDVKRIIMGLDKY  69

Query  731  SRTPCGFCFV  702
             +TPCGFCF+
Sbjct  70   KKTPCGFCFI  79


 Score = 76.3 bits (186),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+Q+++
Sbjct  106  TDWDAGFIEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLIQQKI  150



>ref|XP_001690572.1| hypothetical protein CHLREDRAFT_169371 [Chlamydomonas reinhardtii]
 gb|EDP05831.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=156

 Score =   103 bits (258),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            I+ YRDRRF+GT+ ++E AL  STTVYVGN++F T EEQ+Y++F R G IK+IVMGLDK 
Sbjct  21   ITQYRDRRFEGTEADWEHALTSSTTVYVGNLAFTTREEQLYDVFGRVGHIKRIVMGLDKV  80

Query  731  SRTPCGFCFVI  699
             +TPCGF F I
Sbjct  81   QKTPCGFAFAI  91


 Score = 74.3 bits (181),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKL  514
            D DWGF+EGRQ+GRG+SGGQVRDE+R DYDPGRGGYGKL
Sbjct  118  DLDWGFVEGRQYGRGRSGGQVRDEFRQDYDPGRGGYGKL  156



>ref|XP_001954395.1| GF16759 [Drosophila ananassae]
 sp|B3LYP1.1|NCBP2_DROAN RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Drosophila ananassae]
 gb|EDV42956.1| GF16759 [Drosophila ananassae]
Length=154

 Score =   104 bits (259),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S+YRD+ F+G++ E E +L  STT+YVGN+SFYTTEEQ++ELFSR G+++ IVMGLDK 
Sbjct  7    LSSYRDQHFKGSRSEQERSLRDSTTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDKY  66

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  67   KKTPCGFCFV  76


 Score = 73.6 bits (179),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+ +++
Sbjct  104  DWDAGFIEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKI  147



>ref|XP_001632015.1| predicted protein [Nematostella vectensis]
 gb|EDO39952.1| predicted protein [Nematostella vectensis]
Length=157

 Score =   109 bits (273),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            + +SAYRD+ F+GT++E E  L  S+T+YVGN+SFYT+E+Q+YELF RAGE+KKI+MGLD
Sbjct  2    ADLSAYRDQHFRGTRQELESRLETSSTLYVGNLSFYTSEQQIYELFGRAGELKKIIMGLD  61

Query  737  KNSRTPCGFCFV  702
            K  +TPCGFCFV
Sbjct  62   KVRKTPCGFCFV  73


 Score = 68.2 bits (165),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGK  517
             D+D GF EGRQ+GRGK+GGQVRDEYRTDYDPGRGG+ K
Sbjct  100  TDYDAGFEEGRQYGRGKTGGQVRDEYRTDYDPGRGGFSK  138



>ref|XP_001994622.1| GH15101 [Drosophila grimshawi]
 sp|B4JUT1.1|NCBP2_DROGR RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Drosophila grimshawi]
 gb|EDV91251.1| GH15101 [Drosophila grimshawi]
Length=154

 Score =   103 bits (258),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S+YRD+ F+G++ E E +L  STT+YVGN+SFYTTEEQ++ELFSR G+++ IVMGLDK 
Sbjct  7    LSSYRDQHFKGSRSEQERSLRDSTTLYVGNLSFYTTEEQIHELFSRCGDVRIIVMGLDKY  66

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  67   KKTPCGFCFV  76


 Score = 73.6 bits (179),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+ +++
Sbjct  104  DWDAGFIEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKI  147



>gb|KDR17129.1| Nuclear cap-binding protein subunit 2 [Zootermopsis nevadensis]
Length=163

 Score =   103 bits (256),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E E  L  STT+Y+GN+SFYTTEEQ+YELFS+ G++K+I+MGLDK
Sbjct  10   ELSSYRDQHFKGSRGEQERLLRTSTTMYIGNLSFYTTEEQIYELFSKCGDVKRIIMGLDK  69

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  70   FKKTPCGFCFV  80


 Score = 74.3 bits (181),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLV  478
             D+D GF+EGRQ+GRGK+GGQVRDEYRTD+D GRGGYGK+VQ+++    Q V
Sbjct  107  TDWDAGFIEGRQYGRGKTGGQVRDEYRTDFDGGRGGYGKIVQQKVSTPVQDV  158



>ref|XP_003063843.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH52216.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=147

 Score = 98.6 bits (244),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            ++ Y+DR FQG+ +E+ E L  STT+YVGN+SF+TTEEQ++ELF++ G ++ IVMGLDKN
Sbjct  11   LTQYKDRSFQGSMDEYLEKLRTSTTLYVGNVSFFTTEEQIWELFAKVGVLRMIVMGLDKN  70

Query  731  SRTPCGFCFVIGKGTREVLKDEQVITNFK*FSYQILIGVSW  609
            ++TPCGF FV     ++  K  + +   K    +I I   W
Sbjct  71   AKTPCGFSFVEYHNRKDAEKAVKYLNGTKLDDREIRIDFDW  111


 Score = 79.0 bits (193),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLV  511
            DFDWGF+EGRQ+GRGKSGGQVRDE+RTDYD GRGGYGKL+
Sbjct  108  DFDWGFVEGRQFGRGKSGGQVRDEFRTDYDAGRGGYGKLI  147



>ref|XP_002053575.1| GJ23276 [Drosophila virilis]
 sp|B4LZ88.1|NCB2B_DROVI RecName: Full=Nuclear cap-binding protein subunit 2B; AltName: 
Full=20 kDa nuclear cap-binding protein B; AltName: Full=NCBP 
20 kDa subunit B; Short=CBP20-B [Drosophila virilis]
 gb|EDW67095.1| GJ23276 [Drosophila virilis]
Length=154

 Score =   103 bits (258),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S+YRD+ F+G++ E E +L  STT+YVGN+SFYTTEEQ++ELFSR G+++ IVMGLDK 
Sbjct  7    LSSYRDQHFKGSRSEQERSLRDSTTLYVGNLSFYTTEEQIHELFSRCGDVRIIVMGLDKY  66

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  67   KKTPCGFCFV  76


 Score = 73.2 bits (178),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+ +++
Sbjct  104  DWDAGFVEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKI  147



>gb|KFO33122.1| Nuclear cap-binding protein subunit 2 [Fukomys damarensis]
Length=157

 Score =   105 bits (262),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK 
Sbjct  17   LSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKM  76

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  77   KKTACGFCFV  86


 Score = 71.2 bits (173),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK+
Sbjct  114  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQKQ  157



>ref|XP_009050432.1| hypothetical protein LOTGIDRAFT_186993 [Lottia gigantea]
 gb|ESO98796.1| hypothetical protein LOTGIDRAFT_186993 [Lottia gigantea]
Length=162

 Score =   107 bits (266),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            +IS YRD+ F+G++ + +  L++STT+YVGN+SFYTTEEQ++ELFSR+G++K+++MGLDK
Sbjct  17   QISTYRDQHFKGSRNDQDHLLIQSTTLYVGNLSFYTTEEQIFELFSRSGDVKRVIMGLDK  76

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  77   VRKTPCGFCFV  87


 Score = 69.3 bits (168),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF EGRQ+GRGKSGGQVRDEYR+D+D GRGGYGK+V  ++
Sbjct  114  TDWDAGFREGRQYGRGKSGGQVRDEYRSDFDEGRGGYGKIVINKI  158



>gb|AAP36198.1| Homo sapiens nuclear cap binding protein subunit 2, 20kDa [synthetic 
construct]
 gb|AAX43646.1| nuclear cap binding protein subunit 2, partial [synthetic construct]
Length=157

 Score =   105 bits (261),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 71.2 bits (173),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +L
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQL  157



>ref|XP_002401570.1| Cap binding protein, putative [Ixodes scapularis]
 sp|B7P877.1|NCBP2_IXOSC RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Ixodes scapularis]
 gb|EEC02799.1| Cap binding protein, putative [Ixodes scapularis]
Length=152

 Score =   104 bits (260),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S+YRD+ F+G++ E E  L  STT+YVGNMSFYTTEEQ+YELFS+ G++KK++MGLD+ 
Sbjct  5    LSSYRDQHFKGSRSEQERLLRLSTTLYVGNMSFYTTEEQIYELFSKCGDVKKVIMGLDRF  64

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  65   HKTPCGFCFV  74


 Score = 72.0 bits (175),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF+EGRQ+GRGKSGGQVRDEYRTDYD GRGGYGKL+ + +
Sbjct  101  TDWDAGFVEGRQFGRGKSGGQVRDEYRTDYDSGRGGYGKLMAQRV  145



>ref|XP_008549903.1| PREDICTED: nuclear cap-binding protein subunit 2 [Microplitis 
demolitor]
 ref|XP_008549904.1| PREDICTED: nuclear cap-binding protein subunit 2 [Microplitis 
demolitor]
 ref|XP_008549905.1| PREDICTED: nuclear cap-binding protein subunit 2 [Microplitis 
demolitor]
 ref|XP_008549906.1| PREDICTED: nuclear cap-binding protein subunit 2 [Microplitis 
demolitor]
Length=161

 Score =   103 bits (257),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E +  L  STT+YVGN+SFYTTEEQ+YELFS+ G+IK+IVMGLDK
Sbjct  10   ELSSYRDQHFKGSRAEQDRLLRTSTTLYVGNLSFYTTEEQIYELFSKCGDIKRIVMGLDK  69

Query  734  NSRTPCGFCFV  702
              +TPCGFCF+
Sbjct  70   YKKTPCGFCFL  80


 Score = 72.8 bits (177),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELE  496
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q++++
Sbjct  107  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKIIQQKVQ  152



>ref|XP_005344885.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Microtus 
ochrogaster]
Length=158

 Score =   105 bits (261),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSEYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 71.2 bits (173),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK+ 
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYREDYDAGRGGYGKLAQKQF  157



>ref|XP_011250963.1| PREDICTED: nuclear cap-binding protein subunit 2 [Camponotus 
floridanus]
 gb|EFN71924.1| Nuclear cap-binding protein subunit 2 [Camponotus floridanus]
Length=165

 Score =   103 bits (256),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E +  L  S+T+YVGN+SFYTTEEQ+YELFS+ G+I++I+MGLDK
Sbjct  14   ELSSYRDQHFKGSRAEQDRLLRNSSTLYVGNLSFYTTEEQIYELFSKCGDIRRIIMGLDK  73

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  74   YKKTPCGFCFV  84


 Score = 73.2 bits (178),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEA  493
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++ +
Sbjct  111  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKIIQQKVTS  157



>ref|XP_010957606.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Camelus 
bactrianus]
Length=172

 Score =   104 bits (260),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 71.6 bits (174),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +L
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQL  157



>ref|XP_006974561.1| PREDICTED: nuclear cap-binding protein subunit 2 [Peromyscus 
maniculatus bairdii]
Length=156

 Score =   105 bits (261),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSEYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 71.2 bits (173),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK+
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYREDYDAGRGGYGKLAQKQ  156



>ref|XP_004876671.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004834773.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Heterocephalus 
glaber]
 gb|EHA97840.1| Nuclear cap-binding protein subunit 2 [Heterocephalus glaber]
Length=156

 Score =   105 bits (261),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK 
Sbjct  17   LSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKM  76

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  77   KKTACGFCFV  86


 Score = 71.2 bits (173),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK+
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQKQ  156



>gb|EDM11451.1| rCG52909, isoform CRA_a [Rattus norvegicus]
Length=173

 Score =   104 bits (260),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSEYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 71.2 bits (173),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYREDYDAGRGGYGKLAQK  155



>ref|XP_001998283.1| GI23717 [Drosophila mojavensis]
 sp|B4KCD5.1|NCBP2_DROMO RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Drosophila mojavensis]
 gb|EDW13744.1| GI23717 [Drosophila mojavensis]
Length=154

 Score =   102 bits (255),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S+YRD+ F+G++ E E +L  S+T+YVGN+SFYTTEEQ++ELFSR G+++ IVMGLDK 
Sbjct  7    LSSYRDQHFKGSRSEQERSLRDSSTLYVGNLSFYTTEEQIHELFSRCGDVRIIVMGLDKY  66

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  67   KKTPCGFCFV  76


 Score = 73.2 bits (178),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+ +++
Sbjct  104  DWDAGFVEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKI  147



>ref|XP_011336388.1| PREDICTED: nuclear cap-binding protein subunit 2 [Cerapachys 
biroi]
 gb|EZA55888.1| Nuclear cap-binding protein subunit [Cerapachys biroi]
Length=165

 Score =   102 bits (255),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S+YRD+ F+G++ E +  L  S+T+YVGN+SFYTTEEQ+YELFS+ G+I++I+MGLDK 
Sbjct  15   LSSYRDQHFKGSRAEQDRLLRNSSTMYVGNLSFYTTEEQIYELFSKCGDIRRIIMGLDKY  74

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  75   KKTPCGFCFV  84


 Score = 73.2 bits (178),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEA  493
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++ +
Sbjct  111  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKIIQQKVTS  157



>ref|XP_003692414.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Apis florea]
Length=166

 Score =   103 bits (258),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E +  L  STT+YVGN+SFYTTEEQ+YELFS+ G+I++I+MGLDK
Sbjct  15   ELSSYRDQHFKGSRAEQDRLLRNSTTLYVGNLSFYTTEEQIYELFSKCGDIRRIIMGLDK  74

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  75   YKKTPCGFCFV  85


 Score = 72.0 bits (175),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++
Sbjct  112  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKIIQQKV  156



>ref|NP_080830.1| nuclear cap-binding protein subunit 2 [Mus musculus]
 ref|NP_001102995.1| nuclear cap-binding protein subunit 2 [Rattus norvegicus]
 ref|XP_003495438.1| PREDICTED: nuclear cap-binding protein subunit 2 [Cricetulus 
griseus]
 ref|XP_005071621.1| PREDICTED: nuclear cap-binding protein subunit 2 [Mesocricetus 
auratus]
 ref|XP_005344886.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Microtus 
ochrogaster]
 ref|XP_007635688.1| PREDICTED: nuclear cap-binding protein subunit 2 [Cricetulus 
griseus]
 ref|XP_008836729.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Nannospalax 
galili]
 sp|Q9CQ49.1|NCBP2_MOUSE RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Mus musculus]
 sp|B1WC40.1|NCBP2_RAT RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Rattus norvegicus]
 dbj|BAB26004.1| unnamed protein product [Mus musculus]
 dbj|BAB28389.1| unnamed protein product [Mus musculus]
 dbj|BAC37030.1| unnamed protein product [Mus musculus]
 dbj|BAE27620.1| unnamed protein product [Mus musculus]
 gb|AAI18927.1| Nuclear cap binding protein subunit 2 [Mus musculus]
 gb|EDK97760.1| nuclear cap binding protein subunit 2, isoform CRA_a [Mus musculus]
 gb|EDM11452.1| rCG52909, isoform CRA_b [Rattus norvegicus]
 gb|AAI61994.1| Similar to nuclear cap binding protein subunit 2 [Rattus norvegicus]
 gb|EGV96366.1| Nuclear cap-binding protein subunit 2 [Cricetulus griseus]
 gb|ERE76039.1| nuclear cap-binding protein subunit 2-like protein [Cricetulus 
griseus]
Length=156

 Score =   105 bits (261),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSEYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 71.2 bits (173),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK+
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYREDYDAGRGGYGKLAQKQ  156



>emb|CDJ82645.1| RNA recognition motif domain containing protein [Haemonchus contortus]
Length=224

 Score =   110 bits (275),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            ++IS YRD+RFQGT +E + AL  STTVYVGN+SFYT+E+Q+YELF+RAGE+K+++MGLD
Sbjct  80   TQISEYRDQRFQGTLKEQDLALRTSTTVYVGNLSFYTSEDQLYELFNRAGEVKRVIMGLD  139

Query  737  KNSRTPCGFCFVI  699
            +  ++PCGFCFVI
Sbjct  140  RFKKSPCGFCFVI  152


 Score = 65.5 bits (158),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
            D+D GF+EGRQ+GRGK GGQVRDEYR  YDP RGGYGK+ Q
Sbjct  179  DYDAGFVEGRQYGRGKHGGQVRDEYREQYDPDRGGYGKIWQ  219



>ref|XP_397316.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Apis mellifera]
 ref|XP_006620934.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Apis dorsata]
Length=166

 Score =   103 bits (258),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E +  L  STT+YVGN+SFYTTEEQ+YELFS+ G+I++I+MGLDK
Sbjct  15   ELSSYRDQHFKGSRAEQDRLLRNSTTLYVGNLSFYTTEEQIYELFSKCGDIRRIIMGLDK  74

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  75   YKKTPCGFCFV  85


 Score = 72.0 bits (175),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++
Sbjct  112  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKIIQQKV  156



>ref|XP_005341025.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Ictidomys 
tridecemlineatus]
Length=156

 Score =   104 bits (260),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK 
Sbjct  17   LSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKV  76

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  77   KKTACGFCFV  86


 Score = 71.2 bits (173),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK+
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQKQ  156



>ref|XP_011164867.1| PREDICTED: nuclear cap-binding protein subunit 2 [Solenopsis 
invicta]
 gb|EFZ14881.1| hypothetical protein SINV_03383 [Solenopsis invicta]
Length=165

 Score =   102 bits (255),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+GT+ E +  L  S T+YVGN+SFYTTEEQ+YELFS+ G+I++I+MGLDK
Sbjct  14   ELSSYRDQHFKGTRAEQDRLLRNSCTLYVGNLSFYTTEEQIYELFSKCGDIRRIIMGLDK  73

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  74   YKKTPCGFCFV  84


 Score = 73.2 bits (178),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEA  493
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++ +
Sbjct  111  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKIIQQKVTS  157



>ref|XP_010992712.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Camelus 
dromedarius]
Length=257

 Score =   105 bits (261),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  101  ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  160

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  161  MKKTACGFCFV  171


 Score = 70.9 bits (172),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +L
Sbjct  198  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQL  242



>ref|XP_011067287.1| PREDICTED: nuclear cap-binding protein subunit 2 [Acromyrmex 
echinatior]
 gb|EGI69835.1| Nuclear cap-binding protein subunit 2 [Acromyrmex echinatior]
Length=165

 Score =   102 bits (254),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+GT+ E +  L  S T+YVGN+SFYTTEEQ+YELFS+ G+I++I+MGLDK
Sbjct  14   ELSSYRDQHFKGTRAEQDRLLRNSCTLYVGNLSFYTTEEQIYELFSKCGDIRRIIMGLDK  73

Query  734  NSRTPCGFCFV  702
              +TPCGFCF+
Sbjct  74   YKKTPCGFCFI  84


 Score = 73.2 bits (178),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEA  493
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++ +
Sbjct  111  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKIIQQKVTS  157



>ref|XP_005703214.1| nuclear cap-binding protein subunit 2 [Galdieria sulphuraria]
 gb|EME26694.1| nuclear cap-binding protein subunit 2 [Galdieria sulphuraria]
Length=195

 Score =   110 bits (274),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            ++ YRDRRFQGTQEE+E  +  S T+YVGN+SFYT+EEQ++ELFS  GE+K+I+MGLD+ 
Sbjct  10   VTLYRDRRFQGTQEEYEHRIATSKTLYVGNLSFYTSEEQIWELFSLCGELKRIIMGLDRF  69

Query  731  SRTPCGFCFV  702
             RTPCGFCFV
Sbjct  70   RRTPCGFCFV  79


 Score = 65.9 bits (159),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D+GF  GRQ+GRG+SGGQVRDE+R DYDPGRGGYGK ++K
Sbjct  106  ADWDYGFEPGRQFGRGRSGGQVRDEHREDYDPGRGGYGKFMKK  148



>ref|XP_003477149.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Cavia 
porcellus]
 ref|XP_005383201.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Chinchilla 
lanigera]
Length=156

 Score =   105 bits (261),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK 
Sbjct  17   LSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKM  76

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  77   KKTACGFCFV  86


 Score = 70.9 bits (172),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK+
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQKQ  156



>ref|XP_002070032.1| GK11244 [Drosophila willistoni]
 sp|B4NB54.1|NCBP2_DROWI RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Drosophila willistoni]
 gb|EDW81018.1| GK11244 [Drosophila willistoni]
Length=154

 Score =   102 bits (253),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E E +L +S T+YVGN+SFYTTEEQ++ELFSR G+++ IVMGLDK
Sbjct  6    ELSSYRDQHFKGSRSEQERSLKESCTLYVGNLSFYTTEEQIHELFSRCGDVRLIVMGLDK  65

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  66   YKKTPCGFCFV  76


 Score = 73.6 bits (179),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+ +++
Sbjct  104  DWDAGFIEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKI  147



>ref|XP_006884350.1| PREDICTED: nuclear cap-binding protein subunit 2 [Elephantulus 
edwardii]
Length=159

 Score =   105 bits (261),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK 
Sbjct  17   LSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKM  76

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  77   KKTACGFCFV  86


 Score = 70.5 bits (171),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQK  155



>ref|XP_002096138.1| GE25514 [Drosophila yakuba]
 sp|B4PL68.1|NCBP2_DROYA RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Drosophila yakuba]
 gb|EDW95850.1| GE25514 [Drosophila yakuba]
Length=154

 Score =   102 bits (253),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E E +L  S T+YVGN+SFYTTEEQ++ELFSR G+++ IVMGLDK
Sbjct  6    ELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDK  65

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  66   YKKTPCGFCFV  76


 Score = 73.6 bits (179),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+ +++
Sbjct  104  DWDAGFIEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKI  147



>ref|XP_008767006.1| PREDICTED: nuclear cap-binding protein subunit 2 [Rattus norvegicus]
Length=197

 Score =   104 bits (260),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  57   ELSEYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  116

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  117  MKKTACGFCFV  127


 Score = 70.5 bits (171),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL QK+
Sbjct  154  TDWDAGFKEGRQYGRGRSGGQVRDEYREDYDAGRGGYGKLAQKQ  197



>ref|XP_001608109.1| PREDICTED: nuclear cap-binding protein subunit 2 [Nasonia vitripennis]
Length=158

 Score =   103 bits (257),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E +  L  STT+YVGN+SFYTTEEQ+YELFS+ G+IK+I+MGLDK
Sbjct  9    ELSSYRDQHFKGSRAEQDRLLRNSTTLYVGNLSFYTTEEQIYELFSKCGDIKRIIMGLDK  68

Query  734  NSRTPCGFCFV  702
              +TPCGFCF+
Sbjct  69   YKKTPCGFCFM  79


 Score = 71.6 bits (174),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++
Sbjct  106  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKILQQKV  150



>ref|XP_001979694.1| GG22670 [Drosophila erecta]
 sp|B3P0D7.1|NCBP2_DROER RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Drosophila erecta]
 gb|EDV48652.1| GG22670 [Drosophila erecta]
Length=154

 Score =   101 bits (252),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E E +L  S T+YVGN+SFYTTEEQ++ELFSR G+++ IVMGLDK
Sbjct  6    ELSSYRDQHFKGSRSEQERSLRGSCTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDK  65

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  66   YKKTPCGFCFV  76


 Score = 73.6 bits (179),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+ +++
Sbjct  104  DWDAGFIEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKI  147



>gb|EPY85295.1| nuclear cap-binding protein subunit 2 isoform 1 [Camelus ferus]
Length=172

 Score =   105 bits (262),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 69.7 bits (169),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  156



>ref|XP_003394780.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Bombus 
terrestris]
 ref|XP_003485640.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Bombus 
impatiens]
Length=166

 Score =   102 bits (255),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E +  L  STT+YVGN+SFYTTEEQ+YELFS+ G+I++I+MGLDK
Sbjct  15   ELSSYRDQHFKGSRAEQDRLLRISTTLYVGNLSFYTTEEQIYELFSKCGDIRRIIMGLDK  74

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  75   YKKTPCGFCFV  85


 Score = 72.4 bits (176),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++
Sbjct  112  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKIIQQKV  156



>ref|XP_001600470.2| PREDICTED: nuclear cap-binding protein subunit 2-like [Nasonia 
vitripennis]
Length=174

 Score =   104 bits (260),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +SAYRD+ F+G+Q + +E L  STT+YVGN+SFYTTE+QVYE+FS+ G+IK+I+MGLDK 
Sbjct  14   LSAYRDQYFKGSQSKQDELLKTSTTLYVGNLSFYTTEQQVYEVFSKCGDIKRIIMGLDKY  73

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  74   KKTPCGFCFV  83


 Score = 70.1 bits (170),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELE  496
            D+D GF++GRQ+GRG++GGQ RDEYRTD+D GRGG+GK++QK+L+
Sbjct  111  DWDAGFVDGRQYGRGQTGGQFRDEYRTDFDSGRGGFGKVIQKKLD  155



>ref|XP_004465946.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform 1 [Dasypus 
novemcinctus]
 ref|XP_005873233.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Myotis 
brandtii]
 ref|XP_006084792.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Myotis 
lucifugus]
 ref|XP_006753460.1| PREDICTED: nuclear cap-binding protein subunit 2 [Myotis davidii]
 ref|XP_008158757.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Eptesicus 
fuscus]
 gb|ELK38032.1| Nuclear cap-binding protein subunit 2 [Myotis davidii]
 gb|EPQ12032.1| Nuclear cap-binding protein subunit 2 [Myotis brandtii]
Length=156

 Score =   105 bits (261),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 69.7 bits (169),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  156



>ref|NP_524396.1| cap binding protein 20 [Drosophila melanogaster]
 ref|XP_002041014.1| GM15280 [Drosophila sechellia]
 ref|XP_002102997.1| GD19204 [Drosophila simulans]
 sp|Q9V3L6.1|NCBP2_DROME RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Drosophila melanogaster]
 sp|B4IBA4.1|NCBP2_DROSE RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Drosophila sechellia]
 sp|B4QV17.1|NCBP2_DROSI RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Drosophila simulans]
 emb|CAB53185.1| cap binding protein 20 [Drosophila melanogaster]
 gb|AAF55496.1| cap binding protein 20 [Drosophila melanogaster]
 gb|AAL48049.1| RE12122p [Drosophila melanogaster]
 gb|EDW44662.1| GM15280 [Drosophila sechellia]
 gb|EDX12500.1| GD19204 [Drosophila simulans]
 gb|ACL86517.1| Cbp20-PA, partial [synthetic construct]
 gb|ACL91134.1| Cbp20-PA [synthetic construct]
Length=154

 Score =   101 bits (252),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E E +L  S T+YVGN+SFYTTEEQ++ELFSR G+++ IVMGLDK
Sbjct  6    ELSSYRDQHFKGSRSEQERSLRDSCTLYVGNLSFYTTEEQIHELFSRCGDVRVIVMGLDK  65

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  66   YKKTPCGFCFV  76


 Score = 73.2 bits (178),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+ +++
Sbjct  104  DWDAGFVEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSQKI  147



>ref|XP_011506502.1| PREDICTED: nuclear cap-binding protein subunit 2 [Ceratosolen 
solmsi marchali]
Length=158

 Score =   102 bits (255),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E +  L  S T+YVGN+SFYTTEEQ+YELFSR G+IK+I+MGLDK
Sbjct  9    ELSSYRDQHFKGSRAEQDRLLRTSCTLYVGNLSFYTTEEQIYELFSRCGDIKRIIMGLDK  68

Query  734  NSRTPCGFCFV  702
              +TPCGFCF+
Sbjct  69   YKKTPCGFCFL  79


 Score = 72.0 bits (175),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++
Sbjct  106  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKILQQKV  150



>ref|XP_011148098.1| PREDICTED: nuclear cap-binding protein subunit 2 [Harpegnathos 
saltator]
 gb|EFN78824.1| Nuclear cap-binding protein subunit 2 [Harpegnathos saltator]
Length=165

 Score =   101 bits (252),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E +  L  S+T+YVGN+SFYTTEEQ+YELFS+ G++++I+MGLDK
Sbjct  14   ELSSYRDQHFKGSRAEQDRLLRNSSTLYVGNLSFYTTEEQIYELFSKCGDVRRIIMGLDK  73

Query  734  NSRTPCGFCFV  702
              +TPCGFCF+
Sbjct  74   YKKTPCGFCFI  84


 Score = 73.2 bits (178),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEA  493
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++ +
Sbjct  111  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKIIQQKVTS  157



>ref|XP_008007826.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Chlorocebus 
sabaeus]
Length=189

 Score =   105 bits (261),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  47   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  106

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  107  MKKTACGFCFV  117


 Score = 69.7 bits (169),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  144  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  187



>ref|XP_011384673.1| PREDICTED: nuclear cap-binding protein subunit 2 [Pteropus vampyrus]
Length=156

 Score =   105 bits (262),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 69.3 bits (168),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  156



>ref|XP_005545356.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Macaca 
fascicularis]
 ref|XP_008007827.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X3 [Chlorocebus 
sabaeus]
Length=187

 Score =   105 bits (261),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  47   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  106

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  107  MKKTACGFCFV  117


 Score = 69.7 bits (169),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  144  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  187



>ref|NP_031388.2| nuclear cap-binding protein subunit 2 isoform 1 [Homo sapiens]
 ref|NP_001029568.1| nuclear cap-binding protein subunit 2 [Bos taurus]
 ref|NP_001252776.1| nuclear cap-binding protein subunit 2 [Macaca mulatta]
 ref|XP_535779.1| PREDICTED: nuclear cap-binding protein subunit 2 isoformX2 [Canis 
lupus familiaris]
 ref|XP_516977.2| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Pan 
troglodytes]
 ref|XP_001501058.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform 1 [Equus 
caballus]
 ref|XP_002758268.1| PREDICTED: nuclear cap-binding protein subunit 2 [Callithrix 
jacchus]
 ref|XP_002814513.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Pongo 
abelii]
 ref|XP_002916818.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_003358812.2| PREDICTED: nuclear cap-binding protein subunit 2 isoform 1 [Sus 
scrofa]
 ref|XP_003792724.1| PREDICTED: nuclear cap-binding protein subunit 2 [Otolemur garnettii]
 ref|XP_003806473.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Pan 
paniscus]
 ref|XP_003991806.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Felis 
catus]
 ref|XP_004003065.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform 1 [Ovis 
aries]
 ref|XP_004089763.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform 2 [Nomascus 
leucogenys]
 ref|XP_004391936.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004424594.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004603031.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Sorex 
araneus]
 ref|XP_004745385.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Mustela 
putorius furo]
 ref|XP_004806832.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Mustela 
putorius furo]
 ref|XP_005639661.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X3 [Canis 
lupus familiaris]
 ref|XP_005675134.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Capra 
hircus]
 ref|XP_005897884.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Bos 
mutus]
 ref|XP_005961504.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Pantholops 
hodgsonii]
 ref|XP_005961505.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Pantholops 
hodgsonii]
 ref|XP_006179035.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Camelus 
ferus]
 ref|XP_006200992.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Vicugna 
pacos]
 ref|XP_006156829.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X4 [Tupaia 
chinensis]
 ref|XP_006742934.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006936222.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Felis 
catus]
 ref|XP_007091026.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007091027.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Panthera 
tigris altaica]
 ref|XP_007115290.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Physeter 
catodon]
 ref|XP_006054290.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Bubalus 
bubalis]
 ref|XP_007171657.1| PREDICTED: nuclear cap-binding protein subunit 2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007955290.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Orycteropus 
afer afer]
 ref|XP_008591095.1| PREDICTED: nuclear cap-binding protein subunit 2 [Galeopterus 
variegatus]
 ref|XP_008706584.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Ursus 
maritimus]
 ref|XP_008706585.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Ursus 
maritimus]
 ref|XP_008706586.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Ursus 
maritimus]
 ref|XP_010832651.1| PREDICTED: nuclear cap-binding protein subunit 2 [Bison bison 
bison]
 ref|XP_010957607.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Camelus 
bactrianus]
 ref|XP_010957608.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X3 [Camelus 
bactrianus]
 ref|XP_011219998.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Ailuropoda 
melanoleuca]
 ref|XP_011219999.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Ailuropoda 
melanoleuca]
 sp|P52298.1|NCBP2_HUMAN RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=Cell 
proliferation-inducing gene 55 protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20; AltName: Full=NCBP-interacting 
protein 1; Short=NIP1 [Homo sapiens]
 sp|Q3ZBJ1.1|NCBP2_BOVIN RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Bos taurus]
 pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) 
In Complex With A Cap Analogue M7gpppg
 pdb|1H2U|X Chain X, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) 
In Complex With A Cap Analogue M7gpppg
 pdb|1H2U|Y Chain Y, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) 
In Complex With A Cap Analogue M7gpppg
 pdb|1H2V|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc)
 pdb|1N52|B Chain B, Cap Binding Complex
 pdb|1N54|B Chain B, Cap Binding Complex M7gpppg Free
 pdb|3FEX|B Chain B, Crystal Structure Of The Cbc-Importin Alpha Complex.
 pdb|3FEY|B Chain B, Crystal Structure Of The Cbc-Importin Alpha Complex.
 emb|CAA58962.1| subunit of the dimeric cap binding complex CBC [Homo sapiens]
 gb|AAH01255.1| Nuclear cap binding protein subunit 2, 20kDa [Homo sapiens]
 gb|AAP35488.1| nuclear cap binding protein subunit 2, 20kDa [Homo sapiens]
 gb|AAV85455.1| cell proliferation-inducing gene 55 [Homo sapiens]
 gb|AAX31978.1| nuclear cap binding protein subunit 2 [synthetic construct]
 gb|AAI03268.1| Nuclear cap binding protein subunit 2, 20kDa [Bos taurus]
 gb|EAW53624.1| nuclear cap binding protein subunit 2, 20kDa, isoform CRA_d [Homo 
sapiens]
 gb|ABM81629.1| nuclear cap binding protein subunit 2, 20kDa [synthetic construct]
 gb|ABM84813.1| nuclear cap binding protein subunit 2, 20kDa [synthetic construct]
 dbj|BAG38188.1| unnamed protein product [Homo sapiens]
 dbj|BAI47038.1| nuclear cap binding protein subunit 2, 20kDa [synthetic construct]
 tpg|DAA33356.1| TPA: nuclear cap-binding protein subunit 2 [Bos taurus]
 gb|EHH16879.1| hypothetical protein EGK_12250 [Macaca mulatta]
 gb|ELR54920.1| Nuclear cap-binding protein subunit 2 [Bos mutus]
 gb|ELW50945.1| Nuclear cap-binding protein subunit 2 [Tupaia chinensis]
 prf||2118330A cap-binding protein
Length=156

 Score =   105 bits (261),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 69.3 bits (168),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  156



>ref|XP_004278828.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform 1 [Orcinus 
orca]
 ref|XP_004321656.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform 1 [Tursiops 
truncatus]
Length=156

 Score =   105 bits (261),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 69.3 bits (168),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  156



>dbj|BAA09599.1| NCBP interacting protein 1 [Homo sapiens]
Length=156

 Score =   105 bits (261),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 69.3 bits (168),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  156



>ref|XP_005961506.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X3 [Pantholops 
hodgsonii]
Length=152

 Score =   105 bits (261),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 69.3 bits (168),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  109  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  152



>ref|XP_001359956.1| GA11577 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002019798.1| GL12592 [Drosophila persimilis]
 sp|Q293V6.1|NCBP2_DROPS RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Drosophila pseudoobscura pseudoobscura]
 sp|B4GLK8.1|NCBP2_DROPE RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Drosophila persimilis]
 gb|EAL29108.1| GA11577 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW38432.1| GL12592 [Drosophila persimilis]
Length=154

 Score =   101 bits (252),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E E +L  S T+YVGN+SFYTTEEQ++ELFSR G+++ IVMGLDK
Sbjct  6    ELSSYRDQHFKGSRSEQERSLKDSCTLYVGNLSFYTTEEQIHELFSRCGDVRLIVMGLDK  65

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  66   YKKTPCGFCFV  76


 Score = 72.8 bits (177),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGKL+  ++
Sbjct  104  DWDAGFIEGRQYGRGKTGGQVRDEYRTDYDAGRGGYGKLLSLKI  147



>ref|XP_002716573.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Oryctolagus 
cuniculus]
 ref|XP_004577872.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Ochotona 
princeps]
 ref|XP_008072314.1| PREDICTED: nuclear cap-binding protein subunit 2 [Tarsius syrichta]
Length=156

 Score =   104 bits (260),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   VKKTACGFCFV  86


 Score = 69.3 bits (168),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  156



>ref|XP_004675178.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Condylura 
cristata]
Length=156

 Score =   104 bits (260),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   IKKTACGFCFV  86


 Score = 69.3 bits (168),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYREDYDAGRGGYGKLAQNQ  156



>ref|XP_010379473.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Rhinopithecus 
roxellana]
Length=156

 Score =   104 bits (260),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKK++MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKVIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 69.3 bits (168),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  156



>ref|XP_010992713.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Camelus 
dromedarius]
 ref|XP_010992714.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X3 [Camelus 
dromedarius]
Length=241

 Score =   105 bits (261),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  101  ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  160

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  161  MKKTACGFCFV  171


 Score = 68.9 bits (167),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  198  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  241



>ref|XP_003412984.1| PREDICTED: nuclear cap-binding protein subunit 2 [Loxodonta africana]
 ref|XP_004373639.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform 1 [Trichechus 
manatus latirostris]
Length=156

 Score =   105 bits (261),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 68.9 bits (167),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  156



>ref|XP_008007825.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Chlorocebus 
sabaeus]
Length=235

 Score =   105 bits (261),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  47   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  106

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  107  MKKTACGFCFV  117


 Score = 68.9 bits (167),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q
Sbjct  144  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQ  185



>ref|XP_010379472.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Rhinopithecus 
roxellana]
Length=168

 Score =   104 bits (260),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKK++MGLDK 
Sbjct  17   LSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKVIMGLDKM  76

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  77   KKTACGFCFV  86


 Score = 68.9 bits (167),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQ  154



>ref|XP_007465922.1| PREDICTED: nuclear cap-binding protein subunit 2 [Lipotes vexillifer]
Length=156

 Score =   105 bits (261),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 68.6 bits (166),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQ  154



>gb|EMT25461.1| Nuclear cap-binding protein subunit 2 [Aegilops tauschii]
Length=222

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            SK+S YRDRRF GTQEEFE ALL S TVYVGNMSFYTTEEQ YELFSRAGEIKKI+MGLD
Sbjct  9    SKLSVYRDRRFPGTQEEFEAALLASLTVYVGNMSFYTTEEQAYELFSRAGEIKKIIMGLD  68

Query  737  KNSRTPCGFCFVI  699
            KN++TPCGFCFV+
Sbjct  69   KNTKTPCGFCFVL  81



>emb|CBY24385.1| unnamed protein product [Oikopleura dioica]
Length=202

 Score =   100 bits (248),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +SAYRD +F+GT++E +  L  S+T+YVGN+SFYTTEEQ+ +LF + G++K+++MGLDK 
Sbjct  31   VSAYRDNQFKGTRKEQDRLLHTSSTLYVGNLSFYTTEEQLTDLFGKCGDLKRVIMGLDKV  90

Query  731  SRTPCGFCFV  702
             RTPCGFCFV
Sbjct  91   KRTPCGFCFV  100


 Score = 73.2 bits (178),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLV  478
             D+D GF+EGRQ+GRGK+GGQVRDEYRTDYDPGRGGYGK V++  + +R+++
Sbjct  134  TDWDAGFIEGRQYGRGKTGGQVRDEYRTDYDPGRGGYGKRVEEGGQRKRKMM  185



>gb|ACL54295.1| unknown [Zea mays]
 gb|AFW62943.1| hypothetical protein ZEAMMB73_103683 [Zea mays]
Length=144

 Score =   132 bits (333),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 91/130 (70%), Gaps = 17/130 (13%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+V +ELEAQR+LVDYG    G+
Sbjct  10   DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVLRELEAQRELVDYG----GS  65

Query  450  FPPVMAPQY---GRQGGHGGSYRHGR-DYYRKRHREDDRHRLDYSKRVYRREPVRDSDHE  283
            F P   P Y    R+ GHG S+R+ R DY RKR+R DDR   + SKR    +P       
Sbjct  66   FQPNAPPPYERSERKRGHGDSHRNDRGDYQRKRYRNDDRSAPEESKRAPDSDPA------  119

Query  282  ARPEKNPRFR  253
               EKNPRFR
Sbjct  120  ---EKNPRFR  126



>ref|XP_006637539.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Lepisosteus 
oculatus]
Length=164

 Score =   102 bits (253),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            IS YRD+ F+G + E E  L  S T+YVGN+SFYTTEEQVYELFS++G++K+I+MGLDK 
Sbjct  16   ISQYRDQHFKGNRHEQERLLRASNTLYVGNLSFYTTEEQVYELFSKSGDVKRIIMGLDKV  75

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  76   KKTACGFCFV  85


 Score = 70.9 bits (172),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q +
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKLAQLQ  155



>ref|XP_007517494.1| PREDICTED: nuclear cap-binding protein subunit 2 [Erinaceus europaeus]
Length=160

 Score =   104 bits (260),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   VKKTACGFCFV  86


 Score = 68.2 bits (165),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQ  154



>ref|XP_003228961.1| PREDICTED: nuclear cap-binding protein subunit 2 [Anolis carolinensis]
Length=168

 Score =   100 bits (248),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            +IS YRD++F+G++   ++AL  S T+YVGN+SFYTTEEQ++ELFS+ G++K+IVMGLDK
Sbjct  19   EISCYRDQQFKGSRYLQKKALKSSCTLYVGNLSFYTTEEQIHELFSKCGDVKRIVMGLDK  78

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  79   LKKTPCGFCFV  89


 Score = 73.2 bits (178),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLV  478
             D+D GF EGRQ+GRGK+GGQVRDEYRTDYD GRGG+GK++Q +   Q+  +
Sbjct  116  TDWDAGFKEGRQFGRGKTGGQVRDEYRTDYDVGRGGFGKIIQMQKTNQQTAI  167



>gb|EHH51794.1| hypothetical protein EGM_11239 [Macaca fascicularis]
Length=156

 Score =   103 bits (258),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ ++G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHWRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 68.9 bits (167),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  156



>ref|XP_005107563.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Aplysia 
californica]
Length=161

 Score =   104 bits (259),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            + +S YRD+ F+G + E E+ LL S+T+Y+GN+SFYT+E Q++ELF RAG++K+IVMGLD
Sbjct  11   ASLSQYRDQHFRGNRHEQEQKLLASSTLYIGNLSFYTSEGQIHELFGRAGDVKRIVMGLD  70

Query  737  KNSRTPCGFCFV  702
            K  +TPCGFCFV
Sbjct  71   KVKKTPCGFCFV  82


 Score = 68.6 bits (166),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF EGRQ+GRGK+GGQVRDEYRTDYD  RGGYGK++  ++
Sbjct  109  TDWDTGFKEGRQYGRGKTGGQVRDEYRTDYDEARGGYGKMLANKI  153



>ref|XP_003700782.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Megachile 
rotundata]
Length=166

 Score =   100 bits (250),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = -2

Query  902  YRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNSRT  723
            YRD+ F+G++ E +  L  STT+YVGN+SFYTTEEQ+YELFS+ G+I++I+MGLDK  +T
Sbjct  19   YRDQHFKGSRAEQDRLLRNSTTLYVGNLSFYTTEEQIYELFSKCGDIRRIIMGLDKYKKT  78

Query  722  PCGFCFV  702
            PCGFCFV
Sbjct  79   PCGFCFV  85


 Score = 72.0 bits (175),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++
Sbjct  112  TDWDAGFIEGRQYGRGKTGGQVRDEYRSDFDSGRGGYGKIIQQKV  156



>ref|XP_011299634.1| PREDICTED: nuclear cap-binding protein subunit 2 [Fopius arisanus]
Length=162

 Score =   102 bits (254),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+G++ E +  L  STT+YVGN+SF+TTEEQ+YELFS+ G+IK+IVMGLDK
Sbjct  11   ELSSYRDQHFKGSRAEQDRLLRNSTTLYVGNLSFFTTEEQIYELFSKCGDIKRIVMGLDK  70

Query  734  NSRTPCGFCFV  702
              +TPCGFCF+
Sbjct  71   YKKTPCGFCFL  81


 Score = 70.1 bits (170),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
             D+D GF+EGRQ+GRGK+GGQVRDEYR+D+D GRGGYGK++Q+++
Sbjct  108  TDWDAGFVEGRQYGRGKTGGQVRDEYRSDFDGGRGGYGKILQQKV  152



>gb|EEC73582.1| hypothetical protein OsI_08043 [Oryza sativa Indica Group]
Length=127

 Score =   106 bits (265),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  875  QEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNSRTPCGFCFVI  699
            +EE+E AL  S TVYVGNMSFYTTEEQ YELFSRAGEI+KI+MGLDKNS+TPCGFCF++
Sbjct  6    KEEYEAALQASVTVYVGNMSFYTTEEQAYELFSRAGEIRKIIMGLDKNSKTPCGFCFIL  64


 Score = 65.9 bits (159),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 29/31 (94%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDP  538
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDP
Sbjct  91   DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDP  121



>ref|NP_001155469.1| nuclear cap-binding protein subunit 2-like [Acyrthosiphon pisum]
 dbj|BAH71724.1| ACYPI002210 [Acyrthosiphon pisum]
Length=159

 Score =   103 bits (258),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            S IS+YRD+ F+G++ E ++ L  STT+Y+GN++FYTTE Q+YELFS+ G+IK+IVMGLD
Sbjct  2    SDISSYRDQHFKGSRGELDKMLRSSTTMYIGNLAFYTTEGQIYELFSKCGDIKRIVMGLD  61

Query  737  KNSRTPCGFCFV  702
            K  +TPCGFCF+
Sbjct  62   KFKKTPCGFCFI  73


 Score = 68.6 bits (166),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGK  Q
Sbjct  100  TDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDIGRGGYGKNAQ  141



>ref|XP_006258125.1| PREDICTED: nuclear cap-binding protein subunit 2 [Alligator mississippiensis]
Length=168

 Score = 98.6 bits (244),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            IS YRD+ F+G++   E++L  S+T+YVGN+SFYTTEEQ+ ELFS+ G++K+IVMGLDK 
Sbjct  20   ISQYRDQHFRGSRYLQEKSLKASSTLYVGNLSFYTTEEQIQELFSKCGDVKRIVMGLDKI  79

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  80   KKTPCGFCFV  89


 Score = 73.9 bits (180),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLV  478
             D+D GF EGRQ+GRGK+GGQVRDEYRTDYD GRGG+GK++Q +   Q+ ++
Sbjct  116  TDWDAGFKEGRQYGRGKTGGQVRDEYRTDYDVGRGGFGKIIQMQKANQQTMI  167



>ref|XP_002603437.1| hypothetical protein BRAFLDRAFT_158723 [Branchiostoma floridae]
 gb|EEN59448.1| hypothetical protein BRAFLDRAFT_158723, partial [Branchiostoma 
floridae]
Length=140

 Score =   105 bits (262),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++ AYRD+ ++G++ + E  LL+STT+YVGN+SFYTTEEQ+YELF + G+IK+I+MGLDK
Sbjct  5    ELGAYRDQHYKGSRTDQERRLLESTTLYVGNLSFYTTEEQIYELFGKCGDIKRIIMGLDK  64

Query  734  NSRTPCGFCFV  702
              RTPCGFCFV
Sbjct  65   MQRTPCGFCFV  75


 Score = 67.0 bits (162),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGK  517
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDPGRGGYGK
Sbjct  102  CDWDAGFKEGRQYGRGKSGGQVRDEYRKDYDPGRGGYGK  140



>gb|KGG51643.1| hypothetical protein DI09_2p200 [Microsporidia sp. UGP3]
Length=149

 Score =   106 bits (265),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -2

Query  908  SAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNS  729
            S Y+DR FQGT +E+   + K+ T+YVGN+SFYTTEEQ+YE+FS+AG+IK+I+MGLD+ +
Sbjct  12   SKYKDRYFQGTDDEYHSLMKKTATIYVGNLSFYTTEEQIYEVFSKAGKIKRIIMGLDRVT  71

Query  728  RTPCGFCFV  702
            +TPCGFCFV
Sbjct  72   KTPCGFCFV  80


 Score = 65.5 bits (158),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLV  511
             D D GF E RQ+GRGKSGGQVRDEYR DYDPGRGG+GK+V
Sbjct  107  ADLDPGFRESRQYGRGKSGGQVRDEYREDYDPGRGGWGKVV  147



>ref|XP_637361.1| RNA-binding region RNP-1 domain-containing protein [Dictyostelium 
discoideum AX4]
 sp|Q54KR9.1|NCBP2_DICDI RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Dictyostelium discoideum]
 gb|EAL63873.1| RNA-binding region RNP-1 domain-containing protein [Dictyostelium 
discoideum AX4]
Length=234

 Score =   100 bits (249),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = -2

Query  902  YRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNSRT  723
            Y D++   TQ+EF+ A+ KS+T+YVG +SFYTTEEQ+YELFS+ GEIK+I+MGLD+N +T
Sbjct  12   YYDKKSGFTQDEFKHAIDKSSTIYVGYLSFYTTEEQLYELFSKCGEIKRIIMGLDRNQKT  71

Query  722  PCGFCFV  702
            PCGFCFV
Sbjct  72   PCGFCFV  78


 Score = 71.2 bits (173),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 44/58 (76%), Gaps = 3/58 (5%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSL  457
            D+D+GF EGRQ+GRG SGGQVRDEYRTDYDPGRGGYGK  Q E++   Q  D   G +
Sbjct  106  DWDYGFKEGRQYGRGLSGGQVRDEYRTDYDPGRGGYGKQRQFEMD---QFSDVNGGDI  160



>ref|XP_004712391.1| PREDICTED: nuclear cap-binding protein subunit 2 [Echinops telfairi]
Length=164

 Score =   102 bits (253),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            +++ YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  17   ELTEYRDQHFRGDYEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  76

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  77   VKKTACGFCFV  87


 Score = 69.7 bits (169),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKLVQ
Sbjct  114  TDWDAGFREGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLVQ  155



>ref|XP_003289703.1| hypothetical protein DICPUDRAFT_154090 [Dictyostelium purpureum]
 gb|EGC33778.1| hypothetical protein DICPUDRAFT_154090 [Dictyostelium purpureum]
Length=213

 Score =   100 bits (248),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = -2

Query  902  YRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNSRT  723
            Y D++   TQ+EF++A+ KS+T+YVG +SFYTTEEQ+YELFS+ GEIK+I+MGLD+N +T
Sbjct  12   YYDKKSGLTQDEFKKAIEKSSTIYVGYLSFYTTEEQLYELFSKCGEIKRIIMGLDRNQKT  71

Query  722  PCGFCFV  702
            PCGFCFV
Sbjct  72   PCGFCFV  78


 Score = 71.6 bits (174),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 60/108 (56%), Gaps = 13/108 (12%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQL-VDYGTGSL  457
             D+D+GF EGRQ+GRG SGGQVRDEYRTDYDPGRGGYGK    E+E    + + Y    L
Sbjct  105  CDWDYGFREGRQYGRGLSGGQVRDEYRTDYDPGRGGYGKQRLFEMEQYNDVDITYQQQIL  164

Query  456  GNF-PPVMAPQYGRQGGHGGSYRHGRDY-----------YRKRHREDD  349
                P   + +  R    G S++  RD            YR+R  E+D
Sbjct  165  QTMQPQQFSGKRSRDNDDGDSFKKQRDNNNNSNTPNKNRYRERDEEND  212



>ref|XP_008933114.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Manacus 
vitellinus]
Length=168

 Score = 99.8 bits (247),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            +IS YRD+ F+G+++  E++L  S+T+YVGN+SFYTTEEQ+ ELFS+ G++K+IVMGLDK
Sbjct  19   EISQYRDQHFRGSRQLQEKSLKISSTLYVGNLSFYTTEEQIQELFSKCGDVKRIVMGLDK  78

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  79   IKKTPCGFCFV  89


 Score = 71.6 bits (174),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRGK+GGQVRDEYRTDYD GRGG+GK++Q +
Sbjct  116  TDWDAGFKEGRQYGRGKTGGQVRDEYRTDYDVGRGGFGKIIQMQ  159



>ref|XP_975066.2| PREDICTED: nuclear cap-binding protein subunit 2 [Tribolium castaneum]
Length=182

 Score =   103 bits (258),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ F+GT+ E +  L  STT+YVGN+SFYTTEEQ+YELFS+ G+I+++VMGLDK
Sbjct  10   ELSSYRDQHFKGTRAEQDRLLRLSTTLYVGNLSFYTTEEQIYELFSKCGDIRRVVMGLDK  69

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  70   YKKTPCGFCFV  80


 Score = 67.4 bits (163),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGK  517
             D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYG+
Sbjct  107  TDWDAGFVEGRQYGRGKTGGQVRDEYRTDYDSGRGGYGQ  145



>ref|XP_004392931.1| PREDICTED: nuclear cap-binding protein subunit 2-like isoform 
1 [Odobenus rosmarus divergens]
Length=156

 Score =   105 bits (261),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK 
Sbjct  17   LSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKM  76

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  77   KKTACGFCFV  86


 Score = 66.2 bits (160),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GR GYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRRGYGKLAQNQ  156



>emb|CDJ87529.1| unnamed protein product [Haemonchus contortus]
Length=270

 Score =   111 bits (278),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -2

Query  908  SAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNS  729
            ++YRD RFQGT++E E+AL  STT+YVGN+SFYTTE+Q++ELF+RAG++++++MGLD+  
Sbjct  47   NSYRDNRFQGTRKELEQALRTSTTLYVGNLSFYTTEDQIFELFTRAGDVRRVIMGLDRYR  106

Query  728  RTPCGFCFVI  699
            +TPCGFCFV+
Sbjct  107  KTPCGFCFVV  116


 Score = 59.7 bits (143),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQL  481
            DFD GF EGRQ+GRGK GGQVRDEYR  YD  RGGYG+  Q   E  + L
Sbjct  143  DFDAGFKEGRQYGRGKHGGQVRDEYRETYDADRGGYGRDKQDRDEYLKNL  192



>ref|NP_001232044.1| nuclear cap-binding protein subunit 2 [Taeniopygia guttata]
 ref|XP_005484573.1| PREDICTED: nuclear cap-binding protein subunit 2-like isoform 
X1 [Zonotrichia albicollis]
 ref|XP_005527518.1| PREDICTED: nuclear cap-binding protein subunit 2-like isoform 
X1 [Pseudopodoces humilis]
 ref|XP_009097689.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Serinus 
canaria]
 ref|XP_010563583.1| PREDICTED: nuclear cap-binding protein subunit 2 [Haliaeetus 
leucocephalus]
 sp|B5G279.1|NCBP2_TAEGU RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Taeniopygia guttata]
 gb|ACH45390.1| putative nuclear cap binding protein subunit 2 variant 1 [Taeniopygia 
guttata]
Length=168

 Score = 99.8 bits (247),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            +IS YRD+ F+G+++  E++L  S+T+YVGN+SFYTTEEQ+ ELFS+ G++K+IVMGLDK
Sbjct  19   EISQYRDQHFRGSRQLQEKSLKISSTLYVGNLSFYTTEEQIQELFSKCGDVKRIVMGLDK  78

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  79   IKKTPCGFCFV  89


 Score = 71.6 bits (174),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRGK+GGQVRDEYRTDYD GRGG+GK++Q +
Sbjct  116  TDWDAGFKEGRQYGRGKTGGQVRDEYRTDYDVGRGGFGKIIQMQ  159



>ref|NP_001155582.1| nuclear cap-binding protein subunit 2-like [Acyrthosiphon pisum]
 ref|XP_008184835.1| PREDICTED: nuclear cap-binding protein subunit 2-like isoform 
X1 [Acyrthosiphon pisum]
 dbj|BAH72824.1| ACYPI004714 [Acyrthosiphon pisum]
Length=159

 Score =   102 bits (254),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            + +S+YRD+ F+G++ E ++ L  STT+Y+GN++FYTTE Q+YELFS+ G+IK+IVMGLD
Sbjct  2    TDVSSYRDQHFKGSRGELDKILRLSTTIYIGNLAFYTTEGQIYELFSKCGDIKRIVMGLD  61

Query  737  KNSRTPCGFCFV  702
            K  +TPCGFCF+
Sbjct  62   KFKKTPCGFCFI  73


 Score = 68.9 bits (167),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD GRGGYGK  Q
Sbjct  100  TDWDAGFIEGRQYGRGKTGGQVRDEYRTDYDIGRGGYGKNAQ  141



>emb|CDS11358.1| Putative Small subunit of nuclear cap-bindingFT protein complex 
[Absidia idahoensis var. thermophila]
Length=219

 Score =   107 bits (266),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -2

Query  908  SAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNS  729
            S YRD+++QG+  +F + L  + T+YVGN+SFYTTEEQ+YELFS+ GEIK+I+MGLD+N+
Sbjct  12   STYRDQQYQGSSNQFRDDLSTTATLYVGNLSFYTTEEQIYELFSKCGEIKRIIMGLDRNN  71

Query  728  RTPCGFCFV  702
            +TPCGFCFV
Sbjct  72   KTPCGFCFV  80


 Score = 63.9 bits (154),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQ  484
            D D GF EGRQ+GRG+SGGQVRDEYRT++D GRGG+G  ++  LE +R+
Sbjct  108  DLDPGFKEGRQFGRGRSGGQVRDEYRTEFDAGRGGWGHRMRMTLERERE  156



>ref|XP_312392.3| AGAP002547-PA [Anopheles gambiae str. PEST]
 sp|Q7QCB6.3|NCBP2_ANOGA RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Anopheles gambiae]
 gb|EAA07524.3| AGAP002547-PA [Anopheles gambiae str. PEST]
Length=163

 Score =   102 bits (254),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G++ E E+ L  S+T+YVGN+SFYTTEEQ++ELFSR G++++I+MGLDK 
Sbjct  15   LSKYRDQHFKGSRHEQEKLLRVSSTLYVGNLSFYTTEEQIHELFSRCGDVRRIIMGLDKF  74

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  75   KKTPCGFCFV  84


 Score = 68.6 bits (166),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
            D+D GF+EGRQ+GRGK+GGQVRDEYR D+D GRGGYGK+VQ
Sbjct  112  DWDAGFIEGRQYGRGKTGGQVRDEYRQDHDLGRGGYGKMVQ  152



>gb|ACO14906.1| Nuclear cap-binding protein subunit 2 [Caligus clemensi]
 gb|ACO15032.1| Nuclear cap-binding protein subunit 2 [Caligus clemensi]
Length=161

 Score = 97.4 bits (241),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = -2

Query  902  YRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNSRT  723
            YRD+ F+G++ E E+ L  STT+YVGN+SF+TTE Q+YELF + G++K+IVMGLDK  RT
Sbjct  17   YRDQHFKGSRNEQEKLLKHSTTLYVGNLSFFTTEGQLYELFGKCGDVKRIVMGLDKFKRT  76

Query  722  PCGFCFV  702
            PCGFCFV
Sbjct  77   PCGFCFV  83


 Score = 73.6 bits (179),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEA  493
             D+D GF+EGRQ+GRGKSGGQVRDEYRTDYD GRGGYG+L++++ E 
Sbjct  110  TDWDAGFIEGRQFGRGKSGGQVRDEYRTDYDTGRGGYGQLLRQKFEV  156



>ref|XP_008332614.1| PREDICTED: nuclear cap-binding protein subunit 2 [Cynoglossus 
semilaevis]
Length=164

 Score = 99.4 bits (246),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G ++E E+ L +S T+YVGN+SFYTTEEQV+ELFS++G++K+I++GLDK
Sbjct  15   EVSQYRDQHFKGNRKEQEKLLNQSNTLYVGNLSFYTTEEQVHELFSKSGDVKRIIIGLDK  74

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  75   VKKTACGFCFV  85


 Score = 71.6 bits (174),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q+
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKLAQQ  154



>emb|CDH58989.1| rna-binding domain-containing protein [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=219

 Score =   107 bits (266),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = -2

Query  908  SAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNS  729
            S YRD+++QG+  +F + L  + T+YVGN+SFYTTEEQ+YELFS+ GEIK+I+MGLD+N+
Sbjct  12   STYRDQQYQGSSNQFRDDLSTTATLYVGNLSFYTTEEQIYELFSKCGEIKRIIMGLDRNN  71

Query  728  RTPCGFCFV  702
            +TPCGFCFV
Sbjct  72   KTPCGFCFV  80


 Score = 63.5 bits (153),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQ  484
            D D GF EGRQ+GRG+SGGQVRDEYRT++D GRGG+G  ++  LE +R+
Sbjct  108  DLDPGFKEGRQFGRGRSGGQVRDEYRTEFDAGRGGWGHRMRLTLERERE  156



>ref|XP_007252633.1| PREDICTED: nuclear cap-binding protein subunit 2 [Astyanax mexicanus]
Length=164

 Score = 99.8 bits (247),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQVYELFS++G++K+IV+GLDK 
Sbjct  16   VSQYRDQHFKGNRYEQEKLLKQSNTLYVGNLSFYTTEEQVYELFSKSGDVKRIVIGLDKV  75

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  76   KKTACGFCFV  85


 Score = 71.2 bits (173),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKLAQ  153



>ref|XP_005923946.1| PREDICTED: nuclear cap-binding protein subunit 2-like isoform 
X1 [Haplochromis burtoni]
Length=191

 Score = 98.6 bits (244),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            IS YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQV+ELFS++G++K+I++GLDK 
Sbjct  43   ISQYRDQHFKGNRYEQEKLLKQSNTLYVGNLSFYTTEEQVHELFSKSGDVKRIIIGLDKI  102

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  103  KKTACGFCFV  112


 Score = 72.0 bits (175),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q+
Sbjct  139  TDWDAGFKEGRQFGRGKSGGQVRDEYRQDYDPARGGYGKLAQQ  181



>ref|XP_002055508.1| GJ18756 [Drosophila virilis]
 sp|B4M205.1|NCB2A_DROVI RecName: Full=Nuclear cap-binding protein subunit 2-A; AltName: 
Full=20 kDa nuclear cap-binding protein A; AltName: Full=NCBP 
20 kDa subunit A; Short=CBP20-A [Drosophila virilis]
 gb|EDW65709.1| GJ18756 [Drosophila virilis]
Length=154

 Score = 99.0 bits (245),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S+YRD+ ++G++ E E +L  S+T+YVGN+SFYT EEQ++ELFSR G+++ IVMGLDK
Sbjct  6    ELSSYRDQHYKGSRFEQERSLRDSSTLYVGNLSFYTAEEQIHELFSRCGDVRMIVMGLDK  65

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  66   YKKTPCGFCFV  76


 Score = 71.6 bits (174),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKEL  499
            D+D GF+EGRQ+GRGK+GGQVRDEYRTDYD  RGGYGKL+ +++
Sbjct  104  DWDAGFIEGRQYGRGKTGGQVRDEYRTDYDAARGGYGKLLTQKI  147



>gb|ETN63045.1| nuclear cap-binding protein subunit 2 [Anopheles darlingi]
Length=163

 Score =   102 bits (254),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G++ E E+ L  S T+YVGN+SFYTTEEQ++ELFSR G++++IVMGLDK 
Sbjct  15   LSKYRDQHFKGSRHEQEKLLRLSATLYVGNLSFYTTEEQIHELFSRCGDVRRIVMGLDKF  74

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  75   KKTPCGFCFV  84


 Score = 68.2 bits (165),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
            D+D GF+EGRQ+GRGK+GGQVRDEYR D+D GRGGYGK+VQ
Sbjct  112  DWDAGFVEGRQYGRGKTGGQVRDEYRQDHDLGRGGYGKMVQ  152



>ref|XP_001657521.1| AAEL006135-PA [Aedes aegypti]
 sp|Q177H0.1|NCBP2_AEDAE RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Aedes aegypti]
 gb|EAT42307.1| AAEL006135-PA [Aedes aegypti]
Length=159

 Score =   101 bits (252),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G++ E E  L  ++T+Y+GN+SFYTTEEQ++ELFSR G+I++IVMGLDK 
Sbjct  11   LSKYRDQHFKGSRHEQERLLRLTSTLYIGNLSFYTTEEQIHELFSRCGDIRRIVMGLDKF  70

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  71   KKTPCGFCFV  80


 Score = 68.9 bits (167),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
            D+D GF+EGRQ+GRGKSGGQVRDEYR D+D GRGGYGK+VQ
Sbjct  108  DWDAGFVEGRQYGRGKSGGQVRDEYRQDHDLGRGGYGKMVQ  148



>ref|XP_010870827.1| PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Esox 
lucius]
Length=164

 Score = 99.4 bits (246),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQVYELFS++G++K+I++GLDK 
Sbjct  16   VSQYRDQHFKGNRYEQEKLLKQSNTLYVGNLSFYTTEEQVYELFSKSGDVKRIIIGLDKV  75

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  76   KKTACGFCFV  85


 Score = 71.2 bits (173),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKLAQ  153



>gb|KHJ88245.1| hypothetical protein OESDEN_11964 [Oesophagostomum dentatum]
Length=176

 Score =   106 bits (265),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
              IS YRD+RFQG+ +E + AL  STT+Y+GN+SFYT+E+Q+YELF+RAGE+K+++MGLD
Sbjct  28   GNISEYRDQRFQGSLKEQDLALRTSTTLYIGNLSFYTSEDQLYELFNRAGEVKRVIMGLD  87

Query  737  KNSRTPCGFCFVI  699
            +  ++PCGFCFVI
Sbjct  88   RFKKSPCGFCFVI  100


 Score = 63.5 bits (153),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
            D+D GF+EGRQ+GRGK GGQVRDEYR  YDP RGG+G++ Q
Sbjct  127  DYDAGFVEGRQYGRGKHGGQVRDEYREQYDPDRGGFGRIYQ  167



>gb|EYB98803.1| hypothetical protein Y032_0128g1452 [Ancylostoma ceylanicum]
Length=176

 Score =   106 bits (265),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
              IS YRD+RFQG+ +E + AL  STT+Y+GN+SFYT+E+Q+YELF+RAGE+K+++MGLD
Sbjct  28   GNISEYRDQRFQGSLKEQDLALRTSTTLYIGNLSFYTSEDQLYELFNRAGEVKRVIMGLD  87

Query  737  KNSRTPCGFCFVI  699
            +  ++PCGFCFVI
Sbjct  88   RFKKSPCGFCFVI  100


 Score = 63.5 bits (153),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ-KELEA  493
            D+D GF+EGRQ+GRGK GGQVRDEYR  YDP RGG+G++ Q +EL+ 
Sbjct  127  DYDAGFVEGRQYGRGKHGGQVRDEYREQYDPDRGGFGRIYQDRELKT  173



>ref|XP_005737000.1| PREDICTED: nuclear cap-binding protein subunit 2-like isoform 
X1 [Pundamilia nyererei]
Length=164

 Score = 98.6 bits (244),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            IS YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQV+ELFS++G++K+I++GLDK 
Sbjct  16   ISQYRDQHFKGNRYEQEKLLKQSNTLYVGNLSFYTTEEQVHELFSKSGDVKRIIIGLDKV  75

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  76   KKTACGFCFV  85


 Score = 71.6 bits (174),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q+
Sbjct  112  TDWDAGFKEGRQFGRGKSGGQVRDEYRQDYDPARGGYGKLAQQ  154



>ref|XP_006927128.1| PREDICTED: LOW QUALITY PROTEIN: nuclear cap binding protein subunit 
2, 20kDa [Pteropus alecto]
Length=156

 Score =   100 bits (250),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G  EE E+ L KS T+YVGN+SFY TEE +YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYITEEXIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   MKKTACGFCFV  86


 Score = 69.3 bits (168),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGKL Q +
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ  156



>ref|XP_005286082.1| PREDICTED: nuclear cap-binding protein subunit 2 [Chrysemys picta 
bellii]
Length=168

 Score = 97.8 bits (242),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            +IS YRD+ F+G++   E+AL  S T+YVGN+SFYTTEEQ+ ELFS+ G++K+IVMGLDK
Sbjct  19   EISQYRDQHFRGSRYLQEKALKFSCTLYVGNLSFYTTEEQIQELFSKCGDVKRIVMGLDK  78

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  79   VKKTPCGFCFV  89


 Score = 72.4 bits (176),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLV  478
             D+D GF EGRQ+GRGK+GGQVRDEYRTDYD GRGG+GK++Q +    + ++
Sbjct  116  TDWDAGFKEGRQFGRGKTGGQVRDEYRTDYDVGRGGFGKIIQMQKTNHQTII  167



>ref|XP_005989454.1| PREDICTED: nuclear cap-binding protein subunit 2 [Latimeria chalumnae]
Length=164

 Score = 99.4 bits (246),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            +IS YRD+ F+G + E E+ L  S T+YVGN+SFYTTEEQ+YELFS++G++K+IVMG+DK
Sbjct  15   EISQYRDQHFKGNRYEQEKLLKSSCTLYVGNLSFYTTEEQIYELFSKSGDVKRIVMGIDK  74

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  75   IKKTACGFCFV  85


 Score = 70.9 bits (172),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF EGRQ+GRGKSGGQVRDEYR DYD GRGGYGK+VQ
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDLGRGGYGKIVQ  153



>ref|XP_003138855.1| nuclear cap binding protein subunit 2 [Loa loa]
 gb|EFO25212.1| nuclear cap binding protein subunit 2 [Loa loa]
Length=160

 Score =   105 bits (263),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            S +  YRD+RF+G+  E E+ LL S T+YVGN+S+YTTEEQ YELFSRAG+IK+I+MG+D
Sbjct  14   SSLGPYRDQRFKGSLREQEKLLLNSKTLYVGNLSYYTTEEQTYELFSRAGDIKRIIMGID  73

Query  737  KNSRTPCGFCFV  702
            +  +TPCGFCFV
Sbjct  74   RFKKTPCGFCFV  85


 Score = 63.9 bits (154),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLV  511
             D+D GF+EGRQ+GRGK GGQVRDEYR DYDPGRGG+ +++
Sbjct  112  TDWDAGFVEGRQYGRGKHGGQVRDEYRKDYDPGRGGWNRVI  152



>ref|XP_007897111.1| PREDICTED: nuclear cap-binding protein subunit 2 [Callorhinchus 
milii]
Length=164

 Score = 96.7 bits (239),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G++ + E  L  S T+YVGN+SFYTTEEQ+YELFS++G++K+I+MGLDK
Sbjct  15   ELSQYRDQHFRGSRCDQERLLRNSCTLYVGNLSFYTTEEQIYELFSKSGDVKRIIMGLDK  74

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  75   IKKTSCGFCFV  85


 Score = 73.2 bits (178),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRGKSGGQVRDEYRTD+D GRGG+GKLVQ +
Sbjct  112  TDWDTGFKEGRQFGRGKSGGQVRDEYRTDFDAGRGGFGKLVQMQ  155



>ref|XP_003458995.1| PREDICTED: nuclear cap-binding protein subunit 2-like isoform 
X1 [Oreochromis niloticus]
Length=164

 Score = 98.6 bits (244),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            IS YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQV+ELFS++G++K+I++GLDK 
Sbjct  16   ISQYRDQHFKGNRYEQEKLLKQSNTLYVGNLSFYTTEEQVHELFSKSGDVKRIIIGLDKI  75

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  76   KKTACGFCFV  85


 Score = 71.6 bits (174),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q+
Sbjct  112  TDWDAGFKEGRQFGRGKSGGQVRDEYRQDYDPARGGYGKLAQQ  154



>ref|XP_003769622.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Sarcophilus 
harrisii]
Length=156

 Score =   100 bits (249),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++  YRD+ F+G  ++ E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELGWYRDQHFRGKMDDQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   VKKTACGFCFV  86


 Score = 69.3 bits (168),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGK+VQ +
Sbjct  113  TDWDAGFREGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKIVQNQ  156



>ref|XP_004640072.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Octodon 
degus]
Length=156

 Score =   101 bits (252),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S Y+D  F G  EE E+ L KS T+YVGN+SFYTTEEQ+YELFS++G+IKKI+MGLDK
Sbjct  16   ELSQYQDLHFWGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  76   LKKTACGFCFV  86


 Score = 68.6 bits (166),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR D+D GRGGYGKL QK+
Sbjct  113  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDHDAGRGGYGKLAQKQ  156



>ref|XP_008304825.1| PREDICTED: nuclear cap-binding protein subunit 2 [Stegastes partitus]
Length=164

 Score = 98.2 bits (243),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQV+ELFS++G++K+I++GLDK 
Sbjct  16   VSQYRDQHFKGNRYEQEKLLKQSNTLYVGNLSFYTTEEQVHELFSKSGDVKRIIIGLDKI  75

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  76   KKTACGFCFV  85


 Score = 71.6 bits (174),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q+
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKLAQQ  154



>sp|Q8JGR6.2|NCBP2_DANRE RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Danio rerio]
Length=155

 Score = 95.9 bits (237),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQV+ELF++ G++K+I++GLDK 
Sbjct  16   VSQYRDQHFKGNRYEQEKLLKQSATLYVGNLSFYTTEEQVHELFAKCGDVKRIIIGLDKI  75

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  76   KKTACGFCFV  85


 Score = 73.9 bits (180),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGK+VQK
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKMVQK  154



>ref|XP_005808853.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Xiphophorus 
maculatus]
Length=164

 Score = 97.1 bits (240),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            +++S YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQV+ELFS+ G++K+I++GLD
Sbjct  14   TEVSQYRDQHFKGNRYEQEKLLKQSNTLYVGNLSFYTTEEQVHELFSKCGDVKRIIIGLD  73

Query  737  KNSRTPCGFCFV  702
            K  +T CGFCFV
Sbjct  74   KIKKTACGFCFV  85


 Score = 72.4 bits (176),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQR  487
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q+    +R
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKLAQQHRSTER  160



>ref|XP_001845223.1| nuclear cap-binding protein subunit 2 [Culex quinquefasciatus]
 sp|B0W939.1|NCBP2_CULQU RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Culex quinquefasciatus]
 gb|EDS39736.1| nuclear cap-binding protein subunit 2 [Culex quinquefasciatus]
Length=160

 Score =   103 bits (256),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G++ E E  L  S+T+Y+GN+SFYTTEEQ++ELFSR G+I++IVMGLDK 
Sbjct  11   LSKYRDQHFKGSRHEQERLLRNSSTLYIGNLSFYTTEEQIHELFSRCGDIRRIVMGLDKF  70

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  71   KKTPCGFCFV  80


 Score = 66.2 bits (160),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLV  511
            D+D GF+EGRQ+GRGK+GGQVRDEYR D+D GRGGYGK+V
Sbjct  108  DWDAGFVEGRQYGRGKTGGQVRDEYRQDHDLGRGGYGKMV  147



>ref|NP_001006430.1| nuclear cap-binding protein subunit 2 [Gallus gallus]
 sp|Q5ZKR5.1|NCBP2_CHICK RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Gallus gallus]
 emb|CAG31678.1| hypothetical protein RCJMB04_9i16 [Gallus gallus]
Length=168

 Score = 97.4 bits (241),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            +IS YRD+ F+G+++  E+ L  S+T+YVGN+SFYTTEEQ+ ELFS+ G++K+IVMGLDK
Sbjct  19   EISRYRDQHFRGSKKLQEKFLKISSTLYVGNLSFYTTEEQIQELFSKCGDVKRIVMGLDK  78

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  79   IKKTPCGFCFV  89


 Score = 72.0 bits (175),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLV  478
             D+D GF EGRQ+GRGK+GGQVRDEYRTDYD GRGG+GK++Q +   Q+  V
Sbjct  116  TDWDAGFKEGRQYGRGKTGGQVRDEYRTDYDVGRGGFGKIIQMQKANQQPAV  167



>ref|XP_007540685.1| PREDICTED: nuclear cap-binding protein subunit 2 [Poecilia formosa]
Length=164

 Score = 97.1 bits (240),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQV+ELFS+ G++K+I++GLDK
Sbjct  15   EVSQYRDQHFKGNRYEQEKLLKQSNTLYVGNLSFYTTEEQVHELFSKCGDVKRIIIGLDK  74

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  75   VKKTACGFCFV  85


 Score = 72.4 bits (176),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQR  487
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q+    +R
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKLAQQHRSTER  160



>ref|XP_010752640.1| PREDICTED: nuclear cap-binding protein subunit 2 [Larimichthys 
crocea]
Length=164

 Score = 97.4 bits (241),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQV+ELFS++G++K+I++GLDK 
Sbjct  16   VSQYRDQHFKGNRYEQEKLLKQSHTLYVGNLSFYTTEEQVHELFSKSGDVKRIIIGLDKV  75

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  76   KKTACGFCFV  85


 Score = 71.6 bits (174),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q+
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKLAQQ  154



>gb|EFX66775.1| hypothetical protein DAPPUDRAFT_231808 [Daphnia pulex]
Length=152

 Score = 98.2 bits (243),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -2

Query  908  SAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNS  729
            S YRD+ F+G++ E E  L +S T+YVGN+SF+TTEEQ++ELF + G++K+I+MGLDK +
Sbjct  5    STYRDQHFKGSRVEQERLLSQSCTLYVGNLSFFTTEEQIHELFGKCGDVKRIIMGLDKFT  64

Query  728  RTPCGFCFV  702
            RTPCGFCFV
Sbjct  65   RTPCGFCFV  73


 Score = 70.9 bits (172),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEA  493
             D+D GF+EGRQ+GRGK+GGQVRDEYRTD+D GRGG+GK++Q+++  
Sbjct  100  TDWDAGFIEGRQYGRGKTGGQVRDEYRTDFDGGRGGWGKMIQQKVAT  146



>emb|CDJ82646.1| RNA recognition motif domain containing protein [Haemonchus contortus]
Length=173

 Score =   107 bits (266),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = -2

Query  917  SKISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLD  738
            ++IS YRD+RFQGT +E + AL  STT+Y+GN+SFYT+E+Q+YELF RAGE+K+I++GLD
Sbjct  28   TQISEYRDQRFQGTLKEQDLALRTSTTLYIGNLSFYTSEDQLYELFGRAGEVKRIIIGLD  87

Query  737  KNSRTPCGFCFVI  699
            +  ++PCGFCFVI
Sbjct  88   RFKKSPCGFCFVI  100


 Score = 62.0 bits (149),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
            D+D GF+EGRQ+GRG+ GGQVRDEYR  +DP RGGYGK+ Q
Sbjct  127  DYDAGFVEGRQYGRGRHGGQVRDEYREQFDPDRGGYGKIWQ  167



>ref|XP_005147075.1| PREDICTED: nuclear cap-binding protein subunit 2 [Melopsittacus 
undulatus]
Length=157

 Score =   102 bits (253),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+GT+ + E  L KS T+YVGN+SFYTTEEQ++ELF ++G+IKK++MGLDK 
Sbjct  18   LSQYRDQHFRGTRYDQERLLRKSCTLYVGNLSFYTTEEQIHELFGKSGDIKKVIMGLDKV  77

Query  731  SRTPCGFCFV  702
             +TPCGFCFV
Sbjct  78   KKTPCGFCFV  87


 Score = 67.0 bits (162),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGK VQ +
Sbjct  114  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKNVQCQ  157



>ref|XP_008404481.1| PREDICTED: nuclear cap-binding protein subunit 2 [Poecilia reticulata]
Length=164

 Score = 96.7 bits (239),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQV+ELFS+ G++K+I++GLDK
Sbjct  15   EVSQYRDQHFKGNRYEQEKLLKQSNTLYVGNLSFYTTEEQVHELFSKCGDVKRIIIGLDK  74

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  75   IKKTACGFCFV  85


 Score = 72.4 bits (176),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQR  487
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q+    +R
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKLAQQHRSTER  160



>gb|ACO14652.1| Nuclear cap-binding protein subunit 2 [Caligus clemensi]
Length=161

 Score = 95.5 bits (236),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = -2

Query  902  YRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNSRT  723
            YRD+ F+G++ E E+ L  STT+YVGN+SF+TTE Q+YELF + G++K+ VMGLDK  RT
Sbjct  17   YRDQHFKGSRNEQEKLLKHSTTLYVGNLSFFTTEGQLYELFGKCGDVKRFVMGLDKFKRT  76

Query  722  PCGFCFV  702
            PCGFCFV
Sbjct  77   PCGFCFV  83


 Score = 73.6 bits (179),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEA  493
             D+D GF+EGRQ+GRGKSGGQVRDEYRTDYD GRGGYG+L++++ E 
Sbjct  110  TDWDAGFIEGRQFGRGKSGGQVRDEYRTDYDTGRGGYGQLLRQKFEV  156



>ref|NP_001167476.1| nuclear cap binding protein subunit 2, 20kDa [Xenopus laevis]
 sp|P52299.2|NCBP2_XENLA RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Xenopus laevis]
 gb|AAH72902.1| Unknown (protein for MGC:80352) [Xenopus laevis]
Length=153

 Score = 98.2 bits (243),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G + + E  L +S T+YVGN+SFYTTEEQ++ELFS++G++K+IVMGLDK 
Sbjct  14   LSQYRDQHFRGNRSDQESLLKQSCTLYVGNLSFYTTEEQIHELFSKSGDVKRIVMGLDKV  73

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  74   KKTACGFCFV  83


 Score = 70.9 bits (172),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 34/42 (81%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF EGRQ+GRGKSGGQVRDEYR DYD GRGGYGK+VQ
Sbjct  110  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDAGRGGYGKVVQ  151



>ref|XP_002741239.1| PREDICTED: nuclear cap-binding protein subunit 2-like [Saccoglossus 
kowalevskii]
Length=172

 Score = 99.0 bits (245),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++++YRD+ F+GT  E E  L  S+T+Y+GN+SFYTTEEQ++ELFS+ G++K+I+MGLDK
Sbjct  16   ELTSYRDQHFKGTLTEQEYRLSTSSTLYLGNLSFYTTEEQIHELFSKCGDLKRIIMGLDK  75

Query  734  NSRTPCGFCFV  702
              +TPCGFCFV
Sbjct  76   VKKTPCGFCFV  86


 Score = 69.7 bits (169),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLV  478
             D+D GF+EGRQ+GRGKSGGQVRDEYRTDYD GRGGYGK   ++    + ++
Sbjct  113  TDWDAGFIEGRQYGRGKSGGQVRDEYRTDYDSGRGGYGKAALRQQHTPQDII  164



>ref|NP_001290613.1| nuclear cap-binding protein subunit 2 [Esox lucius]
 sp|C1BY64.1|NCBP2_ESOLU RecName: Full=Nuclear cap-binding protein subunit 2; AltName: 
Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 
20 kDa subunit; Short=CBP20 [Esox lucius]
 gb|ACO13967.1| Nuclear cap-binding protein subunit 2 [Esox lucius]
Length=155

 Score = 99.0 bits (245),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  911  ISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKN  732
            +S YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQVYELFS++G++K+I++GLDK 
Sbjct  16   VSQYRDQHFKGNRYEQEKLLKQSNTLYVGNLSFYTTEEQVYELFSKSGDVKRIIIGLDKV  75

Query  731  SRTPCGFCFV  702
             +T CGFCFV
Sbjct  76   KKTACGFCFV  85


 Score = 69.7 bits (169),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQK  505
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGK+V +
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKVVAR  154



>gb|ACN31065.1| unknown [Zea mays]
Length=216

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 92/131 (70%), Gaps = 18/131 (14%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQLVDYGTGSLGN  451
            DFDWGF EGRQWGRG+SGGQVRDEYRTDYDPGRGGYGK+VQ+ELEAQR+LVDYG    G+
Sbjct  81   DFDWGFEEGRQWGRGRSGGQVRDEYRTDYDPGRGGYGKMVQRELEAQRELVDYG----GS  136

Query  450  FPPVMAPQY---GRQGGHGGSYRHGR-DYYRKRHR-EDDRHRLDYSKRVYRREPVRDSDH  286
            F P   P Y    R+ G+G S+R+ R DY RKR+R  DDR   + SKR    +P      
Sbjct  137  FQPNAPPPYERGERKRGYGDSHRNDRGDYQRKRYRSSDDRSAPEESKRAPDSDPA-----  191

Query  285  EARPEKNPRFR  253
                EKNPRFR
Sbjct  192  ----EKNPRFR  198



>ref|XP_004068089.1| PREDICTED: nuclear cap-binding protein subunit 2 [Oryzias latipes]
Length=164

 Score = 95.9 bits (237),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G + E E+ L +S T+YVGN+SFYTTEEQV+ELF++ G++K+I++GLDK
Sbjct  15   EVSQYRDQHFKGNRYEQEKLLKQSNTLYVGNLSFYTTEEQVHELFAKCGDVKRIIIGLDK  74

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  75   VKKTACGFCFV  85


 Score = 72.4 bits (176),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKE  502
             D+D GF EGRQ+GRGKSGGQVRDEYR DYDP RGGYGKL Q++
Sbjct  112  TDWDAGFKEGRQYGRGKSGGQVRDEYRQDYDPARGGYGKLAQQQ  155



>emb|CEJ03570.1| Putative Genomic scaffold, msy_sf_27 [Rhizopus microsporus]
Length=219

 Score =   100 bits (248),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -2

Query  908  SAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNS  729
            S+YRD+ +QG+  +  + L  + T+YVGN+SF+TTEEQ+YELFS+ GEIK+I+MGLD++ 
Sbjct  12   SSYRDQLYQGSSNQLTDDLSTTATLYVGNLSFFTTEEQIYELFSKCGEIKRIIMGLDRHQ  71

Query  728  RTPCGFCFV  702
            +TPCGFCFV
Sbjct  72   KTPCGFCFV  80


 Score = 68.2 bits (165),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQ  484
            D D GF EGRQ+GRGKSGGQVRDEYRT+YD GRGG+G  ++ ELE  R+
Sbjct  108  DLDPGFREGRQFGRGKSGGQVRDEYRTEYDAGRGGWGHRMRMELERNRE  156



>ref|XP_005314260.1| PREDICTED: nuclear cap-binding protein subunit 2 [Chrysemys picta 
bellii]
 ref|XP_007066672.1| PREDICTED: nuclear cap-binding protein subunit 2 [Chelonia mydas]
Length=157

 Score = 99.0 bits (245),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  914  KISAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDK  735
            ++S YRD+ F+G + + E  L KS T+YVGN+SFYTTEEQ+YELF ++G+IKKI+MGLDK
Sbjct  17   ELSQYRDQHFRGNRYDQERLLKKSCTLYVGNLSFYTTEEQIYELFGKSGDIKKIIMGLDK  76

Query  734  NSRTPCGFCFV  702
              +T CGFCFV
Sbjct  77   VKKTACGFCFV  87


 Score = 69.3 bits (168),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -1

Query  633  PDFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQ  508
             D+D GF EGRQ+GRG+SGGQVRDEYR DYD GRGGYGK+VQ
Sbjct  114  TDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKVVQ  155



>emb|CEI96241.1| Putative Nuclear cap-binding protein subunit 2 [Rhizopus microsporus]
Length=219

 Score =   100 bits (248),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -2

Query  908  SAYRDRRFQGTQEEFEEALLKSTTVYVGNMSFYTTEEQVYELFSRAGEIKKIVMGLDKNS  729
            S+YRD+ +QG+  +  + L  + T+YVGN+SF+TTEEQ+YELFS+ GEIK+I+MGLD++ 
Sbjct  12   SSYRDQLYQGSSNQLTDDLSTTATLYVGNLSFFTTEEQIYELFSKCGEIKRIIMGLDRHQ  71

Query  728  RTPCGFCFV  702
            +TPCGFCFV
Sbjct  72   KTPCGFCFV  80


 Score = 68.2 bits (165),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -1

Query  630  DFDWGFMEGRQWGRGKSGGQVRDEYRTDYDPGRGGYGKLVQKELEAQRQ  484
            D D GF EGRQ+GRGKSGGQVRDEYRT+YD GRGG+G  ++ ELE  R+
Sbjct  108  DLDPGFREGRQFGRGKSGGQVRDEYRTEYDAGRGGWGHRMRMELERNRE  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2078181867610