BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF039G18

Length=889
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002282422.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    515   0.0      Vitis vinifera
gb|ACN88684.2|  GDP-D-mannose pyrophosphorylase                         512   7e-180   Malus domestica [apple tree]
ref|XP_008371997.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    511   3e-179   Malus domestica [apple tree]
dbj|BAP75927.1|  GDP-mannose pyrophosphorylase                          511   3e-179   Moringa oleifera [maranga]
ref|XP_009594230.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    511   4e-179   Nicotiana tomentosiformis
ref|XP_004490906.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    511   4e-179   Cicer arietinum [garbanzo]
gb|EYU19947.1|  hypothetical protein MIMGU_mgv1a008833mg                511   5e-179   Erythranthe guttata [common monkey flower]
gb|ABI48955.1|  GDP-D-mannose pyrophosphorylase                         510   8e-179   Viola baoshanensis
gb|KJB74050.1|  hypothetical protein B456_011G269100                    509   2e-178   Gossypium raimondii
ref|XP_009759296.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    509   3e-178   Nicotiana sylvestris
gb|AIN40499.1|  GDP-D-mannose pyrophosphorylase                         509   3e-178   Ziziphus jujuba [Chinese jujube]
ref|XP_002524227.1|  mannose-1-phosphate guanyltransferase, putative    508   4e-178   Ricinus communis
ref|XP_011076786.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    508   4e-178   Sesamum indicum [beniseed]
ref|XP_009592609.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    508   5e-178   Nicotiana tomentosiformis
ref|XP_009797660.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    508   5e-178   Nicotiana sylvestris
gb|AFK47417.1|  unknown                                                 508   6e-178   Lotus japonicus
ref|NP_001275205.1|  GDP-mannose pyrophosphorylase                      508   9e-178   Solanum tuberosum [potatoes]
gb|ACN38266.1|  GDP-D-mannose pyrophosphorylase                         508   9e-178   Actinidia latifolia
ref|NP_001234025.1|  GDP-mannose pyrophosphorylase                      507   1e-177   Solanum lycopersicum
gb|ABB53473.1|  GDP-mannose pyrophosphorylase                           507   2e-177   Malpighia glabra [acerola]
dbj|BAB62108.1|  GDP-D-mannose pyrophosphorylase                        507   2e-177   Nicotiana tabacum [American tobacco]
ref|XP_010095035.1|  Mannose-1-phosphate guanylyltransferase 1          507   2e-177   Morus notabilis
ref|XP_009343927.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    506   2e-177   Pyrus x bretschneideri [bai li]
gb|AGI78460.1|  GDP-D-mannose pyrophosphorylase                         506   3e-177   Camellia sinensis [black tea]
ref|XP_003616475.1|  Mannose-1-phosphate guanyltransferase              506   4e-177   Medicago truncatula
ref|XP_011036070.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    506   6e-177   Populus euphratica
ref|XP_007218178.1|  hypothetical protein PRUPE_ppa007618mg             505   7e-177   Prunus persica
ref|XP_002316262.1|  cytokinesis defective 1 family protein             504   2e-176   Populus trichocarpa [western balsam poplar]
ref|XP_007009211.1|  Glucose-1-phosphate adenylyltransferase fami...    504   2e-176   Theobroma cacao [chocolate]
ref|XP_007009215.1|  Glucose-1-phosphate adenylyltransferase fami...    504   2e-176   
ref|XP_004240924.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    504   3e-176   Solanum lycopersicum
ref|XP_007009213.1|  Glucose-1-phosphate adenylyltransferase fami...    504   3e-176   
gb|KDP44883.1|  hypothetical protein JCGZ_01383                         503   4e-176   Jatropha curcas
ref|XP_006338820.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    503   4e-176   Solanum tuberosum [potatoes]
ref|XP_010256792.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    503   5e-176   Nelumbo nucifera [Indian lotus]
gb|KDO69186.1|  hypothetical protein CISIN_1g018060mg                   501   5e-176   Citrus sinensis [apfelsine]
ref|XP_010067451.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    503   5e-176   Eucalyptus grandis [rose gum]
gb|KDO69184.1|  hypothetical protein CISIN_1g018060mg                   503   8e-176   Citrus sinensis [apfelsine]
ref|XP_006435610.1|  hypothetical protein CICLE_v10033733mg             502   1e-175   Citrus clementina [clementine]
ref|NP_001234084.1|  GDP-mannose pyrophosphorylase                      502   1e-175   
ref|XP_008441398.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    501   3e-175   Cucumis melo [Oriental melon]
ref|XP_006486418.1|  PREDICTED: probable mannose-1-phosphate guan...    501   4e-175   Citrus sinensis [apfelsine]
ref|XP_004307574.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    501   5e-175   Fragaria vesca subsp. vesca
ref|XP_002311190.1|  cytokinesis defective 1 family protein             500   6e-175   Populus trichocarpa [western balsam poplar]
ref|XP_011035050.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    500   6e-175   Populus euphratica
ref|XP_010691388.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    499   1e-174   Beta vulgaris subsp. vulgaris [field beet]
gb|AET14212.1|  GDP-D-mannose pyrophosphorylase                         498   2e-174   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009133383.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    498   4e-174   Brassica rapa
gb|ADV59923.1|  putative GDP-mannose pyrophosphorylase                  498   5e-174   Citrus unshiu [satsuma mandarin]
ref|XP_004138454.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    498   6e-174   Cucumis sativus [cucumbers]
ref|XP_004970565.1|  PREDICTED: probable mannose-1-phosphate guan...    498   6e-174   Setaria italica
ref|NP_001276240.1|  mannose-1-phosphate guanylyltransferase 1-like     497   1e-173   Glycine max [soybeans]
ref|XP_006601845.1|  PREDICTED: uncharacterized protein LOC100818...    497   2e-173   
emb|CDY07636.1|  BnaA03g18750D                                          498   2e-173   Brassica napus [oilseed rape]
emb|CDP00140.1|  unnamed protein product                                496   3e-173   Coffea canephora [robusta coffee]
ref|XP_010554624.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    496   3e-173   Tarenaya hassleriana [spider flower]
gb|ACM90325.1|  GDP-D-mannose pyrophosphorylase                         492   3e-173   Ribes nigrum [European black currant]
ref|NP_001142302.1|  uncharacterized protein LOC100274471               496   5e-173   Zea mays [maize]
gb|KEH34762.1|  mannose-1-phosphate guanylyltransferase-like protein    492   1e-172   Medicago truncatula
ref|XP_004977599.1|  PREDICTED: probable mannose-1-phosphate guan...    494   1e-172   Setaria italica
ref|XP_010505663.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    494   2e-172   Camelina sativa [gold-of-pleasure]
emb|CDM85018.1|  unnamed protein product                                494   2e-172   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006294448.1|  hypothetical protein CARUB_v10023461mg             494   2e-172   
gb|ACR34770.1|  unknown                                                 492   2e-172   Zea mays [maize]
gb|ACW84415.1|  GDP-D-mannose pyrophosphorylase                         494   2e-172   Glycine max [soybeans]
ref|XP_003600761.1|  Mannose-1-phosphate guanyltransferase              494   2e-172   
ref|XP_006411211.1|  hypothetical protein EUTSA_v10016850mg             494   2e-172   Eutrema salsugineum [saltwater cress]
ref|XP_010534527.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    494   2e-172   Tarenaya hassleriana [spider flower]
ref|XP_002308180.1|  hypothetical protein POPTR_0006s09130g             494   2e-172   Populus trichocarpa [western balsam poplar]
ref|XP_007141846.1|  hypothetical protein PHAVU_008G230600g             493   5e-172   Phaseolus vulgaris [French bean]
ref|XP_002879816.1|  hypothetical protein ARALYDRAFT_483004             493   5e-172   
gb|EMT31032.1|  Mannose-1-phosphate guanyltransferase beta              493   5e-172   
ref|XP_010262630.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    493   6e-172   Nelumbo nucifera [Indian lotus]
ref|XP_009141836.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    493   6e-172   Brassica rapa
ref|XP_010931208.1|  PREDICTED: probable mannose-1-phosphate guan...    493   6e-172   Elaeis guineensis
ref|XP_008674826.1|  PREDICTED: probable mannose-1-phosphate guan...    493   7e-172   
ref|NP_181507.1|  GDP-mannose pyrophosphorylase/ mannose-1-pyroph...    493   7e-172   Arabidopsis thaliana [mouse-ear cress]
gb|KHN17882.1|  Mannose-1-phosphate guanylyltransferase 1               493   7e-172   Glycine soja [wild soybean]
gb|KDO69185.1|  hypothetical protein CISIN_1g018060mg                   492   1e-171   Citrus sinensis [apfelsine]
ref|XP_008777609.1|  PREDICTED: probable mannose-1-phosphate guan...    492   1e-171   Phoenix dactylifera
emb|CDP16056.1|  unnamed protein product                                492   1e-171   Coffea canephora [robusta coffee]
ref|XP_010088589.1|  Mannose-1-phosphate guanylyltransferase 1          492   1e-171   Morus notabilis
emb|CDY07033.1|  BnaA04g22820D                                          491   2e-171   
ref|NP_001240188.1|  mannose-1-phosphate guanylyltransferase 1-like     491   2e-171   Glycine max [soybeans]
gb|EMS68890.1|  Mannose-1-phosphate guanyltransferase beta              493   2e-171   Triticum urartu
gb|ACN66754.1|  GMP                                                     491   2e-171   Carica papaya [mamon]
emb|CDX93234.1|  BnaC04g46620D                                          491   2e-171   
gb|AHB17740.1|  GDP-mannose pyrophosphorylase                           491   3e-171   Pogonatherum paniceum
ref|XP_003544186.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    492   3e-171   
ref|XP_011019240.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    489   3e-171   Populus euphratica
ref|XP_002456631.1|  hypothetical protein SORBIDRAFT_03g039740          491   4e-171   Sorghum bicolor [broomcorn]
ref|XP_006649823.1|  PREDICTED: probable mannose-1-phosphate guan...    490   6e-171   Oryza brachyantha
ref|XP_010529799.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    489   1e-170   Tarenaya hassleriana [spider flower]
gb|KJB76778.1|  hypothetical protein B456_012G106900                    486   2e-170   Gossypium raimondii
gb|KJB76777.1|  hypothetical protein B456_012G106900                    488   3e-170   Gossypium raimondii
ref|XP_007026924.1|  Glucose-1-phosphate adenylyltransferase fami...    488   4e-170   
ref|XP_007026922.1|  Glucose-1-phosphate adenylyltransferase fami...    488   4e-170   
gb|KHG16049.1|  Mannose-1-phosphate guanyltransferase                   488   4e-170   Gossypium arboreum [tree cotton]
emb|CAC35355.1|  GDP-mannose pyrophosphorylase                          488   7e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008785513.1|  PREDICTED: probable mannose-1-phosphate guan...    487   8e-170   
gb|ACK87007.1|  GDP-mannose pyrophosphorylase                           487   1e-169   Carica papaya [mamon]
ref|XP_003564604.1|  PREDICTED: probable mannose-1-phosphate guan...    487   1e-169   Brachypodium distachyon [annual false brome]
dbj|BAJ95730.1|  predicted protein                                      487   2e-169   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001049673.1|  Os03g0268400                                       486   2e-169   
ref|XP_009412560.1|  PREDICTED: probable mannose-1-phosphate guan...    486   2e-169   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY89395.1|  hypothetical protein OsI_10901                          486   3e-169   Oryza sativa Indica Group [Indian rice]
ref|XP_003558261.1|  PREDICTED: probable mannose-1-phosphate guan...    486   4e-169   Brachypodium distachyon [annual false brome]
ref|XP_008803133.1|  PREDICTED: probable mannose-1-phosphate guan...    485   5e-169   Phoenix dactylifera
ref|XP_004984923.1|  PREDICTED: probable mannose-1-phosphate guan...    485   8e-169   Setaria italica
sp|Q6Z9A3.1|GMPP3_ORYSJ  RecName: Full=Probable mannose-1-phospha...    484   1e-168   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010923222.1|  PREDICTED: probable mannose-1-phosphate guan...    484   1e-168   Elaeis guineensis
ref|XP_009601713.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    484   2e-168   Nicotiana tomentosiformis
gb|KHG01639.1|  hypothetical protein F383_21310                         481   2e-168   Gossypium arboreum [tree cotton]
ref|XP_009407514.1|  PREDICTED: probable mannose-1-phosphate guan...    483   3e-168   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011085013.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    483   3e-168   Sesamum indicum [beniseed]
ref|XP_006429172.1|  hypothetical protein CICLE_v10012040mg             481   3e-168   Citrus clementina [clementine]
ref|XP_009143286.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    483   6e-168   Brassica rapa
emb|CDX74832.1|  BnaA05g05780D                                          482   9e-168   
ref|XP_009791580.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    482   9e-168   Nicotiana sylvestris
ref|XP_006429173.1|  hypothetical protein CICLE_v10012040mg             482   1e-167   
ref|XP_006645004.1|  PREDICTED: probable mannose-1-phosphate guan...    482   1e-167   Oryza brachyantha
ref|XP_010937548.1|  PREDICTED: probable mannose-1-phosphate guan...    481   2e-167   Elaeis guineensis
ref|NP_001044795.1|  Os01g0847200                                       481   2e-167   
gb|AHX74219.1|  GDP-mannose pyrophosphorylase                           481   4e-167   
gb|ABR15468.1|  GDP-mannose pyrophosphorylase                           480   4e-167   Pinus taeda
ref|XP_006493574.1|  PREDICTED: probable mannose-1-phosphate guan...    480   5e-167   Citrus sinensis [apfelsine]
tpg|DAA44592.1|  TPA: hypothetical protein ZEAMMB73_810828              478   7e-167   
gb|AFL69830.1|  mannose-1-phosphate guanyltransferase 1                 479   1e-166   Oryza sativa Indica Group [Indian rice]
gb|EPS66224.1|  hypothetical protein M569_08552                         479   1e-166   Genlisea aurea
ref|NP_001142215.1|  hypothetical protein                               479   2e-166   Zea mays [maize]
emb|CDY20480.1|  BnaC04g05640D                                          479   2e-166   Brassica napus [oilseed rape]
gb|AFL69832.1|  mannose-1-phosphate guanyltransferase 3                 478   4e-166   Oryza sativa Indica Group [Indian rice]
gb|AFL69833.1|  mannose-1-phosphate guanyltransferase 4                 478   4e-166   Oryza sativa Indica Group [Indian rice]
gb|KHN13115.1|  Mannose-1-phosphate guanylyltransferase 1               478   5e-166   Glycine soja [wild soybean]
gb|ABR17757.1|  unknown                                                 477   1e-165   Picea sitchensis
ref|XP_008801635.1|  PREDICTED: probable mannose-1-phosphate guan...    476   2e-165   Phoenix dactylifera
ref|XP_006340997.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    475   5e-165   Solanum tuberosum [potatoes]
ref|NP_001276259.1|  mannose-1-phosphate guanylyltransferase 1-like     474   9e-165   
ref|XP_004246437.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    473   3e-164   Solanum lycopersicum
ref|XP_009388596.1|  PREDICTED: probable mannose-1-phosphate guan...    472   1e-163   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011016812.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    471   2e-163   Populus euphratica
gb|ABK24420.1|  unknown                                                 470   6e-163   Picea sitchensis
gb|ABR15469.1|  GDP-mannose pyrophosphorylase                           467   6e-162   Pinus taeda
ref|NP_001242262.1|  uncharacterized protein LOC100818016               466   3e-161   
ref|XP_009387284.1|  PREDICTED: probable mannose-1-phosphate guan...    466   3e-161   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846369.1|  hypothetical protein AMTR_s00012p00262290          466   3e-161   Amborella trichopoda
ref|XP_008801637.1|  PREDICTED: probable mannose-1-phosphate guan...    465   3e-161   Phoenix dactylifera
ref|NP_191118.1|  probable mannose-1-phosphate guanylyltransferase 2    462   5e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427339.1|  PREDICTED: probable mannose-1-phosphate guan...    451   2e-155   
ref|XP_006846372.1|  hypothetical protein AMTR_s00012p00262630          449   8e-155   Amborella trichopoda
ref|XP_002990832.1|  hypothetical protein SELMODRAFT_185648             449   1e-154   Selaginella moellendorffii
ref|XP_001782193.1|  predicted protein                                  449   1e-154   
ref|XP_002974469.1|  hypothetical protein SELMODRAFT_267755             448   3e-154   Selaginella moellendorffii
ref|XP_001769404.1|  predicted protein                                  448   3e-154   
ref|XP_002966693.1|  hypothetical protein SELMODRAFT_168373             447   4e-154   Selaginella moellendorffii
gb|KJB76118.1|  hypothetical protein B456_012G072800                    446   4e-154   Gossypium raimondii
ref|XP_010412788.1|  PREDICTED: probable mannose-1-phosphate guan...    442   8e-152   Camelina sativa [gold-of-pleasure]
gb|AES92771.2|  mannose-1-phosphate guanyltransferase                   435   5e-150   Medicago truncatula
ref|XP_003610574.1|  Mannose-1-phosphate guanyltransferase              434   4e-149   
gb|ABK24789.1|  unknown                                                 427   7e-146   Picea sitchensis
ref|XP_002310933.1|  cytokinesis defective 1 family protein             424   1e-144   Populus trichocarpa [western balsam poplar]
gb|ACU20879.1|  unknown                                                 414   3e-142   Glycine max [soybeans]
ref|XP_011033044.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    412   4e-140   Populus euphratica
ref|XP_010438160.1|  PREDICTED: probable mannose-1-phosphate guan...    397   2e-134   Camelina sativa [gold-of-pleasure]
ref|XP_006408596.1|  hypothetical protein EUTSA_v10002042mg             395   5e-134   
gb|KFK29636.1|  hypothetical protein AALP_AA7G159400                    398   1e-133   Arabis alpina [alpine rockcress]
ref|XP_010432971.1|  PREDICTED: probable mannose-1-phosphate guan...    394   7e-133   Camelina sativa [gold-of-pleasure]
ref|XP_010432972.1|  PREDICTED: probable mannose-1-phosphate guan...    392   1e-132   
ref|XP_006284084.1|  hypothetical protein CARUB_v10005214mg             387   9e-131   
gb|KDP38962.1|  hypothetical protein JCGZ_00719                         384   3e-129   Jatropha curcas
ref|XP_010438164.1|  PREDICTED: probable mannose-1-phosphate guan...    383   6e-129   Camelina sativa [gold-of-pleasure]
ref|XP_010941227.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    381   5e-128   Elaeis guineensis
ref|NP_194786.1|  Glucose-1-phosphate adenylyltransferase family ...    380   6e-128   Arabidopsis thaliana [mouse-ear cress]
emb|CAB79775.1|  GDP-mannose pyrophosphorylase like protein             380   8e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799379.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    379   3e-127   Phoenix dactylifera
ref|XP_010275250.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    377   2e-126   Nelumbo nucifera [Indian lotus]
emb|CDX90770.1|  BnaA03g24500D                                          375   2e-125   
ref|XP_009134205.1|  PREDICTED: probable mannose-1-phosphate guan...    372   2e-124   Brassica rapa
ref|XP_001695916.1|  GDP-D-mannose pyrophosphorylase                    365   1e-121   Chlamydomonas reinhardtii
ref|XP_009137936.1|  PREDICTED: probable mannose-1-phosphate guan...    364   3e-121   Brassica rapa
emb|CDY39219.1|  BnaA03g50310D                                          363   4e-121   Brassica napus [oilseed rape]
emb|CDX72252.1|  BnaC07g42740D                                          362   8e-121   
gb|AGC69739.1|  mannose-1-phosphate guanylyltransferase                 359   2e-119   Tieghemostelium lacteum
ref|XP_002952855.1|  hypothetical protein VOLCADRAFT_81984              357   1e-118   Volvox carteri f. nagariensis
gb|EPZ31169.1|  Mannose-1-phosphate guanyltransferase                   357   1e-118   Rozella allomycis CSF55
gb|EFA80657.1|  mannose-1-phosphate guanylyltransferase                 355   6e-118   Heterostelium album PN500
ref|XP_003287195.1|  mannose-1-phosphate guanylyltransferase            355   8e-118   Dictyostelium purpureum
dbj|BAN16547.1|  ADB2008858                                             355   1e-117   Acytostelium subglobosum
ref|XP_008319281.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    355   1e-117   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004581526.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    354   2e-117   Ochotona princeps [southern American pika]
ref|XP_006010396.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    354   2e-117   Latimeria chalumnae
ref|XP_003500392.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    353   3e-117   
ref|XP_006892962.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    353   4e-117   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004368238.1|  GDPmannose pyrophosphorylase                       353   5e-117   Acanthamoeba castellanii str. Neff
ref|XP_637125.1|  mannose-1-phosphate guanylyltransferase               353   6e-117   Dictyostelium discoideum AX4
ref|XP_003448400.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    352   1e-116   Oreochromis niloticus
ref|XP_010755204.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    352   1e-116   
ref|XP_005347941.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    352   1e-116   Microtus ochrogaster [prairie voles]
ref|XP_003936705.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    352   1e-116   Saimiri boliviensis boliviensis
ref|XP_007446277.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    352   1e-116   Lipotes vexillifer [baiji]
sp|Q9Y5P6.2|GMPPB_HUMAN  RecName: Full=Mannose-1-phosphate guanyl...    352   2e-116   Homo sapiens [man]
emb|CBN80660.1|  Mannose-1-phosphate guanyltransferase beta             352   2e-116   Dicentrarchus labrax [European sea bass]
ref|XP_002758401.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    352   2e-116   Callithrix jacchus [common marmoset]
ref|XP_006783131.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    352   2e-116   Neolamprologus brichardi [lyretail cichlid]
emb|CDX90771.1|  BnaA03g24510D                                          351   3e-116   
ref|XP_004760688.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    351   3e-116   Mustela putorius furo [black ferret]
ref|XP_005547199.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   3e-116   Macaca fascicularis [crab eating macaque]
ref|NP_068806.1|  mannose-1-phosphate guanyltransferase beta isof...    351   3e-116   
gb|KGL86216.1|  Mannose-1-phosphate guanyltransferase beta              347   4e-116   Charadrius vociferus
ref|XP_006744594.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    350   5e-116   Leptonychotes weddellii
ref|NP_001087522.1|  mannose-1-phosphate guanyltransferase beta-A       350   5e-116   Xenopus laevis [clawed frog]
gb|KFM01180.1|  Mannose-1-phosphate guanyltransferase beta              347   5e-116   Aptenodytes forsteri
ref|XP_004399306.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    350   6e-116   Odobenus rosmarus divergens
ref|XP_003982282.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    350   6e-116   Felis catus [cat]
ref|XP_003894464.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    350   6e-116   Papio anubis [baboon]
ref|XP_004353971.1|  mannose-1-phosphate guanylyltransferase            350   7e-116   Cavenderia fasciculata
ref|XP_008702343.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   8e-116   Ursus maritimus [white bear]
ref|XP_004664300.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    350   9e-116   Jaculus jaculus
ref|NP_001252910.1|  mannose-1-phosphate guanyltransferase beta         350   1e-115   Macaca mulatta [rhesus macaque]
ref|XP_004451926.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    350   1e-115   Dasypus novemcinctus
ref|XP_007575815.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    350   1e-115   Poecilia formosa
gb|KFQ90789.1|  Mannose-1-phosphate guanyltransferase beta              347   1e-115   Nipponia nippon
ref|XP_003639816.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   1e-115   Canis lupus familiaris [dogs]
ref|XP_009879625.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   1e-115   Charadrius vociferus
gb|EMP33974.1|  Mannose-1-phosphate guanyltransferase beta              347   1e-115   Chelonia mydas [green seaturtle]
ref|XP_004347896.1|  mannose-1-phosphate guanyltransferase beta         349   1e-115   Capsaspora owczarzaki ATCC 30864
gb|EPQ07262.1|  Mannose-1-phosphate guanyltransferase beta              347   1e-115   Myotis brandtii
dbj|BAN82072.1|  hypothetical protein                                   348   1e-115   Protobothrops flavoviridis [habu]
ref|XP_002920584.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   2e-115   Ailuropoda melanoleuca
ref|XP_005074974.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   2e-115   Mesocricetus auratus [Syrian golden hamster]
ref|XP_009475176.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   2e-115   Nipponia nippon
ref|XP_009089239.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   2e-115   Serinus canaria [canary]
ref|XP_005522264.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   2e-115   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_006631022.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   2e-115   Lepisosteus oculatus
ref|XP_004615299.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   2e-115   Sorex araneus [Eurasian shrew]
ref|XP_005814035.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   2e-115   Xiphophorus maculatus
ref|XP_006171011.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   2e-115   
ref|XP_009279642.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   2e-115   Aptenodytes forsteri
ref|XP_005326986.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    349   2e-115   Ictidomys tridecemlineatus
ref|XP_006978396.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   2e-115   Peromyscus maniculatus bairdii
ref|XP_007888693.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   3e-115   Callorhinchus milii [Australian ghost shark]
ref|NP_001231470.1|  mannose-1-phosphate guanyltransferase beta         348   3e-115   Sus scrofa [pigs]
ref|XP_008153791.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   3e-115   Eptesicus fuscus
ref|NP_808578.1|  mannose-1-phosphate guanyltransferase beta            348   3e-115   Mus musculus [mouse]
ref|XP_005724499.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   3e-115   Pundamilia nyererei
gb|KIY95803.1|  hypothetical protein MNEG_12160                         347   3e-115   Monoraphidium neglectum
ref|XP_005141643.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    346   4e-115   Melopsittacus undulatus
tpg|DAA16917.1|  TPA: mannose-1-phosphate guanyltransferase beta        348   4e-115   Bos taurus [bovine]
gb|KGL84089.1|  Mannose-1-phosphate guanyltransferase beta-A            345   4e-115   Tinamus guttatus
ref|XP_005229990.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   4e-115   Falco peregrinus [peregrine]
ref|XP_010716657.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    346   4e-115   Meleagris gallopavo [common turkey]
ref|XP_005444503.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   4e-115   Falco cherrug
ref|XP_002713245.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   5e-115   Oryctolagus cuniculus [domestic rabbit]
ref|NP_001102251.1|  mannose-1-phosphate guanyltransferase beta         348   5e-115   Rattus norvegicus [brown rat]
ref|XP_002038340.1|  GM10777                                            348   5e-115   Drosophila sechellia
gb|KFV84323.1|  Mannose-1-phosphate guanyltransferase beta-A            345   5e-115   Struthio camelus australis
ref|XP_003476723.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   6e-115   Cavia porcellus [guinea pig]
ref|XP_004284004.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   6e-115   Orcinus orca [Orca]
ref|XP_010866576.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   6e-115   
ref|XP_004676214.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   6e-115   Condylura cristata
ref|XP_005052977.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   6e-115   
gb|ETE70877.1|  Mannose-1-phosphate guanyltransferase beta-A            348   7e-115   Ophiophagus hannah
ref|NP_001008434.1|  mannose-1-phosphate guanyltransferase beta         347   7e-115   Xenopus tropicalis [western clawed frog]
ref|XP_006412681.1|  hypothetical protein EUTSA_v10025578mg             347   7e-115   Eutrema salsugineum [saltwater cress]
ref|XP_006196371.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   8e-115   Vicugna pacos
ref|XP_010222885.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   8e-115   Tinamus guttatus
ref|XP_006174178.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   9e-115   
sp|P0C5I2.1|GMPPB_PIG  RecName: Full=Mannose-1-phosphate guanyltr...    347   9e-115   Sus scrofa [pigs]
ref|XP_007428476.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   9e-115   Python bivittatus
ref|XP_005696009.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   9e-115   
ref|XP_008301904.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   1e-114   Stegastes partitus
ref|XP_006909163.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   1e-114   
ref|XP_003217595.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   1e-114   Anolis carolinensis [Carolina anole]
ref|XP_004018504.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   1e-114   
ref|XP_008522209.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   1e-114   Equus przewalskii [Przewalski horse]
ref|XP_001994106.1|  GH23007                                            347   1e-114   Drosophila grimshawi
ref|XP_009679063.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   1e-114   Struthio camelus australis
ref|XP_009995252.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    344   1e-114   Chaetura pelagica
ref|XP_011209172.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   1e-114   Bactrocera dorsalis [papaya fruit fly]
ref|XP_009537794.1|  hypothetical protein PHYSODRAFT_319613             347   1e-114   
ref|XP_002867340.1|  hypothetical protein ARALYDRAFT_913419             345   1e-114   
gb|KFU89083.1|  Mannose-1-phosphate guanyltransferase beta              344   1e-114   
ref|XP_004069373.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   1e-114   
ref|XP_003800644.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   1e-114   
ref|XP_010559913.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   1e-114   
gb|KFP04832.1|  Mannose-1-phosphate guanyltransferase beta-A            344   1e-114   
ref|XP_006243873.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    348   1e-114   
ref|XP_004368596.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   1e-114   
ref|NP_001280244.1|  mannose-1-phosphate guanyltransferase beta         347   1e-114   
ref|XP_008569780.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   2e-114   
ref|XP_008851399.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   2e-114   
ref|XP_001946280.2|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   2e-114   
ref|XP_007129911.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   2e-114   
ref|XP_009905934.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   2e-114   
ref|XP_006053329.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   2e-114   
ref|NP_001039633.1|  mannose-1-phosphate guanyltransferase beta         347   2e-114   
ref|XP_007168787.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   2e-114   
ref|XP_002613614.1|  hypothetical protein BRAFLDRAFT_93657              346   2e-114   
ref|XP_001378168.2|  PREDICTED: mannose-1-phosphate guanyltransfe...    346   2e-114   
ref|XP_010388613.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   2e-114   
ref|XP_008497167.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    346   2e-114   
ref|XP_005601090.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   2e-114   
ref|XP_004419768.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    346   3e-114   
ref|XP_010967477.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    346   3e-114   
ref|XP_001978865.1|  GG12578                                            346   3e-114   
gb|KFV73795.1|  Mannose-1-phosphate guanyltransferase beta-A            343   3e-114   
ref|XP_005865488.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   4e-114   
ref|XP_008061359.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    347   4e-114   
ref|XP_005279712.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   5e-114   
ref|XP_002095987.1|  GE25436                                            345   6e-114   
ref|XP_007953540.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   6e-114   
ref|XP_007251546.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   7e-114   
ref|XP_002000465.1|  GI10243                                            345   7e-114   
ref|XP_006873657.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   7e-114   
ref|XP_005969337.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   9e-114   
ref|XP_007527319.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    345   1e-113   
ref|XP_010613859.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    344   1e-113   
ref|NP_649498.1|  CG1129, isoform A                                     345   1e-113   
ref|XP_008630498.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    342   1e-113   
ref|XP_009644181.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    342   1e-113   
ref|NP_001091347.1|  mannose-1-phosphate guanyltransferase beta-B       344   1e-113   
ref|XP_011432652.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    344   1e-113   
ref|XP_004715224.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    344   2e-113   
gb|KFO57932.1|  Mannose-1-phosphate guanyltransferase beta              340   3e-113   
ref|XP_002074034.1|  GK12822                                            344   3e-113   
ref|XP_004903552.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    343   3e-113   
ref|XP_001359425.1|  GA10892                                            343   3e-113   
ref|XP_011182489.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    343   3e-113   
ref|XP_006275003.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    343   4e-113   
ref|XP_005410264.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    343   5e-113   
dbj|GAM18590.1|  hypothetical protein SAMD00019534_017650               343   6e-113   
ref|XP_008903956.1|  hypothetical protein PPTG_09918                    343   6e-113   
ref|XP_006770662.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    343   7e-113   
gb|KFP10017.1|  Mannose-1-phosphate guanyltransferase beta              339   1e-112   
ref|XP_001955746.1|  GF18913                                            342   2e-112   
ref|XP_002899327.1|  mannose-1-phosphate guanyltransferase beta, ...    341   2e-112   
gb|ELK25027.1|  Mannose-1-phosphate guanyltransferase beta              339   3e-112   
sp|Q6DBU5.1|GMPPB_DANRE  RecName: Full=Mannose-1-phosphate guanyl...    341   3e-112   
emb|CDY39215.1|  BnaA03g50270D                                          339   3e-112   
ref|NP_001003491.2|  mannose-1-phosphate guanyltransferase beta         341   3e-112   
ref|XP_003976606.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    340   5e-112   
gb|EMT15706.1|  Mannose-1-phosphate guanyltransferase beta              337   1e-111   
gb|KDR18890.1|  Mannose-1-phosphate guanyltransferase beta              339   1e-111   
ref|XP_007129912.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    339   1e-111   
ref|XP_009058578.1|  hypothetical protein LOTGIDRAFT_227532             339   2e-111   
ref|XP_004996866.1|  GDP-D-mannose pyrophosphorylase                    340   2e-111   
ref|XP_002118061.1|  hypothetical protein TRIADDRAFT_33563              338   2e-111   
ref|XP_002056635.1|  GJ11048                                            339   3e-111   
ref|XP_003727955.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    338   5e-111   
gb|EHJ63816.1|  hypothetical protein KGM_00281                          337   5e-111   
ref|XP_002739492.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    337   7e-111   
gb|ERE75626.1|  amphoterin-induced protein 3                            359   2e-110   
ref|XP_009858053.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    337   2e-110   
ref|XP_005188247.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    337   2e-110   
ref|XP_001637465.1|  predicted protein                                  336   2e-110   
gb|ERE75625.1|  amphoterin-induced protein 3                            359   2e-110   
ref|XP_009089238.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    336   3e-110   
ref|XP_005522263.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    336   3e-110   
gb|EAW65012.1|  GDP-mannose pyrophosphorylase B, isoform CRA_a          336   4e-110   
emb|CCA19060.1|  mannose1phosphate guanyltransferase beta putative      335   6e-110   
ref|XP_008970505.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    336   6e-110   
ref|XP_009237280.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    336   7e-110   
ref|NP_037466.2|  mannose-1-phosphate guanyltransferase beta isof...    336   7e-110   
ref|XP_009443776.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    336   7e-110   
gb|ELU15028.1|  hypothetical protein CAPTEDRAFT_154984                  335   8e-110   
ref|XP_005508929.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    332   1e-109   
gb|KDD72216.1|  hypothetical protein H632_c3685p0                       332   1e-109   
ref|XP_009199021.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    335   1e-109   
ref|XP_007982437.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    335   1e-109   
ref|XP_005422538.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    332   1e-109   
ref|XP_005851739.1|  hypothetical protein CHLNCDRAFT_133102             334   2e-109   
ref|XP_005547197.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    334   2e-109   
gb|EHH16358.1|  hypothetical protein EGK_11629                          334   2e-109   
ref|XP_006619482.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    333   2e-109   
ref|XP_004931363.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    333   2e-109   
ref|XP_004944488.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    334   3e-109   
ref|XP_004664299.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    334   3e-109   
ref|XP_005326985.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    333   5e-109   
ref|XP_008471831.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    332   5e-109   
ref|XP_005696008.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    333   6e-109   
ref|XP_001749938.1|  hypothetical protein                               332   7e-109   
ref|XP_011063870.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    333   7e-109   
gb|KFM70041.1|  Mannose-1-phosphate guanyltransferase beta-A            332   7e-109   
ref|XP_008551456.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    332   8e-109   
ref|XP_011168503.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    332   8e-109   
ref|XP_005652260.1|  GDP-D-mannose pyrophosphorylase                    332   9e-109   
ref|XP_392845.4|  PREDICTED: mannose-1-phosphate guanyltransferas...    332   9e-109   
gb|EQB77062.1|  inositol hexakisphosphate kinase 1                      346   1e-108   
ref|XP_011334298.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    332   1e-108   
ref|XP_011152525.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    329   1e-108   
ref|XP_009022655.1|  hypothetical protein HELRODRAFT_106916             331   2e-108   
ref|XP_011399603.1|  Mannose-1-phosphate guanyltransferase              331   2e-108   
ref|XP_008471832.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    331   2e-108   
ref|XP_010345461.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    332   2e-108   
ref|XP_008569779.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    332   3e-108   
ref|XP_005006710.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    332   3e-108   
ref|XP_005106670.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    331   3e-108   
ref|XP_004537003.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    331   3e-108   
ref|XP_003487881.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    331   3e-108   
ref|XP_003691872.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    331   3e-108   
ref|XP_003399056.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    331   3e-108   
ref|XP_006196370.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    332   3e-108   
ref|XP_011152524.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    331   4e-108   
ref|XP_011264948.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    330   5e-108   
ref|XP_005969336.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    331   6e-108   
emb|CEG72190.1|  Putative Mannose-1-phosphate guanyltransferase         328   6e-108   
gb|EFN62395.1|  Mannose-1-phosphate guanyltransferase beta              330   7e-108   
emb|CEG72189.1|  Putative Mannose-1-phosphate guanyltransferase         328   9e-108   
ref|XP_003700573.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    330   1e-107   
ref|XP_008497166.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    330   1e-107   
ref|XP_007527318.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    330   1e-107   
ref|XP_011385554.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    330   1e-107   
ref|XP_004715223.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    330   2e-107   
ref|XP_004625162.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    329   4e-107   
emb|CAX73189.1|  putative GDP-mannose pyrophosphorylase B isoform 2     328   4e-107   
gb|EFX81986.1|  hypothetical protein DAPPUDRAFT_101964                  327   1e-106   
gb|KIW14322.1|  mannose-1-phosphate guanyltransferase                   327   1e-106   
emb|CCX14363.1|  Similar to Mannose-1-phosphate guanyltransferase...    327   1e-106   
gb|KIW41620.1|  mannose-1-phosphate guanyltransferase, variant          326   2e-106   
gb|KIW41619.1|  mannose-1-phosphate guanyltransferase                   327   2e-106   
gb|EMS20847.1|  mannose-1-phosphate guanylyltransferase                 326   2e-106   
gb|AAA69677.1|  mannose-1-phosphate guanyltransferase                   326   2e-106   
ref|NP_010228.1|  mannose-1-phosphate guanylyltransferase               326   2e-106   
ref|XP_003670001.1|  hypothetical protein NDAI_0D04440                  326   2e-106   
ref|XP_005536787.1|  mannose-1-phosphate guanylyltransferase            326   2e-106   
ref|XP_001227041.1|  hypothetical protein CHGG_09114                    326   2e-106   
ref|XP_008715026.1|  mannose-1-phosphate guanyltransferase              326   3e-106   
gb|ELR08715.1|  mannose-1-phosphate guanyltransferase                   325   4e-106   
gb|KER00901.1|  hypothetical protein AUEXF2481DRAFT_35153               325   4e-106   
gb|EHN03270.1|  Psa1p                                                   325   5e-106   
emb|CDM36708.1|  Mannose-1-phosphate guanyltransferase                  325   5e-106   
gb|EMC83983.1|  Mannose-1-phosphate guanyltransferase beta              323   5e-106   
ref|XP_001689367.1|  AGAP001299-PA                                      325   5e-106   
gb|EJW88469.1|  mannose-1-phosphate guanyltransferase beta              325   5e-106   
gb|EGW08929.1|  Mannose-1-phosphate guanyltransferase beta              320   9e-106   
ref|XP_011334299.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    325   9e-106   
dbj|GAM41645.1|  mannose-1-phosphate guanyltransferase                  324   9e-106   
gb|KGO78487.1|  Nucleotidyl transferase                                 324   9e-106   
ref|XP_001899556.1|  GDP-mannose pyrophosphorylase B, isoform 2         324   1e-105   
gb|KFY75477.1|  hypothetical protein V499_04519                         324   1e-105   
gb|KGK39965.1|  hypothetical protein JL09_g896                          324   1e-105   
ref|XP_005706305.1|  mannose-1-phosphate guanylyltransferase            324   1e-105   
emb|CDQ00570.1|  Protein BM-TAG-335, isoform a                          324   1e-105   
ref|XP_011303559.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    324   2e-105   
ref|XP_011334297.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    325   2e-105   
gb|ESW95927.1|  Mannose-1-phosphate guanyltransferase                   323   2e-105   
gb|EKV04708.1|  Mannose-1-phosphate guanyltransferase                   323   2e-105   
ref|XP_004944487.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    325   2e-105   
gb|KIX96214.1|  mannose-1-phosphate guanyltransferase                   323   2e-105   
gb|EIF49787.1|  gdp-mannose pyrophosphorylase                           323   2e-105   
gb|KFB42785.1|  hypothetical protein ZHAS_00010532                      323   2e-105   
ref|XP_002151296.1|  mannose-1-phosphate guanylyltransferase            323   3e-105   
sp|Q9P8N0.1|MPG1_PICAN  RecName: Full=Mannose-1-phosphate guanylt...    323   3e-105   
ref|XP_003843812.1|  similar to mannose-1-phosphate guanyltransfe...    323   3e-105   
dbj|BAO41930.1|  mannose-1-phosphate guanyltransferase                  323   3e-105   
ref|XP_663190.1|  hypothetical protein AN5586.2                         323   3e-105   
gb|KIV83904.1|  mannose-1-phosphate guanyltransferase                   323   4e-105   
ref|XP_003383986.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    323   4e-105   
ref|XP_001653050.1|  AAEL001331-PA                                      323   4e-105   
sp|Q5B1J4.2|MPG1_EMENI  RecName: Full=Mannose-1-phosphate guanylt...    323   4e-105   
gb|KFY19685.1|  hypothetical protein V491_04283                         323   5e-105   
ref|XP_011102864.1|  psa1p                                              322   5e-105   
ref|XP_001401863.1|  mannose-1-phosphate guanyltransferase              322   5e-105   
gb|ETN59015.1|  mannose-1-phosphate guanyltransferase                   323   5e-105   
gb|ENN79514.1|  hypothetical protein YQE_03977                          322   5e-105   
gb|KGO38018.1|  Nucleotidyl transferase                                 322   6e-105   
dbj|BAM76579.1|  VTC1                                                   316   6e-105   
gb|KEQ68936.1|  mannose-1-phosphate guanyltransferase                   322   6e-105   
emb|CEI86118.1|  Putative Mannose-1-phosphate guanyltransferase         325   7e-105   
gb|KEY70742.1|  hypothetical protein S7711_03238                        322   7e-105   
gb|ESA01850.1|  hypothetical protein GLOINDRAFT_256407                  322   7e-105   
gb|EXX60943.1|  mannose-1-phosphate guanylyltransferase                 322   7e-105   
gb|KFA61058.1|  hypothetical protein S40285_06340                       322   8e-105   
ref|XP_002174350.1|  mannose-1-phosphate guanyltransferase Mpg1         322   8e-105   
gb|KFY61094.1|  hypothetical protein V496_05148                         322   1e-104   
gb|KFY85514.1|  hypothetical protein V500_08352                         322   1e-104   
ref|XP_006682149.1|  hypothetical protein BATDEDRAFT_20856              322   1e-104   
ref|XP_002584611.1|  mannose-1-phosphate guanyltransferase              322   1e-104   
gb|KIV97144.1|  mannose-1-phosphate guanyltransferase, variant 5        320   1e-104   
dbj|GAN07474.1|  conserved hypothetical protein                         322   1e-104   
gb|KIW58407.1|  mannose-1-phosphate guanyltransferase, variant          320   1e-104   
ref|XP_002564636.1|  Pc22g06040                                         322   1e-104   
ref|XP_003673192.1|  hypothetical protein NCAS_0A02430                  321   1e-104   
sp|Q4U3E8.1|MPG1_ASPFU  RecName: Full=Mannose-1-phosphate guanylt...    321   1e-104   
ref|XP_006966629.1|  mannose-1-phosphate guanyltransferase              321   2e-104   
gb|EKG18392.1|  hypothetical protein MPH_04393                          321   2e-104   
gb|EPS33496.1|  hypothetical protein PDE_08458                          321   2e-104   
gb|KFY24564.1|  hypothetical protein V493_05165                         321   2e-104   
gb|KEQ58368.1|  mannose-1-phosphate guanyltransferase                   321   2e-104   
gb|EPB86770.1|  mannose-1-phosphate guanyltransferase                   321   2e-104   
gb|KFY30807.1|  hypothetical protein V494_08049                         321   2e-104   
gb|EDP50516.1|  mannose-1-phosphate guanylyltransferase                 321   2e-104   
dbj|GAA55890.1|  mannose-1-phosphate guanylyltransferase                322   2e-104   
gb|EME45421.1|  hypothetical protein DOTSEDRAFT_52701                   321   2e-104   
gb|KFX86865.1|  hypothetical protein V490_08766                         321   2e-104   
ref|XP_001820172.2|  mannose-1-phosphate guanyltransferase              320   2e-104   
emb|CEG73578.1|  Putative Mannose-1-phosphate guanyltransferase         321   2e-104   
emb|CDS22572.1|  mannose 1 phosphate guanyltransferase beta             321   2e-104   
gb|EIE85443.1|  mannose-1-phosphate guanyltransferase                   321   2e-104   
gb|KFH70136.1|  mannose-1-phosphate guanyltransferase                   320   3e-104   



>ref|XP_002282422.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Vitis vinifera]
Length=361

 Score =   515 bits (1327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/265 (94%), Positives = 259/265 (98%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYPFKEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEES G+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPFKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESIGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VDRFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLASGAHIVGNVLVDE+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSSKLASGAHIVGNVLVDESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEAGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|ACN88684.2| GDP-D-mannose pyrophosphorylase [Malus domestica]
Length=333

 Score =   512 bits (1318),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 247/265 (93%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYPFKEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  69   LIDDSGEPFFVLNSDVISEYPFKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  128

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAENKL+AMVLPGF
Sbjct  129  VQKFVEKPKLFVGNKINAGIYLLNPSVLDKIELRPTSIEKEVFPKIAAENKLFAMVLPGF  188

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRK SS KLA GAHIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  189  WMDIGQPRDYITGLRLYLDSLRKNSSSKLARGAHIVGNVLVDETAKIGEGCLIGPDVAIG  248

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+IESGVRLSRCTVMRGVRIK H CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  249  PGCIIESGVRLSRCTVMRGVRIKNHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDE  308

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  309  IYSNGGVVLPHKEIKSSILKPEIVM  333



>ref|XP_008371997.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Malus domestica]
 ref|XP_009351402.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Pyrus x 
bretschneideri]
Length=361

 Score =   511 bits (1317),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 247/265 (93%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYPFKEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPFKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAENKL+AMVLPGF
Sbjct  157  VQKFVEKPKLFVGNKINAGIYLLNPSVLDKIELRPTSIEKEVFPKIAAENKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRK SS KLA GAHIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKNSSSKLARGAHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+IESGVRLSRCTVMRGVRIK H CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCIIESGVRLSRCTVMRGVRIKNHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>dbj|BAP75927.1| GDP-mannose pyrophosphorylase, partial [Moringa oleifera]
Length=342

 Score =   511 bits (1315),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 246/265 (93%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SG PFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  78   LVDGSGAPFFVLNSDVISEYPLKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  137

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  138  VERFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEQKLYAMVLPGF  197

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSSPKLA+G ++VGNVLVDETAKI EGCLIGPDVAIG
Sbjct  198  WMDIGQPRDYITGLRLYLDSLRKKSSPKLATGPNVVGNVLVDETAKIGEGCLIGPDVAIG  257

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  258  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  317

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  318  IYSNGGVVLPHKEIKSSILKPEIVM  342



>ref|XP_009594230.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009594231.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
tomentosiformis]
Length=361

 Score =   511 bits (1316),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 259/265 (98%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+DDSGEPFFVLNSDVIS+YPFKEMIEFHKSHGGEAS+MVTKVDEPSKYGVVV EESTG+
Sbjct  97   LVDDSGEPFFVLNSDVISDYPFKEMIEFHKSHGGEASLMVTKVDEPSKYGVVVTEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLL+PS+LD+I+L+PTSIEKE+FPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLDPSILDRIQLRPTSIEKEIFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SL+KKSSPKLASG+HIVGNVLVDETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLKKKSSPKLASGSHIVGNVLVDETATIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRCTVMRGVR+KKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVIESGVRLSRCTVMRGVRVKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_004490906.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cicer 
arietinum]
Length=361

 Score =   511 bits (1316),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 246/265 (93%), Positives = 259/265 (98%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEETTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLASG++IVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSSKLASGSNIVGNVIVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSNILKPEIVM  361



>gb|EYU19947.1| hypothetical protein MIMGU_mgv1a008833mg [Erythranthe guttata]
Length=361

 Score =   511 bits (1315),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 247/265 (93%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMI FHKSHGGEASIMVTKVDEPSKYGVVV EES+GK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIAFHKSHGGEASIMVTKVDEPSKYGVVVTEESSGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKE+FPKIAAE KL+AMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEIFPKIAAEKKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSSPKLASGAHI+GNVLVDE+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSPKLASGAHIIGNVLVDESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|ABI48955.1| GDP-D-mannose pyrophosphorylase [Viola baoshanensis]
Length=361

 Score =   510 bits (1314),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 246/265 (93%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L  DSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LTGDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPKIFVGNKINAGIYLLNPSVLD IEL+PTSIEKEVFPKIAAE KL+AMVLPGF
Sbjct  157  VDKFVEKPKIFVGNKINAGIYLLNPSVLDLIELRPTSIEKEVFPKIAAEKKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSSPKLA+GA IVGNVLVDETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSPKLATGASIVGNVLVDETATIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSI+GWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIVGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|KJB74050.1| hypothetical protein B456_011G269100 [Gossypium raimondii]
Length=361

 Score =   509 bits (1311),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 259/265 (98%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D+SGEPFFVLNSDVISEYPFKEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LVDESGEPFFVLNSDVISEYPFKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VDKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+SPKLASG ++VGNVLV ETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKASPKLASGPNVVGNVLVHETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHST+GQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_009759296.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
 ref|XP_009759297.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
 ref|XP_009759298.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
Length=361

 Score =   509 bits (1310),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 258/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+DDS EPFFVLNSDVIS+YPFKEMIEFHKSHGGEAS+MVTKVDEPSKYGVVV EESTG+
Sbjct  97   LVDDSAEPFFVLNSDVISDYPFKEMIEFHKSHGGEASLMVTKVDEPSKYGVVVTEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLL+PS+LD+I+L+PTSIEKE+FPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLDPSILDRIQLRPTSIEKEIFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SL+K+SSPKLASG+HIVGNVLVDETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLKKRSSPKLASGSHIVGNVLVDETATIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRCTVMRGVR+KKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVIESGVRLSRCTVMRGVRVKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|AIN40499.1| GDP-D-mannose pyrophosphorylase [Ziziphus jujuba]
Length=361

 Score =   509 bits (1310),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 247/265 (93%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVL +IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPSVLHRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS  LA+GAHIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSSNLATGAHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_002524227.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis]
 gb|EEF38151.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis]
Length=361

 Score =   508 bits (1309),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 242/265 (91%), Positives = 258/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID+SG+PFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDESGDPFFVLNSDVISEYPLKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFPKIAA+ +L+AMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPKIAADKQLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS +LA+GAH+VGNVL+DETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSSRLANGAHVVGNVLIDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSI+GWHSTVGQW R+ENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIVGWHSTVGQWTRIENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_011076786.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Sesamum 
indicum]
 ref|XP_011076787.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Sesamum 
indicum]
Length=361

 Score =   508 bits (1309),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 246/265 (93%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEETTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLA G HI+GNVLVDE+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSSKLALGTHIIGNVLVDESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_009592609.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009592610.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   508 bits (1308),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYPFKEMI FHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPFKEMIAFHKSHGGEASLMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAG YLLNPSVLD+I+L+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGFYLLNPSVLDRIQLRPTSIEKEVFPKIAAEEKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI GLRLYL+SL+K SSPKLASG+HIVGNV+VDE+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYIAGLRLYLDSLKKNSSPKLASGSHIVGNVIVDESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GCVIESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  SGCVIESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_009797660.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009797661.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009797662.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
Length=361

 Score =   508 bits (1308),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYPFKEMI FHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPFKEMIAFHKSHGGEASLMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAG YLLNPSVL++I+L+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGFYLLNPSVLERIQLRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SL+K SSPKLASG+HIVGNV+VDE+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLKKNSSPKLASGSHIVGNVIVDESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GCVIESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  SGCVIESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|AFK47417.1| unknown [Lotus japonicus]
Length=353

 Score =   508 bits (1307),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 258/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP +EMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  89   LIDGSGEPFFVLNSDVISEYPLEEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGQ  148

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  149  VEKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEQKLYAMVLPGF  208

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLASG++IVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  209  WMDIGQPRDYITGLRLYLDSLRKKSSSKLASGSNIVGNVIVDETAKIGEGCLIGPDVAIG  268

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRCT+MRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  269  PGCIVESGVRLSRCTIMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  328

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  329  IYSNGGVVLPHKEIKSSILKPEIVM  353



>ref|NP_001275205.1| GDP-mannose pyrophosphorylase [Solanum tuberosum]
 gb|AAD01737.1| GDP-mannose pyrophosphorylase [Solanum tuberosum]
Length=361

 Score =   508 bits (1307),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYPFKEMI+FHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPFKEMIQFHKSHGGEASLMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAG YLLNPSVLD+I+L+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGFYLLNPSVLDRIQLRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SL+K SSPKLASG HIVGNV+VDE+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLKKHSSPKLASGPHIVGNVIVDESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GCVIESGVRLSRCTVMRGVRIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  SGCVIESGVRLSRCTVMRGVRIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|ACN38266.1| GDP-D-mannose pyrophosphorylase [Actinidia latifolia]
Length=361

 Score =   508 bits (1307),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKE+FPKIA E KLYAMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEIFPKIAGEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+S KLA+G HIVGNVLVDETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKTSSKLATGPHIVGNVLVDETATIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGV LPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVALPHKEIKSSILKPEIVM  361



>ref|NP_001234025.1| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
 gb|AAT37498.2| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
Length=361

 Score =   507 bits (1305),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYPFKEMI+FHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPFKEMIQFHKSHGGEASLMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAG YLLNPSVLD+I+L+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGFYLLNPSVLDRIQLRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SL+K SSPKLASG HIVGNV+VDE+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLKKHSSPKLASGPHIVGNVIVDESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GCVIESGVRLSRCTVMRGVRIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  SGCVIESGVRLSRCTVMRGVRIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|ABB53473.1| GDP-mannose pyrophosphorylase [Malpighia glabra]
 gb|ABX80393.1| GDP-mannose pyrophosphorylase [Malpighia glabra]
Length=361

 Score =   507 bits (1305),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 242/265 (91%), Positives = 259/265 (98%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID+SGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDESGEPFFVLNSDVISEYPLKEMIEFHKNHGGEASIMVTKVDEPSKYGVVVMEESTGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAA+N LYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAADNSLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKSS KLA+G+++VGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKKSSTKLATGSNVVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH C+SSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACVSSSIIGWHSTVGQWARVENMTILGEDVHLCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSI+ PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSIIKPEIVM  361



>dbj|BAB62108.1| GDP-D-mannose pyrophosphorylase [Nicotiana tabacum]
Length=361

 Score =   507 bits (1305),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYPFKEMI FHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPFKEMIAFHKSHGGEASLMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAG YLLNPSVLD+I+L+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGFYLLNPSVLDRIQLRPTSIEKEVFPKIAAEEKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI GLRLYL+SL+K SSPKLASG+HIVGNV+VDE+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYIPGLRLYLDSLKKNSSPKLASGSHIVGNVIVDESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GCVIESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  SGCVIESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_010095035.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
 gb|EXB58141.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
Length=361

 Score =   507 bits (1305),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMI+FHK+HGGEASIMVTKVDEPSKYGVVVMEEST K
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIDFHKAHGGEASIMVTKVDEPSKYGVVVMEESTRK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLA+G+HIVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSSKLATGSHIVGNVIVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVEAGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_009343927.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Pyrus 
x bretschneideri]
Length=361

 Score =   506 bits (1304),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 245/265 (92%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYPFK+MIEFHK HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPFKQMIEFHKGHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAENKL+AMVLPGF
Sbjct  157  VQKFVEKPKLFVGNKINAGIYLLNPSVLDKIELRPTSIEKEVFPKIAAENKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRK  S KLA GAHIVGNVLVDETAK+ EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKNCSSKLAVGAHIVGNVLVDETAKLGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRCTVMRGVRIK H CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVIESGVRLSRCTVMRGVRIKNHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|AGI78460.1| GDP-D-mannose pyrophosphorylase [Camellia sinensis]
Length=361

 Score =   506 bits (1303),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAA+ +LY MVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAQKQLYGMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KL++G HIVGNVLVDET+KI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPSKLSTGPHIVGNVLVDETSKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEAGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_003616475.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
 gb|AAT58365.1| GMPase [Medicago sativa]
 gb|AES99433.1| mannose-1-phosphate guanylyltransferase-like protein [Medicago 
truncatula]
Length=361

 Score =   506 bits (1303),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 258/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVIS+YP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LIDDSGEPFFVLNSDVISDYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEETTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKE+FPKIAAE KLYAMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEIFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLA G++IVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSSKLAGGSNIVGNVIVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCIVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIK++IL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKTNILKPEIVM  361



>ref|XP_011036070.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Populus 
euphratica]
 ref|XP_011036071.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Populus 
euphratica]
Length=361

 Score =   506 bits (1302),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP K+MIEFHK HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPLKQMIEFHKVHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSV+D+IEL+PTSIEKEVFPKIAAE+KLYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVIDRIELRPTSIEKEVFPKIAAEDKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRK SS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKNSSSKLANGPHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRC+VMRGVRIKKH CISSSIIGWHSTVGQWARVEN+TILGEDVH+CDE
Sbjct  277  PGCIVESGVRLSRCSVMRGVRIKKHACISSSIIGWHSTVGQWARVENLTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_007218178.1| hypothetical protein PRUPE_ppa007618mg [Prunus persica]
 ref|XP_008233488.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Prunus 
mume]
 ref|XP_008233489.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Prunus 
mume]
 dbj|BAH03298.1| GDP-D-mannose pyrophosphorylase [Prunus persica]
 gb|EMJ19377.1| hypothetical protein PRUPE_ppa007618mg [Prunus persica]
Length=361

 Score =   505 bits (1301),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 256/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYPFK+MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPFKQMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP IAAENKL+AMVLPGF
Sbjct  157  VQKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPNIAAENKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRK SS KLA G+++VGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKNSSSKLARGSNVVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_002316262.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEF02433.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=361

 Score =   504 bits (1298),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 244/265 (92%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP K+MIEFHK HGGEASIMVTKVDEPSKYGVVV EESTGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPLKQMIEFHKVHGGEASIMVTKVDEPSKYGVVVTEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE+KLYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEDKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRK SS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKNSSSKLANGPHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRC+VMRGVRIKKH CISSSIIGWHSTVGQWARVEN+TILGEDVH+CDE
Sbjct  277  PGCIVESGVRLSRCSVMRGVRIKKHACISSSIIGWHSTVGQWARVENLTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_007009211.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009212.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009214.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18021.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18022.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18024.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
Length=361

 Score =   504 bits (1298),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SG+PFFVLNSDVISEYPFKEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDGSGKPFFVLNSDVISEYPFKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VDKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+S KLA+G HIVGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKASTKLATGPHIVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVR+KKH CISSSIIGWHST+GQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRVKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_007009215.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
5 [Theobroma cacao]
 gb|EOY18025.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
5 [Theobroma cacao]
Length=362

 Score =   504 bits (1298),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SG+PFFVLNSDVISEYPFKEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  98   LIDGSGKPFFVLNSDVISEYPFKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGQ  157

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  158  VDKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  217

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+S KLA+G HIVGNVLV E+AKI EGCLIGPDVAIG
Sbjct  218  WMDIGQPRDYITGLRLYLDSLRKKASTKLATGPHIVGNVLVHESAKIGEGCLIGPDVAIG  277

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVR+KKH CISSSIIGWHST+GQWARVENMTILGEDVH+CDE
Sbjct  278  PGCVVESGVRLSRCTVMRGVRVKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVCDE  337

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  338  IYSNGGVVLPHKEIKSSILKPEIVM  362



>ref|XP_004240924.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_004240926.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_004240927.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_010322173.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_010322174.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
Length=361

 Score =   504 bits (1297),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+DDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LVDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASLMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLL+P VL++I+L+PTSIEKEVFP IAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLDPCVLERIQLRPTSIEKEVFPNIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SL+K+SSPKLA G+HIVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLKKRSSPKLALGSHIVGNVIVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRCTVMRGVR+KKH C+S SIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVIESGVRLSRCTVMRGVRVKKHACVSGSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_007009213.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
 gb|EOY18023.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
Length=362

 Score =   504 bits (1297),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SG+PFFVLNSDVISEYPFKEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  98   LIDGSGKPFFVLNSDVISEYPFKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGQ  157

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  158  VDKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  217

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+S KLA+G HIVGNVLV E+AKI EGCLIGPDVAIG
Sbjct  218  WMDIGQPRDYITGLRLYLDSLRKKASTKLATGPHIVGNVLVHESAKIGEGCLIGPDVAIG  277

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVR+KKH CISSSIIGWHST+GQWARVENMTILGEDVH+CDE
Sbjct  278  PGCVVESGVRLSRCTVMRGVRVKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVCDE  337

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  338  IYSNGGVVLPHKEIKSSILKPEIVM  362



>gb|KDP44883.1| hypothetical protein JCGZ_01383 [Jatropha curcas]
Length=361

 Score =   503 bits (1296),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 242/265 (91%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LVDGSGEPFFVLNSDVISEYPLKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP IA +  L+AMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPNIAGDKNLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRK+SS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKRSSSKLATGPHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_006338820.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006338821.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006338822.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X3 [Solanum tuberosum]
Length=361

 Score =   503 bits (1296),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 238/265 (90%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+DD+GEPFFVLNSDVISEYPFKEMIEFHKSHGGEAS+MVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LVDDAGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASLMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLL+P VL++I+L+PTSIEKEVFP IAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLDPCVLERIQLRPTSIEKEVFPNIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SL+K+SSPKLA G+HIVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLKKRSSPKLALGSHIVGNVIVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRCTVMRGVR+KKH C+S SIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVIESGVRLSRCTVMRGVRVKKHACVSGSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_010256792.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nelumbo 
nucifera]
Length=361

 Score =   503 bits (1296),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMI FHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIAFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKSS  LA+G+HIVGNVLV ETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKKSSSNLANGSHIVGNVLVHETAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIE GVRLSRCT+MRGVR+KKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+CDE
Sbjct  277  PGCVIEPGVRLSRCTIMRGVRVKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|KDO69186.1| hypothetical protein CISIN_1g018060mg [Citrus sinensis]
Length=302

 Score =   501 bits (1289),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDD+GEPFFVLNSDVISEYPF EMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  38   LIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  97

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNP+VLD+IEL+PTSIEKEVFPKIA E KL+AMVLPGF
Sbjct  98   VEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGF  157

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLA+GA+IVGNVLV E+A+I EGCLIGPDVA+G
Sbjct  158  WMDIGQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVG  217

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  218  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  277

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  278  IYSNGGVVLPHKEIKSSILKPEIVM  302



>ref|XP_010067451.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067452.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067453.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067454.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW65590.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65591.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65592.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65593.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
Length=361

 Score =   503 bits (1295),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+DDSGEPFFVLNSDVISEYP KEMI+FHK+HGGEASIMVTKVDEPSKYGVV+MEESTG+
Sbjct  97   LLDDSGEPFFVLNSDVISEYPLKEMIQFHKAHGGEASIMVTKVDEPSKYGVVIMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+I+L+PTSIEKEVFPKIAAE +L+AMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIQLRPTSIEKEVFPKIAAEKQLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+S+RKKSS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSIRKKSSEKLATGPHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|KDO69184.1| hypothetical protein CISIN_1g018060mg [Citrus sinensis]
Length=361

 Score =   503 bits (1294),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDD+GEPFFVLNSDVISEYPF EMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNP+VLD+IEL+PTSIEKEVFPKIA E KL+AMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLA+GA+IVGNVLV E+A+I EGCLIGPDVA+G
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_006435610.1| hypothetical protein CICLE_v10033733mg [Citrus clementina]
 gb|ESR48850.1| hypothetical protein CICLE_v10033733mg [Citrus clementina]
Length=361

 Score =   502 bits (1293),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDD+GEPFFVLNSDVISEYPF EMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNP+VLD+IEL+PTSIEKEVFPKIA E KL+AMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLA+GA+IVGNVLV E+A+I EGCLIGPDVA+G
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSFKLATGANIVGNVLVHESAQIGEGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|NP_001234084.1| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
 gb|ABE03745.2| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
Length=361

 Score =   502 bits (1293),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYPFKEMI+FHKSHGGEAS+MVT +DEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPFKEMIQFHKSHGGEASLMVTNLDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAG YLLNPSVLD+I+L PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGFYLLNPSVLDRIQLPPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SL+K SSPKLASG HIVGNV+VDE+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLKKHSSPKLASGPHIVGNVIVDESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GCVIESGVRLSRCTVMRGVRIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  SGCVIESGVRLSRCTVMRGVRIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_008441398.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Cucumis 
melo]
Length=361

 Score =   501 bits (1290),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 243/265 (92%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP K+MIEFHKSHGGEASIMVTKVDEPSKYGVVVM+ESTGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKQMIEFHKSHGGEASIMVTKVDEPSKYGVVVMDESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP IAAE KLYAMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPSIAAEQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL SLRK SS  LA G+HIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLNSLRKNSSSMLAVGSHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_006486418.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
[Citrus sinensis]
Length=361

 Score =   501 bits (1290),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 257/265 (97%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDD+GEPFFVLNSDVISEYPF EMIEFHK+HGGEASIMVTKVDEPSKYGVVVME+STGK
Sbjct  97   LIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEDSTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNP+VLD+IEL+PTSIEKEVFPKIA E KL+AMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLA+GA+IVGNVLV E+A+I EGCLIGPDVA+G
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSFKLATGANIVGNVLVHESAQIGEGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_004307574.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004307575.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   501 bits (1289),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 241/265 (91%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVV+EESTGK
Sbjct  97   LIDQSGEPFFVLNSDVISEYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVLEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNP VLD+I+L+PTSIEKEVFPKIA+ENKL+AMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPEVLDRIQLRPTSIEKEVFPKIASENKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKSS KLA G HIVGNVLVDETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKKSSSKLAKGTHIVGNVLVDETATIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_002311190.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEE88557.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=361

 Score =   500 bits (1288),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP K+MI+FHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKQMIDFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSV+D+IEL+PTSIEKEVFPKIAA+NKLYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVIDRIELRPTSIEKEVFPKIAADNKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI GLRLYL+SL+K SS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYIVGLRLYLDSLKKNSSSKLATGPHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRC+VMRGV IKKH CISSSIIGWHSTVG+WARVENMTILGEDV +CDE
Sbjct  277  PGCIVESGVRLSRCSVMRGVYIKKHACISSSIIGWHSTVGRWARVENMTILGEDVQVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_011035050.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
 ref|XP_011035125.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
Length=361

 Score =   500 bits (1288),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP K+MI+FHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKQMIDFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSV+D+IEL+PTSIEKEVFPKIAA+NKLYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVIDRIELRPTSIEKEVFPKIAADNKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI GLRLYL+SL+K SS KLA+G HIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYIVGLRLYLDSLKKNSSSKLATGPHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRC+VMRGV IKKH CISSSIIGWHSTVG+WARVENMTILGEDV +CDE
Sbjct  277  PGCIVESGVRLSRCSVMRGVYIKKHACISSSIIGWHSTVGRWARVENMTILGEDVQVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_010691388.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Beta vulgaris 
subsp. vulgaris]
Length=361

 Score =   499 bits (1286),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID+SGEPFFVLNSDVISEYP K+MIEFHKSHGGEASIMVTKVDEPSKYGVVV EESTGK
Sbjct  97   LIDESGEPFFVLNSDVISEYPLKQMIEFHKSHGGEASIMVTKVDEPSKYGVVVTEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIA+E +LYAMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDKIELRPTSIEKEVFPKIASEKQLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRK S  +LASG+HI+GNVLVDE+A I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKNSPSQLASGSHIIGNVLVDESATIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIE+GVRLSRCT+MRGVR+KKH CISSSIIGWHSTVGQWARVENMT+LGEDVH+CDE
Sbjct  277  PGCVIEAGVRLSRCTIMRGVRVKKHACISSSIIGWHSTVGQWARVENMTVLGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIK+SIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKTSILKPEIVM  361



>gb|AET14212.1| GDP-D-mannose pyrophosphorylase [Brassica rapa subsp. chinensis]
Length=329

 Score =   498 bits (1282),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVM+E+TGK
Sbjct  65   LVDGSGEPFFVLNSDVISEYPLKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMDETTGK  124

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  125  VEKFVEKPKLFVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  184

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  185  WMDIGQPRDYITGLRLYLDSLRKKSPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIG  244

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRG RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+CDE
Sbjct  245  PGCVVESGVRLSRCTVMRGARIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVCDE  304

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY+NGGVVLPHKEIKS+IL PEIVM
Sbjct  305  IYTNGGVVLPHKEIKSNILKPEIVM  329



>ref|XP_009133383.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Brassica 
rapa]
 emb|CDY61780.1| BnaC03g72590D [Brassica napus]
Length=361

 Score =   498 bits (1283),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVM+E+TGK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPLKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMDETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRG RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGARIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY+NGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYTNGGVVLPHKEIKSNILKPEIVM  361



>gb|ADV59923.1| putative GDP-mannose pyrophosphorylase [Citrus unshiu]
Length=361

 Score =   498 bits (1282),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 240/265 (91%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDD+GEPFFVLNSDVISEYPF EMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNP+VLD+IEL+PTSIEKEVFPKIA E KL+AMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLA+GA+IVGNVLV E+A+I E CLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSFKLATGANIVGNVLVHESAQIGEECLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGV LPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVALPHKEIKSSILKPEIVM  361



>ref|XP_004138454.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004154737.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cucumis 
sativus]
 gb|KGN45744.1| hypothetical protein Csa_6G008750 [Cucumis sativus]
Length=361

 Score =   498 bits (1282),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 242/265 (91%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP K+MIEFHKSHGGEASIMVTKVDEPSKYGVVVM+ESTGK
Sbjct  97   LIDASGEPFFVLNSDVISEYPLKQMIEFHKSHGGEASIMVTKVDEPSKYGVVVMDESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP IAAE KLYAMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPSIAAEQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL SLRK SS  LA G+HIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLNSLRKNSSSVLAVGSHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_004970565.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Setaria italica]
Length=361

 Score =   498 bits (1281),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SGEPFFVLNSDVISEYPF E+IEFHKSHGGEA+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LADGSGEPFFVLNSDVISEYPFAELIEFHKSHGGEATIMVTKVDEPSKYGVVVMEEATGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP+IAA+ KL+AMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPQIAADQKLHAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SLRKKS+ KLASGAH+VGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLRKKSAAKLASGAHVVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|NP_001276240.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 gb|ACX37458.1| GDP-D-mannose pyrophosphorylase [Glycine max]
 gb|KHN20905.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   497 bits (1280),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKNHGGEASIMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIA+E KLYAMVLPGF
Sbjct  157  VDKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIASEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI GLRLYL+SLRKKSS KLASG+ IVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYIAGLRLYLDSLRKKSSSKLASGSQIVGNVIVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIE GVRL  CT+MRGVR+KKH C+SSSI+GWHSTVGQWARV+NMTILGEDVH+CDE
Sbjct  277  PGCVIEQGVRLKSCTIMRGVRVKKHACVSSSIVGWHSTVGQWARVDNMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSNILKPEIVM  361



>ref|XP_006601845.1| PREDICTED: uncharacterized protein LOC100818016 isoform X1 [Glycine 
max]
 ref|XP_006601846.1| PREDICTED: uncharacterized protein LOC100818016 isoform X2 [Glycine 
max]
 ref|XP_006601847.1| PREDICTED: uncharacterized protein LOC100818016 isoform X3 [Glycine 
max]
 ref|XP_006601848.1| PREDICTED: uncharacterized protein LOC100818016 isoform X4 [Glycine 
max]
 ref|XP_006601849.1| PREDICTED: uncharacterized protein LOC100818016 isoform X5 [Glycine 
max]
 gb|KHN07601.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   497 bits (1279),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKTHGGEATIMVTKVDEPSKYGVVVMEETTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYI+GL LYL+SLRKKS  KLASG H VGNV+V ETA I EGCL+GPDVAIG
Sbjct  217  WMDIGQPKDYISGLTLYLDSLRKKSPSKLASGPHFVGNVIVHETATIGEGCLVGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKHTCIS+SIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHTCISNSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSNILKPEIVM  361



>emb|CDY07636.1| BnaA03g18750D [Brassica napus]
Length=401

 Score =   498 bits (1282),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVM+E+TGK
Sbjct  137  LVDGSGEPFFVLNSDVISEYPLKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMDETTGK  196

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  197  VEKFVEKPKLFVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  256

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  257  WMDIGQPRDYITGLRLYLDSLRKKSPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIG  316

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRG RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+CDE
Sbjct  317  PGCVVESGVRLSRCTVMRGARIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVCDE  376

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY+NGGVVLPHKEIKS+IL PEIVM
Sbjct  377  IYTNGGVVLPHKEIKSNILKPEIVM  401



>emb|CDP00140.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   496 bits (1277),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SGEPFFVLNSDVISEYP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVV+EE+TG+
Sbjct  97   LADGSGEPFFVLNSDVISEYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVLEEATGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVL +I+L+PTSIEKEVFPKIAAE  LYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLNPSVLGRIKLRPTSIEKEVFPKIAAEKMLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK + KLASG HIVGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKDASKLASGTHIVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEAGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_010554624.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010554625.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
Length=361

 Score =   496 bits (1277),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 238/265 (90%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP +EMI FHK+HGGEASIMVTKVDEPSKYGVVV +E+TGK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPLEEMIAFHKAHGGEASIMVTKVDEPSKYGVVVTDENTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLA+G+HIVGNV+V E+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSSSKLATGSHIVGNVIVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEPGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSI+ PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSIMKPEIVM  361



>gb|ACM90325.1| GDP-D-mannose pyrophosphorylase [Ribes nigrum]
Length=261

 Score =   492 bits (1266),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 238/261 (91%), Positives = 249/261 (95%), Gaps = 0/261 (0%)
 Frame = -2

Query  876  SGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGKVERF  697
            SGEPFFVLNSDVISEYP KEMI FHKSHGGEASIMVTKVDEPSKYGVV MEES+GKVERF
Sbjct  1    SGEPFFVLNSDVISEYPLKEMIAFHKSHGGEASIMVTKVDEPSKYGVVCMEESSGKVERF  60

Query  696  VEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGFWMDI  517
            VEKPK+FVGNKINAGIYLLNPSVLD+IELKPTSIEKE+FPKIAAE KL+AMVLPGFWMDI
Sbjct  61   VEKPKLFVGNKINAGIYLLNPSVLDRIELKPTSIEKEIFPKIAAEEKLFAMVLPGFWMDI  120

Query  516  GQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCV  337
            GQPRDYITGLRLYLESLRKKSS KLA+G+HIVGNVLVDETAKI EGCLIGPDVAIGPGCV
Sbjct  121  GQPRDYITGLRLYLESLRKKSSSKLATGSHIVGNVLVDETAKIGEGCLIGPDVAIGPGCV  180

Query  336  IESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSN  157
            +ESGVRLSRCTVMR  R+KKH CIS SIIGWHSTVGQWARVENMTILGEDVH+CDEIYSN
Sbjct  181  VESGVRLSRCTVMRNARVKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVCDEIYSN  240

Query  156  GGVVLPHKEIKSSILNPEIVM  94
            GGVVLP KEIK+SIL PEIVM
Sbjct  241  GGVVLPXKEIKTSILKPEIVM  261



>ref|NP_001142302.1| uncharacterized protein LOC100274471 [Zea mays]
 ref|XP_008654645.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 ref|XP_008654646.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 ref|XP_008654647.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 gb|ACF80591.1| unknown [Zea mays]
 gb|ACF88136.1| unknown [Zea mays]
 gb|AFW84601.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84602.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84603.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84604.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84605.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
Length=361

 Score =   496 bits (1276),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 233/265 (88%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SGEPFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LADGSGEPFFVLNSDVISEYPFAELIKFHKSHGGEATIMVTKVDEPSKYGVVVMEEATGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP+IAA+ +LYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPQIAADQQLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SLRKKS+ +LA+GAH+VGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLRKKSAARLAAGAHVVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|KEH34762.1| mannose-1-phosphate guanylyltransferase-like protein [Medicago 
truncatula]
Length=302

 Score =   492 bits (1267),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP KEMI+FHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG+
Sbjct  38   LIDGSGEPFFVLNSDVISEYPLKEMIKFHKSHGGEASIMVTKVDEPSKYGVVVMEETTGQ  97

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD IEL+PTSIEKEVFPKIAA  KLYAMVLPGF
Sbjct  98   VEKFVEKPKLFVGNKINAGIYLLNPSVLDHIELRPTSIEKEVFPKIAANKKLYAMVLPGF  157

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+S KLASG HI+GNV+V ETAKI EGCLIGPDVAIG
Sbjct  158  WMDIGQPRDYITGLRLYLDSLRKKTSSKLASGPHILGNVIVHETAKIGEGCLIGPDVAIG  217

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC IESGVRLS CTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  218  PGCTIESGVRLSCCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDE  277

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIK+SILNPEIVM
Sbjct  278  VYSNGGVVLPHKEIKTSILNPEIVM  302



>ref|XP_004977599.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Setaria italica]
Length=361

 Score =   494 bits (1273),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SGEPFFVLNSDVISEYPF E+IEFHKSHGGEA+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LADGSGEPFFVLNSDVISEYPFAELIEFHKSHGGEATIMVTKVDEPSKYGVVVMEEATGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP+IAA+ KL+AMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPQIAADQKLHAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SLRKKS+ KLASGAH+VGNVLV E+AKI E CLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLRKKSAAKLASGAHVVGNVLVHESAKIGECCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_010505663.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010505664.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010508973.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010517339.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
Length=361

 Score =   494 bits (1272),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP KEM+EFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPLKEMLEFHKTHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  157  VEKFVEKPKLYVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KL SG HIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPAKLTSGPHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCIVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIK++IL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKTNILKPEIVM  361



>emb|CDM85018.1| unnamed protein product [Triticum aestivum]
Length=361

 Score =   494 bits (1272),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVME++TG 
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIQFHKSHGGEATIMVTKVDEPSKYGVVVMEDTTGV  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAA+ KLYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIAADQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS+ KLA+GAH+VGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSAAKLAAGAHVVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_006294448.1| hypothetical protein CARUB_v10023461mg, partial [Capsella rubella]
 gb|EOA27346.1| hypothetical protein CARUB_v10023461mg, partial [Capsella rubella]
Length=371

 Score =   494 bits (1273),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP KEM+EFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  107  LVDGSGEPFFVLNSDVISEYPLKEMLEFHKTHGGEASIMVTKVDEPSKYGVVVMEESTGR  166

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  167  VEKFVEKPKLYVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  226

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KL SG+HIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  227  WMDIGQPRDYITGLRLYLDSLRKKSPAKLTSGSHIVGNVLVDETAKIGEGCLIGPDVAIG  286

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  287  PGCIVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDE  346

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIK++IL PEIVM
Sbjct  347  IYSNGGVVLPHKEIKTNILKPEIVM  371



>gb|ACR34770.1| unknown [Zea mays]
 tpg|DAA56850.1| TPA: hypothetical protein ZEAMMB73_139428 [Zea mays]
Length=302

 Score =   492 bits (1266),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SG+PFFVLNSDVISEYPF E+I+FHK HGGEA+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  38   LADGSGQPFFVLNSDVISEYPFAELIKFHKCHGGEATIMVTKVDEPSKYGVVVMEEATGR  97

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP+IAA+ +LYAMVLPGF
Sbjct  98   VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPQIAADQQLYAMVLPGF  157

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+S+RKKS+ KLA+GAH+VGNVLV E+AKI EGCLIGPDVAIG
Sbjct  158  WMDVGQPRDYITGLRLYLDSIRKKSAAKLATGAHVVGNVLVHESAKIGEGCLIGPDVAIG  217

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE
Sbjct  218  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDE  277

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  278  VYSNGGVVLPHKEIKSSILKPEIVM  302



>gb|ACW84415.1| GDP-D-mannose pyrophosphorylase [Glycine max]
Length=361

 Score =   494 bits (1272),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LI DSGEPFFVLNSDVISEYP KEMI+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LISDSGEPFFVLNSDVISEYPLKEMIQFHKTHGGEATIMVTKVDEPSKYGVVVMEETTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYI+GL LYL+SLRKKS  KLASG H VGNV+V ETA I EGCL+GPDVAIG
Sbjct  217  WMDIGQPKDYISGLTLYLDSLRKKSPSKLASGPHFVGNVIVHETATIGEGCLVGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKHTCIS+SIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHTCISNSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSNILKPEIVM  361



>ref|XP_003600761.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
 gb|AES71012.1| mannose-1-phosphate guanylyltransferase-like protein [Medicago 
truncatula]
Length=361

 Score =   494 bits (1271),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP KEMI+FHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LIDGSGEPFFVLNSDVISEYPLKEMIKFHKSHGGEASIMVTKVDEPSKYGVVVMEETTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD IEL+PTSIEKEVFPKIAA  KLYAMVLPGF
Sbjct  157  VEKFVEKPKLFVGNKINAGIYLLNPSVLDHIELRPTSIEKEVFPKIAANKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+S KLASG HI+GNV+V ETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKTSSKLASGPHILGNVIVHETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC IESGVRLS CTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCTIESGVRLSCCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIK+SILNPEIVM
Sbjct  337  VYSNGGVVLPHKEIKTSILNPEIVM  361



>ref|XP_006411211.1| hypothetical protein EUTSA_v10016850mg [Eutrema salsugineum]
 dbj|BAJ34137.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52664.1| hypothetical protein EUTSA_v10016850mg [Eutrema salsugineum]
Length=361

 Score =   494 bits (1271),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPLKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  157  VEKFVEKPKLYVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KL +G HIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPAKLTTGPHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRG RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGARIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSNILKPEIVM  361



>ref|XP_010534527.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Tarenaya 
hassleriana]
 ref|XP_010534528.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Tarenaya 
hassleriana]
Length=361

 Score =   494 bits (1271),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP +EMI FHK+HGGEASI+VTKVDEPSKYGVVVM+E+ GK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPLEEMIAFHKAHGGEASIVVTKVDEPSKYGVVVMDETDGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI+GLRLYL+SLRKKSS KLA G HIVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYISGLRLYLDSLRKKSSSKLARGEHIVGNVIVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRCT+MRG RIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+CDE
Sbjct  277  PGCIVESGVRLSRCTIMRGARIKKHACISSSIIGWHSTVGKWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSI+ PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSIMKPEIVM  361



>ref|XP_002308180.1| hypothetical protein POPTR_0006s09130g [Populus trichocarpa]
 gb|EEE91703.1| hypothetical protein POPTR_0006s09130g [Populus trichocarpa]
Length=361

 Score =   494 bits (1271),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSG PFFVLNSDVISEYP K+MIEFHK HGGEASIMVTKVDEPSKYGVV+MEE++GK
Sbjct  97   LIDDSGAPFFVLNSDVISEYPLKQMIEFHKGHGGEASIMVTKVDEPSKYGVVLMEETSGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAENKL+AMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAENKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DY+TGLRLYL+SLRK SSPKLA+G +IVGNVLVDE+A I EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYVTGLRLYLDSLRKMSSPKLATGPNIVGNVLVDESAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+I+SGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVG+WAR+ENMTILGEDVH+ DE
Sbjct  277  PGCIIDSGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGRWARIENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_007141846.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 ref|XP_007141847.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 gb|ESW13840.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 gb|ESW13841.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
Length=361

 Score =   493 bits (1269),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 233/265 (88%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHK HGGEASIMVTKVDEPSKYGVVVME+STG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKGHGGEASIMVTKVDEPSKYGVVVMEDSTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVL++IEL+PTSIEKEVFPKIAAE KL+AMVLPGF
Sbjct  157  VDKFVEKPKLFVGNKINAGIYLLNPSVLNRIELRPTSIEKEVFPKIAAEKKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI+GLRLYL+SLRKKSS KLASG+ IVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYISGLRLYLDSLRKKSSSKLASGSQIVGNVIVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+IE GVRL  CT+MRGVR+KKH C+SSSIIGWHSTVGQW+RV+NMTILGEDVH+CDE
Sbjct  277  PGCIIEQGVRLKSCTIMRGVRVKKHACVSSSIIGWHSTVGQWSRVDNMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSNILKPEIVM  361



>ref|XP_002879816.1| hypothetical protein ARALYDRAFT_483004 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56075.1| hypothetical protein ARALYDRAFT_483004 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   493 bits (1269),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP KEM+EFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPLKEMLEFHKTHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  157  VEKFVEKPKLYVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KL SG HIVGNVLVDETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPAKLTSGPHIVGNVLVDETATIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCIVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSNILKPEIVM  361



>gb|EMT31032.1| Mannose-1-phosphate guanyltransferase beta [Aegilops tauschii]
Length=361

 Score =   493 bits (1269),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVME++TG 
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIQFHKSHGGEATIMVTKVDEPSKYGVVVMEDTTGV  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAA+ KLYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIAADQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS+ KLA+GAHIVGNVLV ++AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSAAKLAAGAHIVGNVLVHDSAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_010262630.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nelumbo 
nucifera]
Length=361

 Score =   493 bits (1269),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMI+FHK+HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIDFHKAHGGEASIMVTKVDEPSKYGVVVMEEATGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KL+AM LPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEGKLFAMALPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKSS +LA G+HIVGNVLV ETA I +GCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKKSSSQLARGSHIVGNVLVHETAVIGDGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVM+G  IKKHTCISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMQGTHIKKHTCISSSIIGWHSTVGQWARIENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGG+VLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGIVLPHKEIKSSILKPEIVM  361



>ref|XP_009141836.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Brassica 
rapa]
Length=361

 Score =   493 bits (1269),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP +EMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPLREMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  157  VEKFVEKPKLYVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKKSPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH C+SSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACVSSSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY+NGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYTNGGVVLPHKEIKSNILKPEIVM  361



>ref|XP_010931208.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   493 bits (1269),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYPF E+I+FHK+HGGEA+IMVTKVDEPSKYGV+VMEE TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPFAELIQFHKAHGGEATIMVTKVDEPSKYGVLVMEEETGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFPKIAA+ KLYAMVLPGF
Sbjct  157  VDRFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPKIAADQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KLA+G HIVGNVLV E A I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPYKLAAGPHIVGNVLVHEGAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHST+GQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSNILKPEIVM  361



>ref|XP_008674826.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 ref|XP_008674827.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 ref|XP_008674828.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 gb|ACR38121.1| unknown [Zea mays]
 tpg|DAA56851.1| TPA: hypothetical protein ZEAMMB73_139428 [Zea mays]
 tpg|DAA56852.1| TPA: hypothetical protein ZEAMMB73_139428 [Zea mays]
Length=361

 Score =   493 bits (1268),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SG+PFFVLNSDVISEYPF E+I+FHK HGGEA+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LADGSGQPFFVLNSDVISEYPFAELIKFHKCHGGEATIMVTKVDEPSKYGVVVMEEATGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP+IAA+ +LYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPQIAADQQLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+S+RKKS+ KLA+GAH+VGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSIRKKSAAKLATGAHVVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|NP_181507.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 ref|NP_001189713.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 sp|O22287.1|GMPP1_ARATH RecName: Full=Mannose-1-phosphate guanylyltransferase 1; AltName: 
Full=GDP-mannose pyrophosphorylase 1; AltName: Full=Protein 
CYTOKINESIS DEFECTIVE 1; AltName: Full=Protein EMBRYO DEFECTIVE 
101; AltName: Full=Protein HYPERSENSITIVE TO AMMONIUM 
ION 1; AltName: Full=Protein SENSITIVE TO OZONE 1; AltName: 
Full=Protein VITAMIN C DEFECTIVE 1 [Arabidopsis thaliana]
 gb|AAK32825.1|AF361812_1 At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAL16129.1|AF428297_1 At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAB87126.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAC78474.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAD04627.1| CYT1 protein [Arabidopsis thaliana]
 gb|AAL09781.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAM65235.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAM91473.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAN31841.1| putative GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAP21173.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AEC09721.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 gb|AEC09722.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
Length=361

 Score =   493 bits (1268),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP KEM+EFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LLDGSGEPFFVLNSDVISEYPLKEMLEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  157  VEKFVEKPKLYVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KL SG HIVGNVLVDETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPAKLTSGPHIVGNVLVDETATIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCIVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSNILKPEIVM  361



>gb|KHN17882.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   493 bits (1268),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LI DSGEPFFVLNSDVISEYP KEMI+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LISDSGEPFFVLNSDVISEYPLKEMIQFHKTHGGEATIMVTKVDEPSKYGVVVMEETTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYI+GL LYL+SLRKKS  KLASG H VGNV+V ETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYISGLTLYLDSLRKKSPSKLASGPHFVGNVIVHETATIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV++SGVRLSRCTVMRGVRIKKHTCIS+SIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVDSGVRLSRCTVMRGVRIKKHTCISNSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSNILKPEIVM  361



>gb|KDO69185.1| hypothetical protein CISIN_1g018060mg [Citrus sinensis]
Length=358

 Score =   492 bits (1267),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 238/265 (90%), Positives = 254/265 (96%), Gaps = 3/265 (1%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDD+GEPFFVLNSDVISEYPF EMIEFHK+HGGEASIMV   DEPSKYGVVVMEESTGK
Sbjct  97   LIDDTGEPFFVLNSDVISEYPFAEMIEFHKAHGGEASIMV---DEPSKYGVVVMEESTGK  153

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNP+VLD+IEL+PTSIEKEVFPKIA E KL+AMVLPGF
Sbjct  154  VEKFVEKPKLFVGNKINAGIYLLNPAVLDRIELRPTSIEKEVFPKIALEGKLFAMVLPGF  213

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKSS KLA+GA+IVGNVLV E+A+I EGCLIGPDVA+G
Sbjct  214  WMDIGQPRDYITGLRLYLDSLRKKSSLKLATGANIVGNVLVHESAQIGEGCLIGPDVAVG  273

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  274  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  333

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  334  IYSNGGVVLPHKEIKSSILKPEIVM  358



>ref|XP_008777609.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   492 bits (1267),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVI+EYPF E+I+FHK+HGG+A+IMVTKVDEPSKYGVVVMEE TG+
Sbjct  97   LIDSSGEPFFVLNSDVINEYPFAELIQFHKAHGGDATIMVTKVDEPSKYGVVVMEEETGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFPKIAA+ KLYAMVLPGF
Sbjct  157  VDRFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPKIAADQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KLA+G HIVGNVLV E+A I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPYKLAAGRHIVGNVLVHESAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRCTVMRGVRIKKH CIS SIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCIVESGVRLSRCTVMRGVRIKKHACISGSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>emb|CDP16056.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   492 bits (1267),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SGEPFFVLNSDVISEYP KEMIEFHKSHGGEASI+VTKVDEPSKYGVVV+EESTG+
Sbjct  97   LADGSGEPFFVLNSDVISEYPLKEMIEFHKSHGGEASIVVTKVDEPSKYGVVVLEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE  LYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKMLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLR+K + KLASG HIVGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRRKDASKLASGTHIVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMRGVRIKKH CISSSIIGWHS+VG+WARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEAGVRLSRCTVMRGVRIKKHACISSSIIGWHSSVGEWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL  EIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKSEIVM  361



>ref|XP_010088589.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
 gb|EXB36730.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
Length=361

 Score =   492 bits (1266),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 239/265 (90%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHKSH GEASIMVTKVDEPSKYGVVVM+E+TGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKSHVGEASIMVTKVDEPSKYGVVVMDETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFPKIAAENKLYAMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPKIAAENKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKSS KLASG+HI+GNVLVDE+A I +GCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKKSSSKLASGSHIIGNVLVDESAVIGDGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC IE GVRLS CTVMRGVRIKKH CIS  IIGWHSTVG+WAR+ENMTILGEDVHI DE
Sbjct  277  PGCEIEQGVRLSHCTVMRGVRIKKHACISRGIIGWHSTVGRWARIENMTILGEDVHIGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>emb|CDY07033.1| BnaA04g22820D [Brassica napus]
Length=361

 Score =   491 bits (1265),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP +EMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPLREMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  157  VEKFVEKPKLYVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKKSPAKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRG RIKKH C+SSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGARIKKHACVSSSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY+NGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYTNGGVVLPHKEIKSNILKPEIVM  361



>ref|NP_001240188.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 ref|XP_006590281.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X1 [Glycine max]
 gb|ACU21527.1| unknown [Glycine max]
Length=361

 Score =   491 bits (1265),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LI DSGEPFFVLNSDVISEYP KEMI+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LISDSGEPFFVLNSDVISEYPLKEMIQFHKTHGGEATIMVTKVDEPSKYGVVVMEETTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAA+ KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAADKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYI+GL LYL+SLRKKS  KLASG H VGNV+V ETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYISGLTLYLDSLRKKSPSKLASGPHFVGNVIVHETATIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV++SGVRLSRCTVMRGVRIKKHTCIS+SIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVDSGVRLSRCTVMRGVRIKKHTCISNSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSNILKPEIVM  361



>gb|EMS68890.1| Mannose-1-phosphate guanyltransferase beta [Triticum urartu]
Length=412

 Score =   493 bits (1270),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVV E++TG 
Sbjct  148  LVDGSGEPFFVLNSDVISEYPFAELIQFHKSHGGEATIMVTKVDEPSKYGVVVTEDTTGV  207

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAA+ KLYAMVLPGF
Sbjct  208  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIAADQKLYAMVLPGF  267

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS+ KLA+GAH+VGNVLV E+AKI EGCLIGPDVAIG
Sbjct  268  WMDIGQPRDYITGLRLYLDSLRKKSAAKLAAGAHVVGNVLVHESAKIGEGCLIGPDVAIG  327

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  328  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDE  387

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  388  VYSNGGVVLPHKEIKSSILKPEIVM  412



>gb|ACN66754.1| GMP [Carica papaya]
Length=361

 Score =   491 bits (1265),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID+SGEPFFVLNSDVISEYP  EMI+FH SHGGEASIMVTKVDEPSKYGVVV+EE+T K
Sbjct  97   LIDESGEPFFVLNSDVISEYPLTEMIKFHNSHGGEASIMVTKVDEPSKYGVVVIEEATRK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+I+L+PTSIEKEVFP+IAAENKLYAMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIQLRPTSIEKEVFPEIAAENKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRK SS KLA+G+HIVGNVLVDE+A IE+GCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKTSSSKLATGSHIVGNVLVDESAVIEDGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC IESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE
Sbjct  277  PGCTIESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>emb|CDX93234.1| BnaC04g46620D [Brassica napus]
Length=361

 Score =   491 bits (1264),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP +EMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPLREMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  157  VEKFVEKPKLYVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKS  KL +GAHIVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKKSPGKLTTGAHIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH C+SSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACVSSSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY+NGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYTNGGVVLPHKEIKSNILKPEIVM  361



>gb|AHB17740.1| GDP-mannose pyrophosphorylase [Pogonatherum paniceum]
Length=361

 Score =   491 bits (1264),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 230/265 (87%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SGEPFFVLNSDVISEYPF E+I+FHK HGGEA+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LADGSGEPFFVLNSDVISEYPFAELIKFHKCHGGEATIMVTKVDEPSKYGVVVMEEATGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP+IAA+ KLYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPQIAADQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SLRKK++ +LA+GAH++GNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLRKKTADRLATGAHVIGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV++ GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+CDE
Sbjct  277  PGCVVDDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_003544186.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Glycine 
max]
Length=374

 Score =   492 bits (1266),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 233/262 (89%), Positives = 251/262 (96%), Gaps = 0/262 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKNHGGEASIMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIA+E KLYAMVLPGF
Sbjct  157  VDKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIASEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI GLRLYL+SLRKKSS KLASG+ IVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYIAGLRLYLDSLRKKSSSKLASGSQIVGNVIVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIE GVRL  CT+MRGVR+KKH C+SSSI+GWHSTVGQWARV+NMTILGEDVH+CDE
Sbjct  277  PGCVIEQGVRLKSCTIMRGVRVKKHACVSSSIVGWHSTVGQWARVDNMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPE  103
            IYSNGGVVLPHKEIKS+IL PE
Sbjct  337  IYSNGGVVLPHKEIKSNILKPE  358



>ref|XP_011019240.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like, partial 
[Populus euphratica]
 ref|XP_011006397.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like, partial 
[Populus euphratica]
Length=329

 Score =   489 bits (1260),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDD+G PFFVLNSDVISEYP K+MIEFHK HGGEASIMVTKVDEPSKYGVV++EE++GK
Sbjct  65   LIDDTGAPFFVLNSDVISEYPLKQMIEFHKGHGGEASIMVTKVDEPSKYGVVLLEETSGK  124

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAENKL+AMVLPGF
Sbjct  125  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAENKLFAMVLPGF  184

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DY+TGLRLYL+SLRK SSPKLA+G +IVGNVLVDE+A I EGCLIGPDVAIG
Sbjct  185  WMDIGQPKDYVTGLRLYLDSLRKMSSPKLANGPNIVGNVLVDESAVIGEGCLIGPDVAIG  244

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+I+SGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVG+WAR+ENMTILGEDVHI DE
Sbjct  245  PGCIIDSGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGRWARMENMTILGEDVHIGDE  304

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  305  VYSNGGVVLPHKEIKSSILKPEIVM  329



>ref|XP_002456631.1| hypothetical protein SORBIDRAFT_03g039740 [Sorghum bicolor]
 gb|EES01751.1| hypothetical protein SORBIDRAFT_03g039740 [Sorghum bicolor]
Length=361

 Score =   491 bits (1263),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 230/265 (87%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SGEPFFVLNSDVISEYPF E+I+FHK HGGEA+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LADGSGEPFFVLNSDVISEYPFAELIKFHKCHGGEATIMVTKVDEPSKYGVVVMEEATGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP+IAA+ KLYAMVLPGF
Sbjct  157  VERFVEKPKVFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPQIAADQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SLRKKS+ +LA+G H+VGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLRKKSAARLATGTHVVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVG+WAR+ENMTILGEDVH+CDE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGKWARIENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_006649823.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
[Oryza brachyantha]
Length=361

 Score =   490 bits (1262),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 232/265 (88%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SG+PFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE TGK
Sbjct  97   LADGSGDPFFVLNSDVISEYPFAELIQFHKSHGGEATIMVTKVDEPSKYGVVVMEEETGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAA+N L+AMVLPGF
Sbjct  157  VERFVEKPKVFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIAADNGLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+  KLASGAH++GNVLV ETA I EGCLIGPDVA+G
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKAPAKLASGAHVLGNVLVHETAVIGEGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMRG R+KKH CISSSIIGWHSTVG WARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEAGVRLSRCTVMRGARVKKHACISSSIIGWHSTVGMWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_010529799.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010529800.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010529801.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
Length=361

 Score =   489 bits (1260),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 255/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D+SGEPFFVLNSDVI EYP +EMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LFDESGEPFFVLNSDVICEYPLQEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVL +I+L+PTSIEKE+FPKIA+ENKLYA+VLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLGRIQLRPTSIEKEIFPKIASENKLYALVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLR YL+SLRKK+SP+LA+G +I+GNVLVDE+A I EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRFYLDSLRKKASPRLATGENIIGNVLVDESAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRCT+MRGVRIKKH CISSSI+GWHSTVG+WARVENMTILGEDVH+ DE
Sbjct  277  PGCVIESGVRLSRCTIMRGVRIKKHACISSSIVGWHSTVGRWARVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSILNPEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILNPEIVM  361



>gb|KJB76778.1| hypothetical protein B456_012G106900 [Gossypium raimondii]
Length=302

 Score =   486 bits (1252),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP KEM+ FHK HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  38   LIDGSGEPFFVLNSDVISEYPLKEMVNFHKGHGGEASIMVTKVDEPSKYGVVVMEETTGK  97

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKP+IFVGNKINAGIYLLNPSVL++IEL+PTSIEKEVFPKIA ENKLYAMVLPGF
Sbjct  98   VKKFVEKPQIFVGNKINAGIYLLNPSVLNRIELRPTSIEKEVFPKIATENKLYAMVLPGF  157

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLR+YLESLRKKSS KL++G+H VGNVLVDE+A I +GCLIGPDVAIG
Sbjct  158  WMDIGQPKDYITGLRMYLESLRKKSSAKLSTGSHFVGNVLVDESAVIGDGCLIGPDVAIG  217

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+IESGVRLSRCT+MRGVRIKKHTC+S+SIIGWHSTVG+WAR+ENMTILGEDVH+ DE
Sbjct  218  PGCIIESGVRLSRCTIMRGVRIKKHTCVSNSIIGWHSTVGKWARLENMTILGEDVHLGDE  277

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  278  VYSNGGVVLPHKEIKSSILKPEIVM  302



>gb|KJB76777.1| hypothetical protein B456_012G106900 [Gossypium raimondii]
Length=361

 Score =   488 bits (1257),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP KEM+ FHK HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPLKEMVNFHKGHGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKP+IFVGNKINAGIYLLNPSVL++IEL+PTSIEKEVFPKIA ENKLYAMVLPGF
Sbjct  157  VKKFVEKPQIFVGNKINAGIYLLNPSVLNRIELRPTSIEKEVFPKIATENKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLR+YLESLRKKSS KL++G+H VGNVLVDE+A I +GCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRMYLESLRKKSSAKLSTGSHFVGNVLVDESAVIGDGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+IESGVRLSRCT+MRGVRIKKHTC+S+SIIGWHSTVG+WAR+ENMTILGEDVH+ DE
Sbjct  277  PGCIIESGVRLSRCTIMRGVRIKKHTCVSNSIIGWHSTVGKWARLENMTILGEDVHLGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_007026924.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
 gb|EOY07426.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
Length=362

 Score =   488 bits (1256),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP KEMI+FHK HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  98   LIDGSGEPFFVLNSDVISEYPLKEMIDFHKGHGGEASIMVTKVDEPSKYGVVVMEETTGK  157

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP IA ENKLYAMVLPGF
Sbjct  158  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPMIAGENKLYAMVLPGF  217

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKSS +L +G++IVGNVLVDE+A I +GCLIGPDVAIG
Sbjct  218  WMDIGQPKDYITGLRLYLDSLRKKSSAELEAGSNIVGNVLVDESAVIGQGCLIGPDVAIG  277

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+IESGVRLSRCT+MRGVRIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE
Sbjct  278  PGCIIESGVRLSRCTIMRGVRIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHLGDE  337

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  338  VYSNGGVVLPHKEIKSSILKPEIVM  362



>ref|XP_007026922.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007026923.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY07424.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY07425.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
Length=361

 Score =   488 bits (1256),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP KEMI+FHK HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPLKEMIDFHKGHGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP IA ENKLYAMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPMIAGENKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKSS +L +G++IVGNVLVDE+A I +GCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKKSSAELEAGSNIVGNVLVDESAVIGQGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+IESGVRLSRCT+MRGVRIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE
Sbjct  277  PGCIIESGVRLSRCTIMRGVRIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHLGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|KHG16049.1| Mannose-1-phosphate guanyltransferase [Gossypium arboreum]
Length=361

 Score =   488 bits (1256),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 232/265 (88%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP KEM+ FHK HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPLKEMVNFHKGHGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKP+IFVGNKINAGIYLLNPSVL++IEL+PTSIEKEVFPKIAAENKLYAMVLPGF
Sbjct  157  VEKFVEKPQIFVGNKINAGIYLLNPSVLNRIELRPTSIEKEVFPKIAAENKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLR+YLESL KKSS KL++G+H VGNVLVDE+A I +GCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRMYLESLLKKSSTKLSTGSHFVGNVLVDESAVIGDGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+IESGVRLSRCT+MRGVRIKKHTC+S+SIIGWHSTVG+WAR+ENMTILGEDVH+ DE
Sbjct  277  PGCIIESGVRLSRCTIMRGVRIKKHTCVSNSIIGWHSTVGKWARLENMTILGEDVHLGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>emb|CAC35355.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
Length=361

 Score =   488 bits (1255),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP KE++EFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LLDGSGEPFFVLNSDVISEYPLKEILEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSVLD+IEL+PTSIEKE FPKIAA    YAMVLPGF
Sbjct  157  VEKFVEKPKLYVGNKINAGIYLLNPSVLDKIELRPTSIEKETFPKIAAAQGHYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KL SG HIVGNVLVDETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPAKLTSGPHIVGNVLVDETATIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCIVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSNILKPEIVM  361



>ref|XP_008785513.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785514.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785515.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785516.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785518.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785519.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785520.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785521.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   487 bits (1254),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 238/265 (90%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYPF E+I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPFAELIKFHKAHGGEATIMVTKVDEPSKYGVVVMEEETGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFPKIAA+ KLYAMVLPGF
Sbjct  157  VDRFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPKIAADQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KLA G HIVGNVLV E+A I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPYKLAVGPHIVGNVLVHESAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSR TVMRGVRIKKH CISSSIIGWH TVG+WARVENMTILGEDVH+CDE
Sbjct  277  PGCVLESGVRLSRSTVMRGVRIKKHACISSSIIGWHCTVGRWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|ACK87007.1| GDP-mannose pyrophosphorylase [Carica papaya]
Length=361

 Score =   487 bits (1253),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID+SGEPFFVLNSDVISEYP  EMI+FH SHGGEASIMVTKVDEPSKYGVVV+EE+TGK
Sbjct  97   LIDESGEPFFVLNSDVISEYPLTEMIKFHNSHGGEASIMVTKVDEPSKYGVVVIEEATGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+I+L+PTSIEKEVFP+IAAENKLYAMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIQLRPTSIEKEVFPEIAAENKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRK SS KLA+G+HIVGNVLVDE+A IE+GCLIGPDV IG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKTSSSKLATGSHIVGNVLVDESAVIEDGCLIGPDVVIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC IESGVRLSRCTVMRGVRIKKH CISSSIIGWHS VG+WARVENMTILGEDVH+ DE
Sbjct  277  PGCTIESGVRLSRCTVMRGVRIKKHACISSSIIGWHSPVGRWARVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIK SIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKFSILKPEIVM  361



>ref|XP_003564604.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brachypodium distachyon]
Length=361

 Score =   487 bits (1253),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 228/265 (86%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SG+PFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVME++TG 
Sbjct  97   LVDGSGKPFFVLNSDVISEYPFAELIQFHKSHGGEATIMVTKVDEPSKYGVVVMEDTTGV  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAA+ KLYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIAADQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKS+ +LA+GAH++GNVLV E+A I EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKKSAARLATGAHVIGNVLVHESANIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++E GVRLSRCTVMRGVRIKKH+C+S+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCIVEDGVRLSRCTVMRGVRIKKHSCVSNSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>dbj|BAJ95730.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91553.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=361

 Score =   487 bits (1253),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 233/265 (88%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVV E++TG 
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIQFHKSHGGEATIMVTKVDEPSKYGVVVTEDTTGV  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAA+ KLYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIAADQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS+ KLA G H VGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSAAKLAVGEHFVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|NP_001049673.1| Os03g0268400 [Oryza sativa Japonica Group]
 sp|Q84JH5.1|GMPP1_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
1 [Oryza sativa Japonica Group]
 gb|AAP06900.1| COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase 
involved in lipopolysaccharide biosynthesis/translation initiation 
factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) 
[Cell envelope biogenesis, outer membrane / Translation, 
ribosomal structure and biogenesis] [Oryza sativa Japonica 
Group]
 gb|AAP06910.1| putative GDP-mannose pyrophosphorylase [Oryza sativa Japonica 
Group]
 gb|ABF95179.1| mannose-1-phosphate guanyltransferase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11587.1| Os03g0268400 [Oryza sativa Japonica Group]
 gb|EAZ26390.1| hypothetical protein OsJ_10274 [Oryza sativa Japonica Group]
 dbj|BAH00737.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   486 bits (1252),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 230/265 (87%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SG+PFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVME+ T K
Sbjct  97   LADGSGDPFFVLNSDVISEYPFAELIQFHKSHGGEATIMVTKVDEPSKYGVVVMEDETDK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAA+N L+AMVLPGF
Sbjct  157  VERFVEKPKVFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIAADNGLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+  KLASGAH++GNVLV ETA I EGCLIGPDVA+G
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKAPAKLASGAHVLGNVLVHETAVIGEGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMRG R+KKH CISSSIIGWHSTVG WARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEAGVRLSRCTVMRGARVKKHACISSSIIGWHSTVGMWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_009412560.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   486 bits (1252),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 236/265 (89%), Positives = 253/265 (95%), Gaps = 1/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVM+ES GK
Sbjct  97   LMDGSGEPFFVLNSDVISEYPFAELIQFHKSHGGEATIMVTKVDEPSKYGVVVMDES-GK  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAA+ KL+AMVLPGF
Sbjct  156  VDRFVEKPKVFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAADQKLHAMVLPGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYLESLRKK+S KLA+G+HIVGNVLV E A I EGCLIGPDVAIG
Sbjct  216  WMDIGQPKDYITGLRLYLESLRKKASSKLATGSHIVGNVLVHENAVIGEGCLIGPDVAIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  276  PGCVIESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  336  IYSNGGVVLPHKEIKSSILKPEIVM  360



>gb|EAY89395.1| hypothetical protein OsI_10901 [Oryza sativa Indica Group]
Length=361

 Score =   486 bits (1251),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 230/265 (87%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SG+PFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE T K
Sbjct  97   LADGSGDPFFVLNSDVISEYPFAELIQFHKSHGGEATIMVTKVDEPSKYGVVVMEEETDK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAA+N L+AMVLPGF
Sbjct  157  VERFVEKPKVFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIAADNGLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+   LASGAH++GNVLV ETA I EGCLIGPDVA+G
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKAPANLASGAHVLGNVLVHETAVIGEGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMRG R+KKH CISSSIIGWHSTVG WARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEAGVRLSRCTVMRGARVKKHACISSSIIGWHSTVGMWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_003558261.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228817.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228818.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228819.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
Length=361

 Score =   486 bits (1250),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 227/265 (86%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SGEPFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVV E+ TGK
Sbjct  97   LADGSGEPFFVLNSDVISEYPFAELIQFHKSHGGEATIMVTKVDEPSKYGVVVTEKETGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAA+N L+AMVLPGF
Sbjct  157  VERFVEKPKVFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIAADNALFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+  +LASG H++GNVLV ETA I EGCLIGPDVA+G
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKAPARLASGTHVLGNVLVHETATIGEGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMRG R+KKH CIS SI+GWHSTVG+WARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEAGVRLSRCTVMRGARVKKHACISGSIVGWHSTVGKWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_008803133.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008803134.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008803135.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   485 bits (1249),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 233/265 (88%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE TGK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIKFHKAHGGEATIMVTKVDEPSKYGVVVMEEETGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFP+IAA+ KLYA VLPGF
Sbjct  157  VDRFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPRIAADQKLYAKVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KLA GAHIVGNVLV E+A I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPYKLAVGAHIVGNVLVHESAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRL+RCTVMRGVRIKKH CISSSIIGWHSTVGQW+R+ENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLARCTVMRGVRIKKHACISSSIIGWHSTVGQWSRIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_004984923.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
isoform X1 [Setaria italica]
 ref|XP_004984924.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
isoform X2 [Setaria italica]
Length=361

 Score =   485 bits (1248),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 227/265 (86%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SG+PFFVLNSDVISEYPF E+I+ HK+HGGEA+IMVTKVDEPSKYGVVVMEE TGK
Sbjct  97   LVDGSGDPFFVLNSDVISEYPFAELIQLHKAHGGEATIMVTKVDEPSKYGVVVMEEGTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAA+  L+AMVLPGF
Sbjct  157  VERFVEKPKVFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIAADAGLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+  +LASGAH++GNVLV ETA I EGCLIGPDVA+G
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKAPARLASGAHVLGNVLVHETAVIGEGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMRG R+K+H C+SSSIIGWHSTVG+WARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEAGVRLSRCTVMRGARVKQHACVSSSIIGWHSTVGKWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>sp|Q6Z9A3.1|GMPP3_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
3 [Oryza sativa Japonica Group]
 dbj|BAD05471.1| putative GDP-mannose pyrophosphorylase [Oryza sativa Japonica 
Group]
 gb|EAZ06115.1| hypothetical protein OsI_28352 [Oryza sativa Indica Group]
 gb|EAZ14142.1| hypothetical protein OsJ_04069 [Oryza sativa Japonica Group]
 dbj|BAH01407.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   484 bits (1247),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 228/265 (86%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG 
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIKFHKNHGGEATIMVTKVDEPSKYGVVVMEEATGM  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+I+A+ KL+AMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRISADAKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SLRK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLRKRSANRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y+NGGV+LPHKEIKSSIL PEIVM
Sbjct  337  VYTNGGVILPHKEIKSSILKPEIVM  361



>ref|XP_010923222.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010923223.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010923224.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   484 bits (1246),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 237/265 (89%), Positives = 248/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYPF E+I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPFAELIKFHKAHGGEATIMVTKVDEPSKYGVVVMEEETGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFPKIAA+ KLYAMVLPGF
Sbjct  157  VDRFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPKIAADQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KLA G HIVGNVLV ETA I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPYKLAVGPHIVGNVLVHETAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GCV+ESGVRLSR TVMR VRIKKH CISSSIIGWH TVGQWARVENMTILGEDVH+CDE
Sbjct  277  QGCVVESGVRLSRSTVMREVRIKKHACISSSIIGWHCTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL P+IVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPQIVM  361



>ref|XP_009601713.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009601714.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   484 bits (1246),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L DDSGEPFFVLNSDVI +YP K+MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE TG+
Sbjct  97   LRDDSGEPFFVLNSDVICDYPLKQMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEGTGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+I+L+PTSIEKEVFP IAAE KL+AMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIQLRPTSIEKEVFPSIAAEKKLHAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRKKSSP LA G HI+GNVL+DE+A I +GCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDSLRKKSSPDLAVGPHILGNVLMDESAVIGDGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRCT+MRGVRIKKH C+SSSI+GWHSTVG+WARVENMTILGEDVH+ DE
Sbjct  277  PGCVIESGVRLSRCTIMRGVRIKKHACVSSSIVGWHSTVGRWARVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>gb|KHG01639.1| hypothetical protein F383_21310 [Gossypium arboreum]
Length=302

 Score =   481 bits (1239),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYPFKEMIEFHK+HGGE SI+VTKVDEPSKYGV+VMEE+TGK
Sbjct  38   LIDGSGEPFFVLNSDVISEYPFKEMIEFHKAHGGEVSIVVTKVDEPSKYGVMVMEETTGK  97

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEK K+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKE+FPKIAAE KLYA+VLPGF
Sbjct  98   VDKFVEKLKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEIFPKIAAEKKLYAIVLPGF  157

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYI GLRLYL+SLRKKSS KLA+G HIVGNVLV E+AKI EGCLIGPDV +G
Sbjct  158  WMDIGQPKDYIAGLRLYLDSLRKKSSTKLATGHHIVGNVLVHESAKIGEGCLIGPDVVVG  217

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLS CTVMRGVRIKKH CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  218  PGCVVEAGVRLSCCTVMRGVRIKKHACISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  277

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY NGGV+LPHKEIKSSIL PEIVM
Sbjct  278  IYGNGGVILPHKEIKSSILKPEIVM  302



>ref|XP_009407514.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   483 bits (1244),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 230/265 (87%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVM+E TG+
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIQFHKSHGGEATIMVTKVDEPSKYGVVVMDEETGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPKIFVGNKINAGIYLLNPSVLD IEL+PTSIEKEVFPKI+A  KLYAMVLPGF
Sbjct  157  VDRFVEKPKIFVGNKINAGIYLLNPSVLDHIELRPTSIEKEVFPKISAGQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+DYITGLRLYL+SLRKK+  +LA+G HIVGNVLV E A I EGCLIGPDVAIG
Sbjct  217  WMDVGQPKDYITGLRLYLDSLRKKAPSRLAAGPHIVGNVLVHENAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRCTVMRGVRIKKH+C+SSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVIESGVRLSRCTVMRGVRIKKHSCVSSSIIGWHSTVGQWARIENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_011085013.1| PREDICTED: LOW QUALITY PROTEIN: mannose-1-phosphate guanylyltransferase 
1-like [Sesamum indicum]
Length=358

 Score =   483 bits (1244),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 235/265 (89%), Positives = 250/265 (94%), Gaps = 3/265 (1%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP K+MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKQMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINA       S+LD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAXXXX---SILDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  213

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KLASG+HI+GNVLVDE+AKI +GCLIGPDVAIG
Sbjct  214  WMDIGQPRDYITGLRLYLDSLRKKSPLKLASGSHIIGNVLVDESAKIGDGCLIGPDVAIG  273

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHST+GQWARVENMTILGEDVH+ DE
Sbjct  274  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTIGQWARVENMTILGEDVHVGDE  333

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  334  VYSNGGVVLPHKEIKSSILKPEIVM  358



>ref|XP_006429172.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
 gb|ESR42412.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
Length=302

 Score =   481 bits (1238),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 232/265 (88%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP K+MIEFH+  GGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  38   LIDDSGEPFFVLNSDVISEYPLKQMIEFHRGRGGEASIMVTKVDEPSKYGVVVMEETTGK  97

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK FVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAAENKL+AMVLPGF
Sbjct  98   VEKFVEKPKNFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPEIAAENKLFAMVLPGF  157

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+ L+K SS KLA+G++I+GNVLV E AKI +GCLIGPDVAIG
Sbjct  158  WMDIGQPKDYITGLRLYLDFLQKNSSSKLATGSNIIGNVLVHEGAKIGDGCLIGPDVAIG  217

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIE GVRLSRCTVMRGVRIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE
Sbjct  218  PGCVIEPGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHVADE  277

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNG VVLPHKEIKSSI+NPEIVM
Sbjct  278  VYSNGAVVLPHKEIKSSIVNPEIVM  302



>ref|XP_009143286.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Brassica 
rapa]
Length=361

 Score =   483 bits (1242),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 232/265 (88%), Positives = 248/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPFKEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSV+D+IEL+PTSI+KE FPKIAA   LYAMVLPGF
Sbjct  157  VEKFVEKPKLYVGNKINAGIYLLNPSVVDKIELRPTSIKKETFPKIAAAQVLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK   KL +G  IVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKCPAKLTTGPDIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRG RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGARIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVRDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL P IVM
Sbjct  337  IYSNGGVVLPHKEIKSNILMPGIVM  361



>emb|CDX74832.1| BnaA05g05780D [Brassica napus]
Length=361

 Score =   482 bits (1241),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 232/265 (88%), Positives = 247/265 (93%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPFKEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSV+D+IEL+PTSIEKE FPKIAA   LYAMVLPGF
Sbjct  157  VEKFVEKPKLYVGNKINAGIYLLNPSVVDKIELRPTSIEKETFPKIAAAQGLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRK    KL +G  IVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKNCPAKLTTGPDIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRG RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGARIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVRDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL P IVM
Sbjct  337  IYSNGGVVLPHKEIKSNILMPGIVM  361



>ref|XP_009791580.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009791581.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
Length=360

 Score =   482 bits (1241),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 233/265 (88%), Positives = 248/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L DDS EPFFVLNSDVI +YP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE TG+
Sbjct  96   LRDDSDEPFFVLNSDVICDYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEGTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE FVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP IAAE KL AMVLPGF
Sbjct  156  VETFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPSIAAEKKLRAMVLPGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+SLRK+SSP LA G HI+GNVL+DE+A I +GCLIGPDVAIG
Sbjct  216  WMDIGQPKDYITGLRLYLDSLRKRSSPDLAVGPHILGNVLIDESAVIGDGCLIGPDVAIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRCT+MRGVRIKKH CISSSI+GWHSTVG+WARVENMTILGEDVH+ DE
Sbjct  276  PGCVIESGVRLSRCTIMRGVRIKKHACISSSIVGWHSTVGRWARVENMTILGEDVHVGDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  336  VYSNGGVVLPHKEIKSSILKPEIVM  360



>ref|XP_006429173.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
 gb|ESR42413.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
Length=361

 Score =   482 bits (1240),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 232/265 (88%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP K+MIEFH+  GGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKQMIEFHRGRGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK FVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAAENKL+AMVLPGF
Sbjct  157  VEKFVEKPKNFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPEIAAENKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+ L+K SS KLA+G++I+GNVLV E AKI +GCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDFLQKNSSSKLATGSNIIGNVLVHEGAKIGDGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIE GVRLSRCTVMRGVRIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE
Sbjct  277  PGCVIEPGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHVADE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNG VVLPHKEIKSSI+NPEIVM
Sbjct  337  VYSNGAVVLPHKEIKSSIVNPEIVM  361



>ref|XP_006645004.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Oryza brachyantha]
Length=361

 Score =   482 bits (1240),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 227/265 (86%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE TG 
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIKFHKNHGGEATIMVTKVDEPSKYGVVVMEEVTGL  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+F+EKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAA+ KLYAMVLPGF
Sbjct  157  VEKFIEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIAADEKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+S+RK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSIRKRSADRLAAGAHIVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++E GVRLSRCTVMR VRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCIVEDGVRLSRCTVMRSVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y+NGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYTNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_010937548.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010937549.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010937550.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   481 bits (1239),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 229/265 (86%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHK+HGGEA+IMVTKVDEPSKYGVVVME+ TG+
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIKFHKAHGGEATIMVTKVDEPSKYGVVVMEDETGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPKIFVGNKINAGIYLLNPSVLD+I+L+PTSIEKEVFP+IAA+ KLYAMVLPGF
Sbjct  157  VDRFVEKPKIFVGNKINAGIYLLNPSVLDRIQLRPTSIEKEVFPRIAADQKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SLRKKS  KL+ G HIVGNVLV E+A I EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLRKKSPYKLSVGPHIVGNVLVHESAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVGQW+R+ENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWSRIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|NP_001044795.1| Os01g0847200 [Oryza sativa Japonica Group]
 sp|Q941T9.1|GMPP2_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
2 [Oryza sativa Japonica Group]
 dbj|BAB64272.1| putative GMPase [Oryza sativa Japonica Group]
 dbj|BAB89577.1| putative GMPase [Oryza sativa Japonica Group]
 dbj|BAF06709.1| Os01g0847200 [Oryza sativa Japonica Group]
 gb|EAZ41985.1| hypothetical protein OsJ_26535 [Oryza sativa Japonica Group]
 dbj|BAG88187.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   481 bits (1239),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 228/265 (86%), Positives = 252/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE TG 
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIKFHKSHGGEATIMVTKVDEPSKYGVVVMEEVTGM  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IA++ KL+A+VLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIASDAKLFALVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SLRK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLRKRSTNRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGV IKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVHIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y+NGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYTNGGVVLPHKEIKSSILKPEIVM  361



>gb|AHX74219.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=362

 Score =   481 bits (1237),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 225/265 (85%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP K+M++FH  HGGEASIMVTKVDEPSKYGVV+++E TGK
Sbjct  98   LIDGSGEPFFVLNSDVISEYPLKQMVDFHTKHGGEASIMVTKVDEPSKYGVVILDEETGK  157

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFPKIA E +LYAMVLPGF
Sbjct  158  VEKFVEKPKVFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPKIAQEKQLYAMVLPGF  217

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI+GLRLYL+SLR+ +S KLA+G +IVGNV+VD TA+I EGCLIGPDVAIG
Sbjct  218  WMDIGQPRDYISGLRLYLDSLRRNTSDKLATGVNIVGNVIVDSTAQIGEGCLIGPDVAIG  277

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIE+GVRLSRCT+MRGVRIKKH C+S SIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  278  PGCVIEAGVRLSRCTIMRGVRIKKHACVSGSIIGWHSTVGQWARVENMTILGEDVHVSDE  337

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y+NGGVVLPHKEIKSSIL PEIVM
Sbjct  338  VYTNGGVVLPHKEIKSSILKPEIVM  362



>gb|ABR15468.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=361

 Score =   480 bits (1236),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 225/265 (85%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP K+M++FH  HGGEASIMVTKVDEPSKYGVV+++E TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPLKQMVDFHTKHGGEASIMVTKVDEPSKYGVVILDEETGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFPKIA E +LYAMVLPGF
Sbjct  157  VEKFVEKPKVFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPKIAQEKQLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI+GLRLYL+SLR+ +S KLA+G +IVGNV+VD TA+I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYISGLRLYLDSLRRNTSDKLATGVNIVGNVIVDSTAQIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIE+GVRLSRCT+MRGVRIKKH C+S SIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVIEAGVRLSRCTIMRGVRIKKHACVSGSIIGWHSTVGQWARVENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y+NGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYTNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_006493574.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Citrus sinensis]
Length=361

 Score =   480 bits (1236),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 231/265 (87%), Positives = 250/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP K+MIEFH+  GGEASIMVT VDEPSKYGVVVMEE+TGK
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKQMIEFHRGRGGEASIMVTNVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK FVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IAAENKL+AMVLPGF
Sbjct  157  VEKFVEKPKNFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPEIAAENKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL+ L+K SS KLA+G++I+GNVLV E AKI +GCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLDFLQKNSSSKLATGSNIIGNVLVHEGAKIGDGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIE GVRLSRCTVMRGVRIKKH CISSSIIGWHSTVG+WARVENMTILGEDVH+ DE
Sbjct  277  PGCVIEPGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGRWARVENMTILGEDVHVADE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNG VVLPHKEIKSSI+NPEIVM
Sbjct  337  VYSNGAVVLPHKEIKSSIVNPEIVM  361



>tpg|DAA44592.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
Length=311

 Score =   478 bits (1230),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 224/265 (85%), Positives = 248/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SG+PFFVLNSDVISEYPF E+IEFH++HGGEA+IMVTKVDEPSKYGVVVMEE TGK
Sbjct  47   LADGSGDPFFVLNSDVISEYPFAELIEFHRAHGGEATIMVTKVDEPSKYGVVVMEEGTGK  106

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK FVGNKINAGIYLLNPSVL +IELKPTSIEKEVFP++AA+  L+AMVLPGF
Sbjct  107  VERFVEKPKAFVGNKINAGIYLLNPSVLGRIELKPTSIEKEVFPRVAADGALFAMVLPGF  166

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+  +LASGAH++GNVLV ETA I +GCLIGPDVA+G
Sbjct  167  WMDIGQPRDYITGLRLYLDSLRKKAPARLASGAHVLGNVLVHETAVIGDGCLIGPDVAVG  226

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMR  R+K+H C+SSSIIGWHSTVG+WARVENMTILGEDVH+CDE
Sbjct  227  PGCVVEAGVRLSRCTVMRAARVKQHACVSSSIIGWHSTVGKWARVENMTILGEDVHVCDE  286

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  287  IYSNGGVVLPHKEIKSSILKPEIVM  311



>gb|AFL69830.1| mannose-1-phosphate guanyltransferase 1 [Oryza sativa Indica 
Group]
Length=361

 Score =   479 bits (1234),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 227/265 (86%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE TG 
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIKFHKSHGGEATIMVTKVDEPSKYGVVVMEEVTGM  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IA++ KL+A+VLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIASDAKLFALVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SLRK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLRKRSTNRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGV IKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVHIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y+NGGVVLPHKEIKS IL PEIVM
Sbjct  337  VYTNGGVVLPHKEIKSGILKPEIVM  361



>gb|EPS66224.1| hypothetical protein M569_08552 [Genlisea aurea]
Length=361

 Score =   479 bits (1234),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 227/265 (86%), Positives = 245/265 (92%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D S EPFFVLNSDVISEYP K MIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG 
Sbjct  97   LLDSSNEPFFVLNSDVISEYPLKAMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGL  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNP VLD+IEL+PTSIEKEVFP IA E +LYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPQVLDRIELRPTSIEKEVFPAIAGERRLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI GLRLYL+SLRK++  KL SGAH++GNVLV +TA I EGCLIGPDVA+G
Sbjct  217  WMDIGQPRDYIAGLRLYLDSLRKRTPSKLVSGAHVLGNVLVHDTATIGEGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRG RIKKH C+SSSI+GWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGARIKKHACVSSSIVGWHSTVGQWARVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY+NGGVVLPHKEIKS+I+ PEIVM
Sbjct  337  IYTNGGVVLPHKEIKSNIVKPEIVM  361



>ref|NP_001142215.1| hypothetical protein [Zea mays]
 ref|XP_008668541.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668543.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668544.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF87905.1| unknown [Zea mays]
 gb|ACR38500.1| unknown [Zea mays]
 tpg|DAA44594.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44595.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44596.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44597.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44598.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
Length=361

 Score =   479 bits (1232),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 224/265 (85%), Positives = 248/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SG+PFFVLNSDVISEYPF E+IEFH++HGGEA+IMVTKVDEPSKYGVVVMEE TGK
Sbjct  97   LADGSGDPFFVLNSDVISEYPFAELIEFHRAHGGEATIMVTKVDEPSKYGVVVMEEGTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK FVGNKINAGIYLLNPSVL +IELKPTSIEKEVFP++AA+  L+AMVLPGF
Sbjct  157  VERFVEKPKAFVGNKINAGIYLLNPSVLGRIELKPTSIEKEVFPRVAADGALFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK+  +LASGAH++GNVLV ETA I +GCLIGPDVA+G
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKAPARLASGAHVLGNVLVHETAVIGDGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMR  R+K+H C+SSSIIGWHSTVG+WARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEAGVRLSRCTVMRAARVKQHACVSSSIIGWHSTVGKWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>emb|CDY20480.1| BnaC04g05640D [Brassica napus]
Length=360

 Score =   479 bits (1232),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 229/263 (87%), Positives = 246/263 (94%), Gaps = 0/263 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVL+SDVISEYPFKEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  97   LVDGSGEPFFVLSSDVISEYPFKEMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEETTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK++VGNKINAGIYLLNPSV+D+IEL+PTSIEKE FPKIAA    YAMVLPGF
Sbjct  157  VEKFVEKPKLYVGNKINAGIYLLNPSVVDKIELRPTSIEKETFPKIAAAQGFYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKK   KL +GA IVGNVLVDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKCPAKLTTGADIVGNVLVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC++ESGVRLSRCTVMRG RIKKH CISSSIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCIVESGVRLSRCTVMRGARIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVRDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEI  100
            IYSNGGVVLPHKEIKS+IL P I
Sbjct  337  IYSNGGVVLPHKEIKSNILMPGI  359



>gb|AFL69832.1| mannose-1-phosphate guanyltransferase 3 [Oryza sativa Indica 
Group]
Length=361

 Score =   478 bits (1230),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 226/265 (85%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHKSHGGEA+IMVTKVDEPSKYGVVVMEE TG 
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIKFHKSHGGEATIMVTKVDEPSKYGVVVMEEVTGM  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+IA++ KL+A+VLPGF
Sbjct  157  VKKFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRIASDAKLFALVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SLRK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLRKRSTNRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGV IKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVHIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y+NGGVVLPHKEIKS IL PEIVM
Sbjct  337  VYTNGGVVLPHKEIKSGILKPEIVM  361



>gb|AFL69833.1| mannose-1-phosphate guanyltransferase 4 [Oryza sativa Indica 
Group]
Length=361

 Score =   478 bits (1230),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 225/265 (85%), Positives = 251/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSD ISEYPF E+I+FHK+HGGEA+IMVTKVDEPSKYGVVVMEE+TG 
Sbjct  97   LVDGSGEPFFVLNSDAISEYPFAELIKFHKNHGGEATIMVTKVDEPSKYGVVVMEEATGM  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFP+I+A+ KL+AMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPRISADAKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQPRDYITGLRLYL+SLRK+S+ +LA+GAHIVGNVLV E+AKI EGCLIGPDVAIG
Sbjct  217  WMDVGQPRDYITGLRLYLDSLRKRSANRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMRGVRIKKH CIS+SIIGWHSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVEDGVRLSRCTVMRGVRIKKHACISNSIIGWHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y+NGGV+LPHKEIKSSIL   IVM
Sbjct  337  VYTNGGVILPHKEIKSSILKXXIVM  361



>gb|KHN13115.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   478 bits (1229),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 234/265 (88%), Positives = 254/265 (96%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KL+AMVLPGF
Sbjct  157  VDKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI+GLRLYL+SL+KKSS KLASG+  VGNV+VDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYISGLRLYLDSLKKKSSSKLASGSQFVGNVIVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+IE GVRL  CT+MRGVR+KKH C+SSSI+GWHSTVGQWARV+NMTILGEDVH+CDE
Sbjct  277  PGCIIEQGVRLKSCTIMRGVRVKKHACVSSSIVGWHSTVGQWARVDNMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSNILKPEIVM  361



>gb|ABR17757.1| unknown [Picea sitchensis]
Length=361

 Score =   477 bits (1228),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 224/265 (85%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYP K+M++FH  HGGEASIMVTKVDEPSKYGVV+++E TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPLKQMVDFHAKHGGEASIMVTKVDEPSKYGVVILDEETGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLN SVLD+IEL+PTSIEKEVFPKIA + KL+AMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNASVLDRIELRPTSIEKEVFPKIAQDKKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI+GLRLYL+SLR+ +S KLA+G +IVGNV+VD+TA+I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYISGLRLYLDSLRRNTSDKLANGLNIVGNVIVDDTAQIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCT+MRGVRIKKH C+S SIIGWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVEAGVRLSRCTIMRGVRIKKHACVSGSIIGWHSTVGQWARVENMTILGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_008801635.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X1 [Phoenix dactylifera]
 ref|XP_008801636.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X1 [Phoenix dactylifera]
Length=361

 Score =   476 bits (1225),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 229/265 (86%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHK+HGGEA+IMVTKV+EPSKYGVVVM+E TGK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFSELIKFHKAHGGEATIMVTKVNEPSKYGVVVMKEETGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPKIFVGNKINAGIYLLNPSV+D+IEL+PTSIEKEVFP+IAA+ KLYAMVLPGF
Sbjct  157  VDRFVEKPKIFVGNKINAGIYLLNPSVIDRIELRPTSIEKEVFPRIAADEKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KLA G HI GNVLV E+A I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPYKLAVGPHIAGNVLVHESAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVM GVRIKKH CISSSIIGWHSTVG+W+RVENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMHGVRIKKHACISSSIIGWHSTVGRWSRVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_006340997.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Solanum 
tuberosum]
Length=361

 Score =   475 bits (1223),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 224/265 (85%), Positives = 249/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L DDSGEPFFVLNSDVI +YP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LRDDSGEPFFVLNSDVICDYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEATGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK+FVGNKINAGIYLLNPSVLD+I+L+PTSIEKEVFP IAAE KL+AM+LPGF
Sbjct  157  VEKFVEKPKVFVGNKINAGIYLLNPSVLDRIQLRPTSIEKEVFPSIAAEKKLHAMILPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRK SSP LA G HI+GNVL+DE+A I +GCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKISSPDLAVGHHILGNVLIDESAVIGDGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRC++MRGVR+K H CISSSI+GWHSTVG+WARVENM+ILGEDVH+ DE
Sbjct  277  PGCVIESGVRLSRCSIMRGVRVKNHACISSSIVGWHSTVGRWARVENMSILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIK SIL P+I+M
Sbjct  337  VYSNGGVVLPHKEIKFSILEPQIIM  361



>ref|NP_001276259.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 gb|ACU21199.1| unknown [Glycine max]
Length=361

 Score =   474 bits (1221),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 233/265 (88%), Positives = 253/265 (95%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KL+AMVLPGF
Sbjct  157  VDKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI+GLRLYL+SL+KKSS KLASG+  VGNV+VDETAKI EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYISGLRLYLDSLKKKSSSKLASGSQFVGNVIVDETAKIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+IE GVRL  CT+MR VR+KKH C+SSSI+GWHSTVGQWARV+NMTILGEDVH+CDE
Sbjct  277  PGCIIEQGVRLKSCTIMRRVRVKKHACVSSSIVGWHSTVGQWARVDNMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSNILKPEIVM  361



>ref|XP_004246437.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Solanum 
lycopersicum]
Length=361

 Score =   473 bits (1218),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 225/265 (85%), Positives = 248/265 (94%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L DDSGEPFFVLNSDVI +YP KE+I FHKSHGGEASIMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LRDDSGEPFFVLNSDVICDYPLKELILFHKSHGGEASIMVTKVDEPSKYGVVVMEEATGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK FVGNKINAGIYLLNPSVLD+I+L+PTSIEKEVFP IAAE +L+AMVLPGF
Sbjct  157  VEKFVEKPKAFVGNKINAGIYLLNPSVLDRIQLRPTSIEKEVFPSIAAEKQLHAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRK SSP LA G HI+GNVL+DE+A I +GCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKISSPDLAVGHHILGNVLIDESAVIGDGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIESGVRLSRC++MRGVR+K H CISSSI+GWHSTVG+WARVENM+ILGEDVH+ DE
Sbjct  277  PGCVIESGVRLSRCSIMRGVRVKNHACISSSIVGWHSTVGRWARVENMSILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSILEPEIVM  361



>ref|XP_009388596.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009388598.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   472 bits (1214),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 226/265 (85%), Positives = 244/265 (92%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SGEPFFVLNSDVISEYPF E+I FHKS G EA+IMVTKV+EPSKYGVVVMEE TGK
Sbjct  97   LIDGSGEPFFVLNSDVISEYPFAELIRFHKSRGSEATIMVTKVEEPSKYGVVVMEEETGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKP+ FVGNKINAGIYLLNPSVLD+IELKPTSIEKEVFPKIAA+ KL+AMVLPGF
Sbjct  157  VDRFVEKPQTFVGNKINAGIYLLNPSVLDRIELKPTSIEKEVFPKIAADQKLHAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYLE++R++   KLA G HIVGNVLV E+A I EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYITGLRLYLEAIRRRKPYKLAVGPHIVGNVLVHESAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E GVRLSRCTVMR  RIKKH+CISSSIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVEDGVRLSRCTVMRAARIKKHSCISSSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL P IVM
Sbjct  337  VYSNGGVVLPHKEIKSSILKPAIVM  361



>ref|XP_011016812.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like, partial 
[Populus euphratica]
Length=349

 Score =   471 bits (1211),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 223/253 (88%), Positives = 244/253 (96%), Gaps = 0/253 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDD+G PFFVLNSDVISEYP K+MIEFHK HGGEASIMVTKVDEPSKYGVV++EE++GK
Sbjct  97   LIDDTGAPFFVLNSDVISEYPLKQMIEFHKGHGGEASIMVTKVDEPSKYGVVLLEETSGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAENKL+AMVLPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAENKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DY+TGLRLYL+SLRK SSPKLA+G +IVGNVLVDE+A I EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYVTGLRLYLDSLRKMSSPKLATGPNIVGNVLVDESAVIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+I+SGVRLSRCTVMRGVRIKKH CISSSIIGWHSTVG+WAR+ENMTILGEDVHI DE
Sbjct  277  PGCIIDSGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGRWARMENMTILGEDVHIGDE  336

Query  168  IYSNGGVVLPHKE  130
            +YSNGGVVLPHKE
Sbjct  337  VYSNGGVVLPHKE  349



>gb|ABK24420.1| unknown [Picea sitchensis]
 gb|ACN39840.1| unknown [Picea sitchensis]
Length=361

 Score =   470 bits (1209),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 219/265 (83%), Positives = 247/265 (93%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SGEPFFVLNSDVI EYP ++M+EFHK HGGEASIMVTKVDEPSKYGVV+++E TG+
Sbjct  97   LDDGSGEPFFVLNSDVICEYPLEQMLEFHKKHGGEASIMVTKVDEPSKYGVVILDEETGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPKIFVGNKINAGIYLLNPSVL+ IEL+PTSIEKEVFPKIA+E +LYAM+LPGF
Sbjct  157  VEKFVEKPKIFVGNKINAGIYLLNPSVLNMIELRPTSIEKEVFPKIASEKQLYAMILPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYI+GLRLYL+SL++    KL+ GAHI+GNV+VDETA+I EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYISGLRLYLDSLKRNLPKKLSFGAHIIGNVIVDETAQIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGC+IE+GVRLSRCTVMRGVRIKKH C+S SIIGWHSTVGQWARVENMT+LGEDVH+CDE
Sbjct  277  PGCMIEAGVRLSRCTVMRGVRIKKHACVSGSIIGWHSTVGQWARVENMTVLGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSI  PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSITKPEIVM  361



>gb|ABR15469.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=361

 Score =   467 bits (1202),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 218/265 (82%), Positives = 244/265 (92%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D S EPFFVLNSDVI EYP K+M+EFHK HGGEASIMVTKVDEPSKYGVV+++E TG+
Sbjct  97   LDDGSAEPFFVLNSDVICEYPLKQMLEFHKKHGGEASIMVTKVDEPSKYGVVILDEETGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPKIFVGNKINAGIYLLNPSVL+ IEL+PTSIEKEVFPKIA + +LY+M+LPGF
Sbjct  157  VDRFVEKPKIFVGNKINAGIYLLNPSVLNMIELRPTSIEKEVFPKIATKKQLYSMILPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYI+GLRLYL+SLR+    KL+ GAHI+GNV+VDETA+I EGCLIGPDVAIG
Sbjct  217  WMDIGQPKDYISGLRLYLDSLRRNLPKKLSFGAHIIGNVIVDETAQIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIE+GVRLSRCTVMRGVRIKKH C+S SIIGWH TVGQWARVENMT+LGEDVH+CDE
Sbjct  277  PGCVIEAGVRLSRCTVMRGVRIKKHACVSGSIIGWHCTVGQWARVENMTVLGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSI  PEIVM
Sbjct  337  VYSNGGVVLPHKEIKSSITKPEIVM  361



>ref|NP_001242262.1| uncharacterized protein LOC100818016 [Glycine max]
 gb|ACU23379.1| unknown [Glycine max]
Length=361

 Score =   466 bits (1198),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 223/265 (84%), Positives = 242/265 (91%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHK+HGG A+IMVTKVDEPSKYGVVVMEE+TG+
Sbjct  97   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKTHGGAATIMVTKVDEPSKYGVVVMEETTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIAAE KLYAMVLPGF
Sbjct  157  VERFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIAAEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYI+GL LYL+SLRKKS  +LASG H VGNV+V ETA I EGCL+GPDVAIG
Sbjct  217  WMDIGQPKDYISGLTLYLDSLRKKSPSRLASGPHFVGNVIVHETATIGEGCLVGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRGVRIKKHTCIS+SIIGWHSTVGQWARVENMTILGEDVH+CDE
Sbjct  277  PGCVVESGVRLSRCTVMRGVRIKKHTCISNSIIGWHSTVGQWARVENMTILGEDVHVCDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGG     +  +     PEIVM
Sbjct  337  VYSNGGCSFAPQGDQVKHSKPEIVM  361



>ref|XP_009387284.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009387293.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   466 bits (1198),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 217/265 (82%), Positives = 247/265 (93%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FH +HGGEA+I+VT+V+EPSKYGVVVM+E TGK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFAELIQFHNAHGGEATILVTQVNEPSKYGVVVMDEETGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK FVGNKINAGIYLLNPSVLD+I+L+PTSIEK+VFP+IAA+ KL+AMVLPGF
Sbjct  157  VERFVEKPKAFVGNKINAGIYLLNPSVLDRIQLRPTSIEKQVFPQIAADQKLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYL++LRKKS  KLA+G+H+VGNVLV ETA + EG LIGPDV++G
Sbjct  217  WMDIGQPKDYITGLRLYLDALRKKSPSKLAAGSHVVGNVLVHETAVVGEGSLIGPDVSVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+E+GVRLSRCTVMRG RIKKH C+S SIIG HSTVGQWAR+ENMTILGEDVH+ DE
Sbjct  277  PGCVVEAGVRLSRCTVMRGTRIKKHACVSGSIIGTHSTVGQWARIENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKSSIL PEIVM
Sbjct  337  IYSNGGVVLPHKEIKSSILKPEIVM  361



>ref|XP_006846369.1| hypothetical protein AMTR_s00012p00262290 [Amborella trichopoda]
 gb|ERN08044.1| hypothetical protein AMTR_s00012p00262290 [Amborella trichopoda]
Length=361

 Score =   466 bits (1198),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 216/265 (82%), Positives = 244/265 (92%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID+SGEPFFVLNSDVISE+P K+M++FHK+HG EASIMVTKVDEPSKYGVVVM E TG+
Sbjct  97   LIDESGEPFFVLNSDVISEFPLKKMLDFHKAHGKEASIMVTKVDEPSKYGVVVMNEKTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPKIFVGNKINAGIYLLNPSVLD+I LKPTSIEK++FP+IA + +LYAMVLPGF
Sbjct  157  VERFVEKPKIFVGNKINAGIYLLNPSVLDRIPLKPTSIEKQIFPQIALDKELYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDY++GLRLYL SLR   SPKLA G HIVGNVL+DE A+I EGCLIGPDVA+G
Sbjct  217  WMDIGQPRDYLSGLRLYLNSLRNVGSPKLACGVHIVGNVLIDENAQIGEGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVMRG R+K+H C++ SI+GWHSTVGQWARVENMTILGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCTVMRGARVKRHACVTGSIVGWHSTVGQWARVENMTILGEDVHVGDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIK++I  PEIVM
Sbjct  337  VYSNGGVVLPHKEIKTNINKPEIVM  361



>ref|XP_008801637.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X2 [Phoenix dactylifera]
Length=358

 Score =   465 bits (1197),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 226/265 (85%), Positives = 246/265 (93%), Gaps = 3/265 (1%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYPF E+I+FHK+HGGEA+IMV   +EPSKYGVVVM+E TGK
Sbjct  97   LVDGSGEPFFVLNSDVISEYPFSELIKFHKAHGGEATIMV---NEPSKYGVVVMKEETGK  153

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPKIFVGNKINAGIYLLNPSV+D+IEL+PTSIEKEVFP+IAA+ KLYAMVLPGF
Sbjct  154  VDRFVEKPKIFVGNKINAGIYLLNPSVIDRIELRPTSIEKEVFPRIAADEKLYAMVLPGF  213

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KLA G HI GNVLV E+A I EGCLIGPDVAIG
Sbjct  214  WMDIGQPRDYITGLRLYLDSLRKKSPYKLAVGPHIAGNVLVHESAVIGEGCLIGPDVAIG  273

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRCTVM GVRIKKH CISSSIIGWHSTVG+W+RVENMTILGEDVH+ DE
Sbjct  274  PGCVVESGVRLSRCTVMHGVRIKKHACISSSIIGWHSTVGRWSRVENMTILGEDVHVGDE  333

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIKSSIL PEIVM
Sbjct  334  VYSNGGVVLPHKEIKSSILKPEIVM  358



>ref|NP_191118.1| probable mannose-1-phosphate guanylyltransferase 2 [Arabidopsis 
thaliana]
 sp|Q9M2S0.1|GMPP2_ARATH RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
2 [Arabidopsis thaliana]
 emb|CAB75917.1| mannose-1-phosphate guanylyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AAY78774.1| putative GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AEE79405.1| probable mannose-1-phosphate guanylyltransferase 2 [Arabidopsis 
thaliana]
Length=364

 Score =   462 bits (1190),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 218/265 (82%), Positives = 247/265 (93%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SG+PFFVLNSDVIS+YP +EMI FH +HGGEASIMVTKVDEPSKYGVVVMEE+TG+
Sbjct  100  LVDGSGQPFFVLNSDVISDYPLEEMIAFHNAHGGEASIMVTKVDEPSKYGVVVMEEATGR  159

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKE+FP+IA   KLYAM+LPGF
Sbjct  160  VERFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEIFPQIAEAEKLYAMLLPGF  219

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KLA+G HI+GNVLVDETA+I EGCLIGP+VAIG
Sbjct  220  WMDIGQPRDYITGLRLYLDSLRKKSPSKLATGPHILGNVLVDETAEIGEGCLIGPNVAIG  279

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLS CTVMRGV +K++ CISSSIIGWHSTVGQWARVENM+ILG++V++CDE
Sbjct  280  PGCVVESGVRLSHCTVMRGVHVKRYACISSSIIGWHSTVGQWARVENMSILGKNVYVCDE  339

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY NGGVVL +KEIKS IL P+IVM
Sbjct  340  IYCNGGVVLHNKEIKSDILKPDIVM  364



>ref|XP_010427339.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
 ref|XP_010427340.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
Length=356

 Score =   451 bits (1159),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 214/265 (81%), Positives = 243/265 (92%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SG+PFFVLNSDVISEYP +E I FH +HGGEASIMVTKVDEPSKYGV+VMEE+TGK
Sbjct  92   LVDGSGQPFFVLNSDVISEYPLEEFIAFHNAHGGEASIMVTKVDEPSKYGVLVMEEATGK  151

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK++VGNKINAGIYLLNPSVLDQIEL+PTSIEKE+FP+IA   KLYAMVLPGF
Sbjct  152  VERFVEKPKLYVGNKINAGIYLLNPSVLDQIELRPTSIEKEIFPQIAEAEKLYAMVLPGF  211

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI GLRLYL+SLRKK+  KLA+G HIVGNVLVDETA+I +GCLIGPDVAIG
Sbjct  212  WMDIGQPRDYIIGLRLYLDSLRKKTPSKLANGPHIVGNVLVDETAEIGDGCLIGPDVAIG  271

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
              CVIESGVRLSRCTVMRG  +K+++C+SSSIIGWHSTVGQWARVENM+ILG++V++ DE
Sbjct  272  RDCVIESGVRLSRCTVMRGAHVKRYSCVSSSIIGWHSTVGQWARVENMSILGKNVNLYDE  331

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY NGGVVL +KEIKS I+ P+IVM
Sbjct  332  IYCNGGVVLHNKEIKSDIMKPDIVM  356



>ref|XP_006846372.1| hypothetical protein AMTR_s00012p00262630 [Amborella trichopoda]
 gb|ERN08047.1| hypothetical protein AMTR_s00012p00262630 [Amborella trichopoda]
Length=361

 Score =   449 bits (1156),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 208/265 (78%), Positives = 244/265 (92%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISE+P KEMIEFHK+HG EASIMVTKVDEPSKYGVV+++E TG+
Sbjct  97   LIDDSGEPFFVLNSDVISEFPLKEMIEFHKAHGKEASIMVTKVDEPSKYGVVLLDEETGE  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+ FVEKP+IFVGNKINAGIYLLNPSVLD+I LKPTSIEK++FPKIA EN+LYAMVLPGF
Sbjct  157  VKEFVEKPQIFVGNKINAGIYLLNPSVLDRIPLKPTSIEKQIFPKIACENQLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDY+TGLRLYL  LR+ SSP LASG HI+GNV+++ET++I EGCLIGPDVA+G
Sbjct  217  WMDIGQPRDYLTGLRLYLNYLRRISSPLLASGPHIIGNVVMEETSQIGEGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCV+ESGVRLSRC+VM+G RIK+H  +S SI+GWHSTVG+WA +ENM++LGEDVH+ DE
Sbjct  277  PGCVVESGVRLSRCSVMQGARIKEHAVVSGSIVGWHSTVGEWAHIENMSVLGEDVHVRDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NGG+VLPHKEIK++I  PEIVM
Sbjct  337  VYCNGGLVLPHKEIKTNIDRPEIVM  361



>ref|XP_002990832.1| hypothetical protein SELMODRAFT_185648 [Selaginella moellendorffii]
 gb|EFJ08105.1| hypothetical protein SELMODRAFT_185648 [Selaginella moellendorffii]
Length=361

 Score =   449 bits (1155),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 205/265 (77%), Positives = 241/265 (91%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP K+MI FHKSHG EA+IMVTKV+EPSKYGVVVM+++TG 
Sbjct  97   LVDGSGEPFFVLNSDVISEYPLKQMIAFHKSHGKEATIMVTKVEEPSKYGVVVMDDATGA  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKP+IFVGNKINAGIYLL+P  +D+IEL+PTSIEKE+FP IAAE +L+AMVLPGF
Sbjct  157  VQRFVEKPQIFVGNKINAGIYLLSPQTVDRIELRPTSIEKEIFPAIAAEKQLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYLES+R+KS  KL+ GAH+VGNV++D +A+I  GCLIGPDVA+G
Sbjct  217  WMDIGQPKDYITGLRLYLESIRRKSPEKLSIGAHVVGNVMIDPSARIGSGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P CVIE GVRLSRCTVMRG +I+KH+C+S SIIGWHS +GQW R+ENMT+LGEDV + DE
Sbjct  277  PDCVIEEGVRLSRCTVMRGAQIRKHSCVSGSIIGWHSKLGQWTRIENMTVLGEDVQVKDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIK+SIL PEIVM
Sbjct  337  LYSNGGVVLPHKEIKTSILKPEIVM  361



>ref|XP_001782193.1| predicted protein [Physcomitrella patens]
 gb|EDQ53016.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   449 bits (1155),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 211/265 (80%), Positives = 239/265 (90%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SGE FFVLNSDVISEYP ++MI+FHK HGGEA+IMVTKVDEPSKYGVVVM+ES G 
Sbjct  97   LDDGSGESFFVLNSDVISEYPLRQMIDFHKKHGGEATIMVTKVDEPSKYGVVVMDESNGC  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKP+ FVGNKINAGIYLL+P  LD+IEL+PTSIEKEVFPKI+AE  L+AMVLPGF
Sbjct  157  VERFVEKPQQFVGNKINAGIYLLSPRTLDRIELRPTSIEKEVFPKISAEKSLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDY TGLRLYL+SLRKK+  KLASG+  +GNV+VDE+AKI EGCLIGPDV+IG
Sbjct  217  WMDIGQPRDYNTGLRLYLDSLRKKAPEKLASGSTFLGNVIVDESAKIGEGCLIGPDVSIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GC IE+GVRLSRCT+MRGVR+KKH CIS SIIGWH T+GQWAR+ENMT+LGEDV + DE
Sbjct  277  QGCTIEAGVRLSRCTIMRGVRVKKHACISGSIIGWHCTIGQWARIENMTVLGEDVRVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            I++NGGVVLPHKEIK+SIL PEIVM
Sbjct  337  IFTNGGVVLPHKEIKASILKPEIVM  361



>ref|XP_002974469.1| hypothetical protein SELMODRAFT_267755 [Selaginella moellendorffii]
 gb|EFJ24691.1| hypothetical protein SELMODRAFT_267755 [Selaginella moellendorffii]
Length=361

 Score =   448 bits (1152),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 204/265 (77%), Positives = 241/265 (91%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVISEYP K+MI FHKSHG EA+IMVTKV+EPSKYGVVVM+++TG 
Sbjct  97   LVDGSGEPFFVLNSDVISEYPLKQMIAFHKSHGKEATIMVTKVEEPSKYGVVVMDDATGA  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKP+IFVGNKINAGIYLL+P  +D+IEL+PTS+EKE+FP IAAE +L+AMVLPGF
Sbjct  157  VQRFVEKPQIFVGNKINAGIYLLSPQTVDRIELRPTSMEKEIFPAIAAEKQLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGLRLYLES+R+KS  KL+ GAH+VGNV++D +A+I  GCLIGPDVA+G
Sbjct  217  WMDIGQPKDYITGLRLYLESIRRKSPEKLSIGAHVVGNVMIDPSARIGSGCLIGPDVAVG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P CVIE GVRLSRCTVMRG +I+KH+C+S SIIGWHS +GQW R+ENMT+LGEDV + DE
Sbjct  277  PDCVIEEGVRLSRCTVMRGAQIRKHSCVSGSIIGWHSKLGQWTRIENMTVLGEDVQVKDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGVVLPHKEIK+SIL PEIVM
Sbjct  337  LYSNGGVVLPHKEIKTSILKPEIVM  361



>ref|XP_001769404.1| predicted protein [Physcomitrella patens]
 gb|EDQ65773.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   448 bits (1152),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 210/265 (79%), Positives = 238/265 (90%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SGE FFVLNSDVISEYP ++M+EFHK HGGEA+IMVTKVDEPSKYGVVVM+ES G 
Sbjct  97   LDDGSGEAFFVLNSDVISEYPLRQMVEFHKKHGGEATIMVTKVDEPSKYGVVVMDESNGC  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKP+ FVGNKINAGIYLL+P  L++IEL+PTSIEKEVFPKIAAE  L+AMVLPGF
Sbjct  157  VQRFVEKPQQFVGNKINAGIYLLSPKTLNRIELRPTSIEKEVFPKIAAEKNLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDY TGLRLYLESLRKK   +LASG+  +GNV+VDE+AKI +GCLIGPDV+IG
Sbjct  217  WMDIGQPRDYNTGLRLYLESLRKKDPERLASGSTFLGNVIVDESAKIGDGCLIGPDVSIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GC IE+GVRLSRCT+MRGVR+KKH CIS SIIGWH T+GQWAR+ENMT+LGEDV + DE
Sbjct  277  QGCTIEAGVRLSRCTIMRGVRVKKHACISGSIIGWHCTIGQWARIENMTVLGEDVRVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            I+SNGGVVLPHKEIK+SIL PEIVM
Sbjct  337  IFSNGGVVLPHKEIKTSILKPEIVM  361



>ref|XP_002966693.1| hypothetical protein SELMODRAFT_168373 [Selaginella moellendorffii]
 ref|XP_002978048.1| hypothetical protein SELMODRAFT_271290 [Selaginella moellendorffii]
 gb|EFJ20705.1| hypothetical protein SELMODRAFT_271290 [Selaginella moellendorffii]
 gb|EFJ32720.1| hypothetical protein SELMODRAFT_168373 [Selaginella moellendorffii]
Length=361

 Score =   447 bits (1151),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 210/265 (79%), Positives = 239/265 (90%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D SGEPFFVLNSDVI EYP ++MI FHK H GEASIMVT+VDEPSKYGVVV++E TG 
Sbjct  97   LLDGSGEPFFVLNSDVICEYPLEQMIAFHKQHKGEASIMVTQVDEPSKYGVVVLDEDTGL  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V RFVEKP+ FVGNKINAG+YLLNPSVLD+IEL+PTSIEKEVFP IA E +L+AMVLPGF
Sbjct  157  VHRFVEKPQTFVGNKINAGVYLLNPSVLDRIELRPTSIEKEVFPGIAQEKQLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITGL+LYLESLRKKS  KLASG+++V NV++DE+A I +GCL+GPDV+IG
Sbjct  217  WMDIGQPKDYITGLQLYLESLRKKSPEKLASGSNVVDNVIIDESASIGQGCLLGPDVSIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GCVIE GVRL  CTVMRGVRIKKH C+S SIIGWHSTVGQWARVENMT+LGEDVH+ DE
Sbjct  277  QGCVIEDGVRLKHCTVMRGVRIKKHACVSWSIIGWHSTVGQWARVENMTVLGEDVHVSDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIK++I+ PEIVM
Sbjct  337  IYSNGGVVLPHKEIKANIMKPEIVM  361



>gb|KJB76118.1| hypothetical protein B456_012G072800 [Gossypium raimondii]
Length=333

 Score =   446 bits (1148),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 213/246 (87%), Positives = 233/246 (95%), Gaps = 0/246 (0%)
 Frame = -2

Query  831  YPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGKVERFVEKPKIFVGNKINAG  652
            YPFKEMIEFHK+HGGEASI+VTKVDEPSK GVVVMEE+TGKV++FVEKPK+FVGNKINAG
Sbjct  88   YPFKEMIEFHKAHGGEASIVVTKVDEPSKCGVVVMEETTGKVDKFVEKPKLFVGNKINAG  147

Query  651  IYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGFWMDIGQPRDYITGLRLYLE  472
            IYLLNPSVLD+IEL+PTSIEK +FPKIAAE KLYA+VLPGFWMDIGQP+DYI GLRLYL+
Sbjct  148  IYLLNPSVLDRIELRPTSIEKAIFPKIAAEKKLYAIVLPGFWMDIGQPKDYIAGLRLYLD  207

Query  471  SLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRG  292
            S RKKSS KLASG HIVGNVLV E+AKI EGCLIGPDV +GPGCV+E+GVRLSRCTVMRG
Sbjct  208  SPRKKSSTKLASGHHIVGNVLVHESAKIGEGCLIGPDVVVGPGCVVEAGVRLSRCTVMRG  267

Query  291  VRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSIL  112
            VRIKKH CISSSIIGWHSTVGQWARVENMT+LGEDVH+ DEIYS+GGV+LPHKEIKSSIL
Sbjct  268  VRIKKHACISSSIIGWHSTVGQWARVENMTVLGEDVHVWDEIYSSGGVILPHKEIKSSIL  327

Query  111  NPEIVM  94
             PEIVM
Sbjct  328  KPEIVM  333



>ref|XP_010412788.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
Length=358

 Score =   442 bits (1136),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 213/265 (80%), Positives = 238/265 (90%), Gaps = 6/265 (2%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D S +PFFVLNSDVISEYP +E I FH +HGGEASIMVTKVDEPSKYGVVVMEE+TGK
Sbjct  100  LVDGSDQPFFVLNSDVISEYPLEEFIAFHNAHGGEASIMVTKVDEPSKYGVVVMEEATGK  159

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK++VGNKINAGIYLLNPSVLDQIEL+PTSIEKE+FP+IA   KLYAMVLPGF
Sbjct  160  VERFVEKPKLYVGNKINAGIYLLNPSVLDQIELRPTSIEKEIFPQIAEAEKLYAMVLPGF  219

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI GLRLYL+SLRKKS  KLA+G HIVGNVLVDETA+I EGCLIGPD    
Sbjct  220  WMDIGQPRDYIIGLRLYLDSLRKKSPSKLANGPHIVGNVLVDETAEIGEGCLIGPD----  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
              CVIESGVRLSRCTVMRG  +K+++C+SSSIIGWHSTVGQWARVENM+ILG++VH+ DE
Sbjct  276  --CVIESGVRLSRCTVMRGAHVKRYSCVSSSIIGWHSTVGQWARVENMSILGKNVHLYDE  333

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY NGGVVL +KEIKS I+ P+IVM
Sbjct  334  IYCNGGVVLHNKEIKSDIMKPDIVM  358



>gb|AES92771.2| mannose-1-phosphate guanyltransferase [Medicago truncatula]
Length=304

 Score =   435 bits (1118),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 211/265 (80%), Positives = 229/265 (86%), Gaps = 17/265 (6%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVI EYP K+MIEFHKSHGGEASIMVTKVDEPSKYGV V+EE+ G+
Sbjct  57   LIDDSGEPFFVLNSDVICEYPLKQMIEFHKSHGGEASIMVTKVDEPSKYGVAVLEETAGQ  116

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK  +  K                   PTSIEKE+FPKIAAE KLYAM+LPGF
Sbjct  117  VEKFVEKPKTLLVTK-----------------SMPTSIEKEIFPKIAAEKKLYAMLLPGF  159

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLR +SS KLASG++IVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  160  WMDIGQPRDYITGLRLYLDSLRNRSSSKLASGSNIVGNVIVDETAKISEGCLIGPDVAIG  219

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P C++E GVRLSRCTVMRGVRIKKH CIS SIIGWHS+VGQWARVENMTILGEDVH+CDE
Sbjct  220  PDCIVEPGVRLSRCTVMRGVRIKKHACISHSIIGWHSSVGQWARVENMTILGEDVHVCDE  279

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  280  IYSNGGVVLPHKEIKSNILKPEIVM  304



>ref|XP_003610574.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
Length=350

 Score =   434 bits (1117),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 211/265 (80%), Positives = 229/265 (86%), Gaps = 17/265 (6%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVI EYP K+MIEFHKSHGGEASIMVTKVDEPSKYGV V+EE+ G+
Sbjct  103  LIDDSGEPFFVLNSDVICEYPLKQMIEFHKSHGGEASIMVTKVDEPSKYGVAVLEETAGQ  162

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE+FVEKPK  +  K                   PTSIEKE+FPKIAAE KLYAM+LPGF
Sbjct  163  VEKFVEKPKTLLVTKS-----------------MPTSIEKEIFPKIAAEKKLYAMLLPGF  205

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLR +SS KLASG++IVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  206  WMDIGQPRDYITGLRLYLDSLRNRSSSKLASGSNIVGNVIVDETAKISEGCLIGPDVAIG  265

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P C++E GVRLSRCTVMRGVRIKKH CIS SIIGWHS+VGQWARVENMTILGEDVH+CDE
Sbjct  266  PDCIVEPGVRLSRCTVMRGVRIKKHACISHSIIGWHSSVGQWARVENMTILGEDVHVCDE  325

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IYSNGGVVLPHKEIKS+IL PEIVM
Sbjct  326  IYSNGGVVLPHKEIKSNILKPEIVM  350



>gb|ABK24789.1| unknown [Picea sitchensis]
Length=361

 Score =   427 bits (1097),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 198/265 (75%), Positives = 237/265 (89%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID SG PFFVLNSDVISEYP  +MIEFH  HGGEASIMVTKV++PSKYGVVV+++ TG+
Sbjct  97   LIDGSGRPFFVLNSDVISEYPLNQMIEFHAKHGGEASIMVTKVEDPSKYGVVVLDDDTGQ  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKP++FVGNKINAGIYLLNP+VLD+IE++PTSIEKEVFP+IA E +L+AMVLPGF
Sbjct  157  VERFVEKPEMFVGNKINAGIYLLNPTVLDRIEVRPTSIEKEVFPEIAREKQLFAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+DYI+GL LYL+SL +  S KLA G++IVGNV+++E+A+I E CLIGPDVAIG
Sbjct  217  WMDVGQPKDYISGLSLYLDSLSRSCSDKLAKGSNIVGNVIIEESAEIGEDCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GCVIE GVRLS+CT+MRG RI+KH  +  SIIGW S+VG+W R+EN+TILGEDVH+ DE
Sbjct  277  AGCVIEEGVRLSQCTIMRGARIQKHARVCGSIIGWMSSVGKWGRLENLTILGEDVHVWDE  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +YSNGGV+LPHKEIKSSILNP IVM
Sbjct  337  VYSNGGVILPHKEIKSSILNPSIVM  361



>ref|XP_002310933.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEE88300.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=375

 Score =   424 bits (1090),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 223/273 (82%), Positives = 240/273 (88%), Gaps = 12/273 (4%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVI EYP K MIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTGK
Sbjct  97   LIDDSGEPFFVLNSDVICEYPLKLMIEFHKAHGGEASIMVTKVDEPSKYGVVVMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK FVGNKINAGIYLLNPSV+D+IEL+PTSIEKEVFPKIAAE KLYAM LPGF
Sbjct  157  VERFVEKPKAFVGNKINAGIYLLNPSVVDRIELRPTSIEKEVFPKIAAEKKLYAMALPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGLRLYL+SLRKKS  KLA+G HI+GNVLVDETA+I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLRLYLDSLRKKSPSKLATGPHIMGNVLVDETAEIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVH----  181
            PGCV+ESGVRLSRC+VM GV IK+H CISSSIIGW STVGQ A VE  T+LGE VH    
Sbjct  277  PGCVVESGVRLSRCSVMSGVTIKEHACISSSIIGWSSTVGQGACVEK-TVLGEAVHVKKT  335

Query  180  -------ICDEIYSNGGVVLPHKEIKSSILNPE  103
                   +CD++YSNGGVVLP +EI+SS L PE
Sbjct  336  SLGEVVYVCDDVYSNGGVVLPGREIESSNLKPE  368



>gb|ACU20879.1| unknown [Glycine max]
Length=262

 Score =   414 bits (1063),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 195/223 (87%), Positives = 211/223 (95%), Gaps = 0/223 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LIDDSGEPFFVLNSDVISEYP KEMIEFHK+HGGEASIMVTKVDEPSKYGVVVMEESTG+
Sbjct  38   LIDDSGEPFFVLNSDVISEYPLKEMIEFHKNHGGEASIMVTKVDEPSKYGVVVMEESTGQ  97

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKPK+FVGNKINAGIYLLNPSVLD+IEL+PTSIEKEVFPKIA+E KLYAMVLPGF
Sbjct  98   VDKFVEKPKLFVGNKINAGIYLLNPSVLDRIELRPTSIEKEVFPKIASEKKLYAMVLPGF  157

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI G+RLYL+SLR+KSS KLASG+ IVGNV+VDETAKI EGCLIGPDVAIG
Sbjct  158  WMDIGQPRDYIAGMRLYLDSLRRKSSSKLASGSQIVGNVIVDETAKIGEGCLIGPDVAIG  217

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWA  220
            PGCVIE GVRL  CT+MRGVR+KKH C+SSSI GWHSTVGQW 
Sbjct  218  PGCVIEQGVRLKSCTIMRGVRVKKHACVSSSIAGWHSTVGQWG  260



>ref|XP_011033044.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
Length=375

 Score =   412 bits (1060),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 217/273 (79%), Positives = 236/273 (86%), Gaps = 12/273 (4%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L DDSGEPFFVLNSDVI EYP K MIEFH++HGGEASIMVTKVDEPSKYGVV+MEESTGK
Sbjct  97   LTDDSGEPFFVLNSDVICEYPLKLMIEFHRAHGGEASIMVTKVDEPSKYGVVIMEESTGK  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK FVGNKINAGIYLLNPSV+D+IEL+PTSIEKEVFPKIAAE+KLYAM LPGF
Sbjct  157  VERFVEKPKAFVGNKINAGIYLLNPSVVDRIELRPTSIEKEVFPKIAAESKLYAMALPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYITGL LYL+SLRKKS  +LA+G HIVGNVLVDETA+I EGCLIGPDVAIG
Sbjct  217  WMDIGQPRDYITGLILYLDSLRKKSPSQLATGPHIVGNVLVDETAEIGEGCLIGPDVAIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHI---  178
            PGCV+ESGVRL RC+VM GV IK+H CISSSIIGW STVGQ A VE  T+LGE VH+   
Sbjct  277  PGCVVESGVRLCRCSVMSGVTIKEHACISSSIIGWSSTVGQGACVEK-TVLGEAVHVKKT  335

Query  177  --------CDEIYSNGGVVLPHKEIKSSILNPE  103
                    CD++YSNGGVV P  EI+SS L PE
Sbjct  336  SLGEVIYLCDDVYSNGGVVYPGGEIESSNLKPE  368



>ref|XP_010438160.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Camelina sativa]
Length=358

 Score =   397 bits (1020),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 193/266 (73%), Positives = 228/266 (86%), Gaps = 6/266 (2%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D++G+PFFVLNSDVI EY   EMIEFHK++  EASIMVTKVD+PSKYGVVV EE+T +
Sbjct  98   LVDETGQPFFVLNSDVICEYLLLEMIEFHKTNNAEASIMVTKVDDPSKYGVVVTEEATAR  157

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE FVEKPK FVGNKINAGIYLLNPSVLD+IEL+ TSIEKE+FPKIA+E KLYAMVLPGF
Sbjct  158  VESFVEKPKHFVGNKINAGIYLLNPSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLPGF  217

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITG R+YL SLR+KSS +LA+G +I+GNVLVDE+A I EGCLIGPDV IG
Sbjct  218  WMDIGQPKDYITGQRMYLNSLREKSSQELATGDNIIGNVLVDESAVIGEGCLIGPDVVIG  277

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-  172
            PGCVI+SGVRL  CTVMRGV IK+H CIS+SI+GW STVG+WARV N+T+LG+DVH+ D 
Sbjct  278  PGCVIDSGVRLLGCTVMRGVWIKEHACISNSIVGWDSTVGRWARVVNITVLGKDVHVADA  337

Query  171  EIYSNGGVVLPHKEIKSSILNPEIVM  94
            E+Y++G V+     +K     PEIVM
Sbjct  338  EVYNSGAVIEDQASVK-----PEIVM  358



>ref|XP_006408596.1| hypothetical protein EUTSA_v10002042mg [Eutrema salsugineum]
 gb|ESQ50049.1| hypothetical protein EUTSA_v10002042mg [Eutrema salsugineum]
Length=326

 Score =   395 bits (1015),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 191/249 (77%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D+SG+PFFVLNSDVI EYP  EMIEFHK HG EASIMVTKVD+PS+YGVVVMEE+T +
Sbjct  78   LVDESGKPFFVLNSDVICEYPLLEMIEFHKIHGAEASIMVTKVDDPSEYGVVVMEETTSR  137

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE FVEKP  +VGNKINAGIYLLNPSVLD+IEL+ TSIEKE+FPKIA+E KLYAM+LPGF
Sbjct  138  VESFVEKPLHYVGNKINAGIYLLNPSVLDRIELRRTSIEKEIFPKIASEKKLYAMLLPGF  197

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITG RLYL+SLRKKS  +L +G HIVGNVLVDE+  I EGCLIGPDV IG
Sbjct  198  WMDIGQPKDYITGQRLYLDSLRKKSLQELVTGDHIVGNVLVDESVVIGEGCLIGPDVVIG  257

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-  172
            PGCVI SGVRL  CTVMRGVRIK+H CIS+SI+GW STVG+WARV N T+LG+DVH+ D 
Sbjct  258  PGCVIGSGVRLFGCTVMRGVRIKEHACISNSIVGWDSTVGRWARVFNRTVLGKDVHVADA  317

Query  171  EIYSNGGVV  145
            E+YS+G V+
Sbjct  318  EVYSSGTVI  326



>gb|KFK29636.1| hypothetical protein AALP_AA7G159400 [Arabis alpina]
Length=434

 Score =   398 bits (1022),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/266 (73%), Positives = 226/266 (85%), Gaps = 5/266 (2%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID+SGEPFFVLNSDVI EYP  EMIEFHK+ G EASIMVTKVD+PSKYGVVVMEE T +
Sbjct  173  LIDESGEPFFVLNSDVICEYPLLEMIEFHKASGAEASIMVTKVDDPSKYGVVVMEEDTSR  232

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE FVEKPK FVGNKINAGIYLLNPSVLD+IEL+ TSIEKE+FPKIA+E KLYAMVLPGF
Sbjct  233  VESFVEKPKHFVGNKINAGIYLLNPSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLPGF  292

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITG R+YL+SLRKK+  +L +G H VGNVL DETA I E CLIGPDV IG
Sbjct  293  WMDIGQPKDYITGQRMYLDSLRKKAPQELVTGDHTVGNVLADETAVIGEHCLIGPDVVIG  352

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-  172
            PGCVI+SGVRL  CT+MRG RIK + C+S+SI+GW STVG+WARV N+++LG+DVH+ D 
Sbjct  353  PGCVIDSGVRLFGCTIMRGARIKTNACVSNSIVGWDSTVGRWARVVNISVLGKDVHVADA  412

Query  171  EIYSNGGVVLPHKEIKSSILNPEIVM  94
            E+YSNG  ++   E + S+  PEIV+
Sbjct  413  EVYSNGATII---EDQMSV-KPEIVI  434



>ref|XP_010432971.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
isoform X1 [Camelina sativa]
Length=358

 Score =   394 bits (1011),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 193/266 (73%), Positives = 225/266 (85%), Gaps = 6/266 (2%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D+SG+PFFVLNSDVI EYP  EMIEFHK++  EASIMVTKVD+PSKYGVVVME +T +
Sbjct  98   LVDESGQPFFVLNSDVICEYPLLEMIEFHKTNNAEASIMVTKVDDPSKYGVVVMEAATAR  157

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE FVEKPK FVGNKINAGIYLLNPSVLD+IEL+ TSIEKE+FPKIAAE KL AMVLPGF
Sbjct  158  VESFVEKPKHFVGNKINAGIYLLNPSVLDRIELRRTSIEKEIFPKIAAEKKLCAMVLPGF  217

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITG  LYL SLR+K+S  L +G +I+GNVLVDE+A I EGCLIGPDV IG
Sbjct  218  WMDIGQPKDYITGQSLYLNSLREKASQVLVTGDNIIGNVLVDESAVIGEGCLIGPDVVIG  277

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-  172
            PGCVI+SGVRL  CTVMRGV IK+H CIS+SI+GW STVG+WARV N+T+LG+DVH+ D 
Sbjct  278  PGCVIDSGVRLLGCTVMRGVWIKEHACISNSIVGWDSTVGRWARVVNVTVLGKDVHVADA  337

Query  171  EIYSNGGVVLPHKEIKSSILNPEIVM  94
            E+Y++G V+     +K     PEIVM
Sbjct  338  EVYNSGSVIEEQASVK-----PEIVM  358



>ref|XP_010432972.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
isoform X2 [Camelina sativa]
Length=353

 Score =   392 bits (1008),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/266 (73%), Positives = 225/266 (85%), Gaps = 6/266 (2%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D+SG+PFFVLNSDVI EYP  EMIEFHK++  EASIMVTKVD+PSKYGVVVME +T +
Sbjct  93   LVDESGQPFFVLNSDVICEYPLLEMIEFHKTNNAEASIMVTKVDDPSKYGVVVMEAATAR  152

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE FVEKPK FVGNKINAGIYLLNPSVLD+IEL+ TSIEKE+FPKIAAE KL AMVLPGF
Sbjct  153  VESFVEKPKHFVGNKINAGIYLLNPSVLDRIELRRTSIEKEIFPKIAAEKKLCAMVLPGF  212

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITG  LYL SLR+K+S  L +G +I+GNVLVDE+A I EGCLIGPDV IG
Sbjct  213  WMDIGQPKDYITGQSLYLNSLREKASQVLVTGDNIIGNVLVDESAVIGEGCLIGPDVVIG  272

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-  172
            PGCVI+SGVRL  CTVMRGV IK+H CIS+SI+GW STVG+WARV N+T+LG+DVH+ D 
Sbjct  273  PGCVIDSGVRLLGCTVMRGVWIKEHACISNSIVGWDSTVGRWARVVNVTVLGKDVHVADA  332

Query  171  EIYSNGGVVLPHKEIKSSILNPEIVM  94
            E+Y++G V+     +K     PEIVM
Sbjct  333  EVYNSGSVIEEQASVK-----PEIVM  353



>ref|XP_006284084.1| hypothetical protein CARUB_v10005214mg [Capsella rubella]
 gb|EOA16982.1| hypothetical protein CARUB_v10005214mg [Capsella rubella]
Length=332

 Score =   387 bits (994),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 186/250 (74%), Positives = 220/250 (88%), Gaps = 2/250 (1%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D+SG+PFFVLNSDVI EYP  EMIEFHK++  EASIMVTKVD+PSKYGVVV EE+T +
Sbjct  78   LLDESGQPFFVLNSDVICEYPLLEMIEFHKTNCAEASIMVTKVDDPSKYGVVVTEEATSR  137

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE FVEKP  FVGNKINAGIYLLNPSVL++IEL+ TSIEKE+FPKIA+E KLYAMVLPGF
Sbjct  138  VESFVEKPNHFVGNKINAGIYLLNPSVLERIELRRTSIEKEIFPKIASEKKLYAMVLPGF  197

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASG-AHIVGNVLVDETAKIEEGCLIGPDVAI  352
            WMDIGQP+DYITG R+YL SLR+KSS +L +G  +I+GNV+VDE+A I EGCLIGPDV I
Sbjct  198  WMDIGQPKDYITGQRMYLNSLREKSSQELVTGDDNIIGNVVVDESAAIGEGCLIGPDVVI  257

Query  351  GPGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD  172
            GPGCVI+SGVRL  CTVMRGVRIK+H CIS+SI+GW STVG+WARV N+T+LG DVH+ D
Sbjct  258  GPGCVIDSGVRLFGCTVMRGVRIKEHACISNSIVGWDSTVGKWARVVNVTVLGNDVHVAD  317

Query  171  -EIYSNGGVV  145
             E+Y++G V+
Sbjct  318  AEVYNSGAVI  327



>gb|KDP38962.1| hypothetical protein JCGZ_00719 [Jatropha curcas]
Length=355

 Score =   384 bits (986),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 183/259 (71%), Positives = 216/259 (83%), Gaps = 0/259 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID +GEPFFVLNSDVISEYP  EMIEFHK HGG+ASIMVT+V +PSKYGVVV+ E+TG 
Sbjct  97   LIDGTGEPFFVLNSDVISEYPLMEMIEFHKGHGGQASIMVTEVIDPSKYGVVVIREATGM  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+ F EKP  F  NKINAGIYLLNPS+LDQIELK TSIEKEVFP+IA + KL+AM LPGF
Sbjct  157  VQEFAEKPSTFSRNKINAGIYLLNPSILDQIELKATSIEKEVFPRIAEDKKLFAMSLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQPRDYI G RLYL+ L++ SS KLA+G  IVGNVL+DE+A IE+G LIGP+V IG
Sbjct  217  WMDIGQPRDYIAGQRLYLQFLQQNSSAKLATGPKIVGNVLIDESAVIEDGSLIGPNVVIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P C IESGV LS CT++RGV IKK   I SSI+GW+S+VG+ AR++NMTILGE   +CDE
Sbjct  277  PDCKIESGVSLSFCTLLRGVHIKKDAFICSSIMGWNSSVGRGARLQNMTILGEKAKVCDE  336

Query  168  IYSNGGVVLPHKEIKSSIL  112
            ++SNG V+ PH+E+KSSI 
Sbjct  337  VFSNGAVLQPHEEMKSSIF  355



>ref|XP_010438164.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Camelina sativa]
Length=346

 Score =   383 bits (983),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 180/249 (72%), Positives = 219/249 (88%), Gaps = 1/249 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID+SG+PFFVLNSDVI EYP  EMI+FHK++  E SIMVTKVD+PSKYGVVV EE+T +
Sbjct  98   LIDESGQPFFVLNSDVICEYPLLEMIKFHKTNNAEVSIMVTKVDDPSKYGVVVTEEATAR  157

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE FVEKPK FVGNKINAGIYLLNPSVLD+IEL+ TSIEKE+FPKIA+E KLYAMVLPGF
Sbjct  158  VESFVEKPKHFVGNKINAGIYLLNPSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLPGF  217

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITG R+YL SLR+KSS +LA+G +I+GNV+VDE+A I +GCLIGPDV +G
Sbjct  218  WMDIGQPKDYITGQRMYLNSLREKSSQELATGDNIIGNVVVDESAVIGKGCLIGPDVVVG  277

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICD-  172
             GCVI+SGVRL  CTVMRGVR+K+H C+S+SI+GW STVG+WARV N+T+LG+  H+ D 
Sbjct  278  AGCVIDSGVRLFGCTVMRGVRVKEHACVSNSIVGWDSTVGKWARVVNVTVLGKGGHVADA  337

Query  171  EIYSNGGVV  145
            E+Y++G ++
Sbjct  338  EVYNSGALI  346



>ref|XP_010941227.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941228.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941229.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941231.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
Length=361

 Score =   381 bits (979),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 174/265 (66%), Positives = 224/265 (85%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSD+  EYP KEM++FH +HGGEASIMVTKV EPSKYGVVV+++++G+
Sbjct  97   LLQEAEKPFFVLNSDITCEYPLKEMLDFHNAHGGEASIMVTKVAEPSKYGVVVLDDNSGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKP +FV NKINAGIYLLN SVL++I L P+S+E++VFP IA E +LYAM+  GF
Sbjct  157  VKKFVEKPTVFVDNKINAGIYLLNTSVLNRIPLSPSSLEQQVFPAIAKEGRLYAMIYDGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+DY+ GLRLYL+ LR+KSS  LA G +I+GNVL+DE+AKI EGCLIGPDV IG
Sbjct  217  WMDVGQPKDYLAGLRLYLDDLRRKSSLDLAIGHNIIGNVLIDESAKIGEGCLIGPDVVIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P CVIESGVRLS CT+M+GV++K+   +S SIIGWHSTVG+ A+V +M +LGEDVH+ + 
Sbjct  277  PNCVIESGVRLSSCTLMKGVQVKRSAHVSGSIIGWHSTVGESAQVSSMAVLGEDVHVGET  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            ++ NG VVLPHKEI+S  + PEIVM
Sbjct  337  VFLNGVVVLPHKEIRSHFVKPEIVM  361



>ref|NP_194786.1| Glucose-1-phosphate adenylyltransferase family protein [Arabidopsis 
thaliana]
 sp|Q8H1Q7.1|GMPP3_ARATH RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
3 [Arabidopsis thaliana]
 gb|AAN13073.1| putative GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AEE85782.1| Glucose-1-phosphate adenylyltransferase family protein [Arabidopsis 
thaliana]
Length=331

 Score =   380 bits (975),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 183/252 (73%), Positives = 217/252 (86%), Gaps = 0/252 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D+SG+PFFVLNSDVI EYP  EMIEFHK++  EASIMVT+VD+PSKYGVVV EE T +
Sbjct  78   LVDESGQPFFVLNSDVICEYPLLEMIEFHKTNRAEASIMVTEVDDPSKYGVVVTEEGTAR  137

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE FVEKPK FVGNKINAGIYLL+PSVLD+IEL+ TSIEKE+FPKIA+E KLYAMVLPGF
Sbjct  138  VESFVEKPKHFVGNKINAGIYLLSPSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLPGF  197

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITG R+YL SLR+K+  +LA+G +I+GNVLV E+A I EGCLIGPDV IG
Sbjct  198  WMDIGQPKDYITGQRMYLNSLREKTPQELATGDNIIGNVLVHESAVIGEGCLIGPDVVIG  257

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVI+SGVRL  CTVMRGV IK+H CIS+SI+GW STVG+WARV N+T+LG+DV++ D 
Sbjct  258  PGCVIDSGVRLFGCTVMRGVWIKEHACISNSIVGWDSTVGRWARVFNITVLGKDVNVADA  317

Query  168  IYSNGGVVLPHK  133
               N GVV+  +
Sbjct  318  EVYNSGVVIEEQ  329



>emb|CAB79775.1| GDP-mannose pyrophosphorylase like protein [Arabidopsis thaliana]
Length=351

 Score =   380 bits (976),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 183/252 (73%), Positives = 217/252 (86%), Gaps = 0/252 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D+SG+PFFVLNSDVI EYP  EMIEFHK++  EASIMVT+VD+PSKYGVVV EE T +
Sbjct  98   LVDESGQPFFVLNSDVICEYPLLEMIEFHKTNRAEASIMVTEVDDPSKYGVVVTEEGTAR  157

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE FVEKPK FVGNKINAGIYLL+PSVLD+IEL+ TSIEKE+FPKIA+E KLYAMVLPGF
Sbjct  158  VESFVEKPKHFVGNKINAGIYLLSPSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLPGF  217

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+DYITG R+YL SLR+K+  +LA+G +I+GNVLV E+A I EGCLIGPDV IG
Sbjct  218  WMDIGQPKDYITGQRMYLNSLREKTPQELATGDNIIGNVLVHESAVIGEGCLIGPDVVIG  277

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVI+SGVRL  CTVMRGV IK+H CIS+SI+GW STVG+WARV N+T+LG+DV++ D 
Sbjct  278  PGCVIDSGVRLFGCTVMRGVWIKEHACISNSIVGWDSTVGRWARVFNITVLGKDVNVADA  337

Query  168  IYSNGGVVLPHK  133
               N GVV+  +
Sbjct  338  EVYNSGVVIEEQ  349



>ref|XP_008799379.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Phoenix 
dactylifera]
Length=361

 Score =   379 bits (973),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 175/265 (66%), Positives = 223/265 (84%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSD+  EYP KEM+EFH +HGGEASIMVTKV EPSKYGVVV++E++G+
Sbjct  97   LLQEADKPFFVLNSDITCEYPLKEMLEFHNAHGGEASIMVTKVAEPSKYGVVVLDENSGR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V++FVEKP +FVGNKINAGIYLLN SVL++I L P+S+E++VFP IA E  LYAMV  GF
Sbjct  157  VKKFVEKPAVFVGNKINAGIYLLNTSVLNRIPLGPSSLEQQVFPSIAKEGCLYAMVYDGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+DY+TGL  YL+ LR+KS+ +LA G +I+GNVL+DE+AKI EGCLIGPDV IG
Sbjct  217  WMDVGQPKDYLTGLGFYLDYLRRKSALELAVGRNIIGNVLIDESAKIGEGCLIGPDVVIG  276

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P CVIE GVRLS CT+M+GV++K+   +S SIIGW+STVG+ A+V +M +LGEDVH+ + 
Sbjct  277  PNCVIEPGVRLSSCTLMKGVQVKRSAHVSGSIIGWYSTVGESAQVSSMAVLGEDVHVGET  336

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            ++ NG VVLPHKEIKS  + PEIVM
Sbjct  337  VFLNGAVVLPHKEIKSHFVKPEIVM  361



>ref|XP_010275250.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nelumbo 
nucifera]
Length=360

 Score =   377 bits (968),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 214/260 (82%), Gaps = 0/260 (0%)
 Frame = -2

Query  873  GEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGKVERFV  694
            GEPFFVLNSD+I EYP KEMIEFHK+H GEASI+VTKVDEPSKYGVVV++E  G+V  F+
Sbjct  101  GEPFFVLNSDIICEYPLKEMIEFHKAHRGEASILVTKVDEPSKYGVVVLDEENGRVNSFI  160

Query  693  EKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGFWMDIG  514
            EKP  FVGNKINAGIY LN SVLD+I+  PTSIE+E+FP IA E KL+AMV  GFWMDIG
Sbjct  161  EKPVTFVGNKINAGIYFLNTSVLDRIQPIPTSIERELFPAIANEGKLFAMVSTGFWMDIG  220

Query  513  QPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVI  334
            QP+DY+ GLRLYL+ L++ S   L+ G +I+GNVL+ ++AKI EGC+IGPDV +GP C+I
Sbjct  221  QPKDYLKGLRLYLDHLKRVSPEILSVGPYIIGNVLIADSAKIGEGCIIGPDVTVGPDCII  280

Query  333  ESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNG  154
            ESGVRLS CT+M+GVR+K    +S SIIGWHSTVGQ A+V NM +LGEDVH+ D ++ NG
Sbjct  281  ESGVRLSFCTLMKGVRVKSSAHVSGSIIGWHSTVGQSAQVSNMAVLGEDVHVSDTMFLNG  340

Query  153  GVVLPHKEIKSSILNPEIVM  94
             VVLPHKEIKS  + PEI+M
Sbjct  341  VVVLPHKEIKSHFVKPEIIM  360



>emb|CDX90770.1| BnaA03g24500D [Brassica napus]
Length=374

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 183/254 (72%), Positives = 211/254 (83%), Gaps = 6/254 (2%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEES---  718
            LID+SG+PFFVLNSDVI EYP  EMIEFHK+H  EASIMVTKVD+PSKYGVVVMEE    
Sbjct  98   LIDESGKPFFVLNSDVICEYPLLEMIEFHKNHAAEASIMVTKVDDPSKYGVVVMEEEGKE  157

Query  717  TGKVERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVL  538
              +VE FVEKPK FVG+KINAGIYLLNPSVLD IEL+ TSIEKE+FPKIA+E KLYAMVL
Sbjct  158  ESRVESFVEKPKHFVGDKINAGIYLLNPSVLDMIELRRTSIEKEIFPKIASEKKLYAMVL  217

Query  537  PGFWMDIGQPRDYITGLRLYLESLRKKSSPKL--ASGAHIVGNVLVDETAKIEEGCLIGP  364
            PGFWMDIGQP+DY+TG R+YL  LRK +  +L  +SG H++GNV+ DETA I E CLIGP
Sbjct  218  PGFWMDIGQPKDYLTGQRMYLRYLRKNAPEELLASSGDHVIGNVIADETAVIGERCLIGP  277

Query  363  DVAIGPGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDV  184
            DV IGPGCVIESGVRL  CTVMRG RIK+H C+S SI+GW STVG WARV N+T+LG+DV
Sbjct  278  DVVIGPGCVIESGVRLFGCTVMRGSRIKEHACVSDSIVGWDSTVGSWARVANITVLGKDV  337

Query  183  HICD-EIYSNGGVV  145
             + D E+YS+G  +
Sbjct  338  RVADAEVYSSGASI  351



>ref|XP_009134205.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
 ref|XP_009134206.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
Length=356

 Score =   372 bits (954),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/254 (72%), Positives = 210/254 (83%), Gaps = 6/254 (2%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEES---  718
            LID+SG+PFFVLNSDVI EYP  EMIEFHK+H  EASIMVTKVD+ SKYGVVVMEE    
Sbjct  98   LIDESGKPFFVLNSDVICEYPLLEMIEFHKNHAAEASIMVTKVDDSSKYGVVVMEEEGKE  157

Query  717  TGKVERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVL  538
              +VE FVEKPK FVG+KINAGIYLLNPSVLD IEL+ TSIEKE+FPKIA+E KLYAMVL
Sbjct  158  ESRVESFVEKPKHFVGDKINAGIYLLNPSVLDMIELRRTSIEKEIFPKIASEKKLYAMVL  217

Query  537  PGFWMDIGQPRDYITGLRLYLESLRKKSSPKL--ASGAHIVGNVLVDETAKIEEGCLIGP  364
            PGFWMDIGQP+DY+TG R+YL  LRK +  +L  +SG H++GNV+ DETA I E CLIGP
Sbjct  218  PGFWMDIGQPKDYLTGQRMYLRYLRKNAPEELLASSGDHVIGNVIADETAVIGERCLIGP  277

Query  363  DVAIGPGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDV  184
            DV IGPGCVIESGVRL  CTVMRG RIK+H C+S SI+GW STVG WARV N+T+LG+DV
Sbjct  278  DVVIGPGCVIESGVRLFGCTVMRGSRIKEHACVSDSIVGWDSTVGSWARVANITVLGKDV  337

Query  183  HICD-EIYSNGGVV  145
             + D E+YS+G  +
Sbjct  338  RVADAEVYSSGASI  351



>ref|XP_001695916.1| GDP-D-mannose pyrophosphorylase [Chlamydomonas reinhardtii]
 gb|EDP01253.1| GDP-D-mannose pyrophosphorylase [Chlamydomonas reinhardtii]
Length=360

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/265 (64%), Positives = 216/265 (82%), Gaps = 1/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D  G PFFVLNSDVI +YP K+M++FHK+ G EA+I+VTKVD+P+KYGVVVM+E  G+
Sbjct  97   LDDGKGTPFFVLNSDVICDYPLKDMLDFHKARGAEATILVTKVDDPTKYGVVVMDE-YGQ  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPK FVG+KINAGIY+ +PS+L++IEL+PTSIE+EVFP +AA+N+LYA  L G+
Sbjct  156  VQRFVEKPKEFVGDKINAGIYVCSPSILNRIELRPTSIEREVFPHVAADNRLYAYTLNGY  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+DY+ GL LYL+S+  + SP+LA G  I GNVLVD +AKI EGCLIGPDV+I 
Sbjct  216  WMDVGQPKDYLKGLHLYLDSMAIRQSPQLAKGTGINGNVLVDPSAKIGEGCLIGPDVSIS  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GCVI +GVRLS C VMRGVRIK H+ + S I+GW S VG W+R+EN  +LGEDV + DE
Sbjct  276  AGCVIGNGVRLSHCVVMRGVRIKDHSKVESCIVGWDSKVGAWSRLENHCVLGEDVTVKDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG +VLPHKEIK S+  P I++
Sbjct  336  LYLNGAIVLPHKEIKESVSTPAIIL  360



>ref|XP_009137936.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
 ref|XP_009137937.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
Length=354

 Score =   364 bits (934),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/241 (72%), Positives = 203/241 (84%), Gaps = 2/241 (1%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID+SG+PFFVLNSDVI EYP  EMI+FHK+HG EASIMVTKV++PSKYGVVVME+   +
Sbjct  98   LIDESGKPFFVLNSDVICEYPLLEMIQFHKNHGAEASIMVTKVEDPSKYGVVVMEKEEAR  157

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VE FVEKPK FVG+KINAGIYLLNPSVLD+IEL+ TSIEKE+FPKIA+E KLYAMVLPGF
Sbjct  158  VESFVEKPKHFVGDKINAGIYLLNPSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLPGF  217

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKL--ASGAHIVGNVLVDETAKIEEGCLIGPDVA  355
            WMDIGQP+DY+TG R+YL  LRK +  +L   SG  ++GNV+ DETA I E CLIGPDV 
Sbjct  218  WMDIGQPKDYLTGQRMYLNYLRKNAPGELLVTSGDGVIGNVMADETAVIGERCLIGPDVV  277

Query  354  IGPGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHIC  175
            IG GCVIE GVRL  CTVMRGVRIK+H C+S SI+GW STVG WARV ++T+LG+DV + 
Sbjct  278  IGAGCVIEPGVRLFGCTVMRGVRIKEHACVSDSIVGWDSTVGSWARVADVTVLGKDVQVA  337

Query  174  D  172
            D
Sbjct  338  D  338



>emb|CDY39219.1| BnaA03g50310D [Brassica napus]
Length=354

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 204/242 (84%), Gaps = 4/242 (2%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            LID+SG+PFFVLNSDVI EYP  EMIEFH +HG EASIMVTKVD+PSKYGVVVMEE   +
Sbjct  98   LIDESGKPFFVLNSDVICEYPLLEMIEFHTNHGAEASIMVTKVDDPSKYGVVVMEEE-AR  156

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            VERFVEKPK FVG+KINAGIYLLNPSVLD+IEL+ TSIEKE+FPKIA+E KLYAMVLPGF
Sbjct  157  VERFVEKPKHFVGDKINAGIYLLNPSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLPGF  216

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKL--ASGAHIV-GNVLVDETAKIEEGCLIGPDV  358
            WMDIGQP+DY+TG R+YL  LRK +  KL  +SG  +V GNV+ DETA I E CLIGPDV
Sbjct  217  WMDIGQPKDYLTGQRMYLNYLRKNAPGKLLVSSGDDVVIGNVMADETAVIGERCLIGPDV  276

Query  357  AIGPGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHI  178
             IG GCVIE GVRL  CTVMRGVRIK+H C+S SI+GW STVG WARV ++T+LG+DV +
Sbjct  277  VIGAGCVIEPGVRLFGCTVMRGVRIKEHACVSDSIVGWDSTVGSWARVADVTVLGKDVQV  336

Query  177  CD  172
             D
Sbjct  337  AD  338



>emb|CDX72252.1| BnaC07g42740D [Brassica napus]
Length=357

 Score =   362 bits (930),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 175/244 (72%), Positives = 205/244 (84%), Gaps = 5/244 (2%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEEST--  715
            LI +SG+PFFVLNSDVI EYP  EMIEFHK+HG EASIMVTKVD+PSKYGVVVMEE++  
Sbjct  98   LIHESGKPFFVLNSDVICEYPLLEMIEFHKNHGAEASIMVTKVDDPSKYGVVVMEEASEA  157

Query  714  GKVERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLP  535
             +VE FVEKPK FVG+KINAGIYLLNPSVLD+IEL+ TSIEKE+FPKIA+E KLYAMVLP
Sbjct  158  ARVESFVEKPKYFVGDKINAGIYLLNPSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLP  217

Query  534  GFWMDIGQPRDYITGLRLYLESLRKKSSPKLASGAH---IVGNVLVDETAKIEEGCLIGP  364
            GFWMDIGQP+DY+TG R+YL  LRK +  +L + +    ++GNV+ DETA I E CLIGP
Sbjct  218  GFWMDIGQPKDYLTGQRMYLNYLRKNAPGELLASSGDDVVIGNVMADETAVIGERCLIGP  277

Query  363  DVAIGPGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDV  184
            DV IG GCVIESGVRL  CTVMRGVRIK+H C+S SI+GW STVG WARV ++T+LG+DV
Sbjct  278  DVVIGAGCVIESGVRLFGCTVMRGVRIKEHACVSDSIVGWDSTVGSWARVADVTVLGKDV  337

Query  183  HICD  172
             + D
Sbjct  338  QVAD  341



>gb|AGC69739.1| mannose-1-phosphate guanylyltransferase [Dictyostelium lacteum]
Length=359

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/265 (62%), Positives = 216/265 (82%), Gaps = 1/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++D GEPFFVLNSD+I ++PF +++ +HK+HGGE +IMVTKV+EPSKYGVVV +E  G+
Sbjct  96   LLND-GEPFFVLNSDIICDFPFADLLAYHKNHGGEGTIMVTKVEEPSKYGVVVYKEENGQ  154

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + +FVEKP+++VGNKINAG+Y+ NPS+L++I+ KPTSIE E+FPK+AAE +LY M L GF
Sbjct  155  ILKFVEKPQVYVGNKINAGVYIFNPSILNRIQPKPTSIETEIFPKMAAEQQLYCMQLEGF  214

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+D++ G+ LYL SL+ K+S  LA+GA IVG VL+D T+ I+ GCLIGP+V IG
Sbjct  215  WMDVGQPKDFLLGMGLYLNSLKNKASETLATGAGIVGPVLIDPTSVIKPGCLIGPNVTIG  274

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P CVIE G RL   TV+ G  I K++ I SSIIGW+ST+G+W R+EN ++LGEDVH+ DE
Sbjct  275  PNCVIEEGSRLINTTVLEGTTIGKNSWIKSSIIGWNSTIGKWVRMENTSVLGEDVHVADE  334

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY NGG +LPHK I SSI  PEI+M
Sbjct  335  IYINGGKILPHKSISSSIPEPEIIM  359



>ref|XP_002952855.1| hypothetical protein VOLCADRAFT_81984 [Volvox carteri f. nagariensis]
 gb|EFJ46105.1| hypothetical protein VOLCADRAFT_81984 [Volvox carteri f. nagariensis]
Length=360

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/265 (65%), Positives = 211/265 (80%), Gaps = 1/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D  G PFFVLNSDVI +YP K+M++FHK+ G EA+I+VTKVD+P+KYGVVVM+E  G+
Sbjct  97   LDDGKGTPFFVLNSDVICDYPLKDMLDFHKARGAEATILVTKVDDPTKYGVVVMDE-YGQ  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V+RFVEKPK FVG+KINAGIY+ +PS+L +IEL+PTSIE+EVFP +AA+N LYA  L G+
Sbjct  156  VQRFVEKPKEFVGDKINAGIYVCSPSILKRIELRPTSIEREVFPHVAADNMLYAYTLNGY  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+DY+ GL LYL+S+  + S  LA G  I GNVLVD TAKI EGCLIGPDV+I 
Sbjct  216  WMDVGQPKDYLKGLHLYLDSMAIRQSSLLAHGPGISGNVLVDPTAKIGEGCLIGPDVSIS  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             GCVI +GVRLS C +MRGV+IK HT +  SIIGW S VG W+R+EN  +LGEDV   DE
Sbjct  276  AGCVIGNGVRLSHCVIMRGVQIKDHTKVDLSIIGWDSRVGAWSRLENHCVLGEDVQCKDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG VVLPHKEIK S+  P I++
Sbjct  336  LYLNGAVVLPHKEIKDSVPAPAIIL  360



>gb|EPZ31169.1| Mannose-1-phosphate guanyltransferase [Rozella allomycis CSF55]
Length=360

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 162/259 (63%), Positives = 213/259 (82%), Gaps = 0/259 (0%)
 Frame = -2

Query  870  EPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGKVERFVE  691
            EPFFVLNSDVI ++PF++MI+FHK HG E +++VTKV++PSKYGVVV ++ + ++ERFVE
Sbjct  102  EPFFVLNSDVICDFPFQDMIKFHKKHGKEGTLVVTKVEDPSKYGVVVCQQDSHEIERFVE  161

Query  690  KPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGFWMDIGQ  511
            KPKI+V NKINAG+YL NPSVLD+IEL+PTSIEKE+FPK+AA+ +L+AM L GFWMD+GQ
Sbjct  162  KPKIYVSNKINAGLYLFNPSVLDRIELRPTSIEKEIFPKMAADGQLHAMNLDGFWMDVGQ  221

Query  510  PRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIE  331
            P+DY+TG+ LYL SL K S   +A+G ++VGNVL+  +A+I + C IGP+V IGP  V+E
Sbjct  222  PKDYLTGIGLYLNSLSKSSPSDMATGDNVVGNVLIHPSARIGKFCKIGPNVVIGPNVVVE  281

Query  330  SGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDEIYSNGG  151
             GVRLSR  VM G RIK H  I+S+I+GW+ TVG+W R+E +TILG+DV +CDE+Y NGG
Sbjct  282  DGVRLSRVAVMEGARIKSHAWINSTIVGWNCTVGRWTRLEGVTILGDDVSVCDEVYVNGG  341

Query  150  VVLPHKEIKSSILNPEIVM  94
             VLPHK I S+I  P+I+M
Sbjct  342  CVLPHKSIASNISEPQIIM  360



>gb|EFA80657.1| mannose-1-phosphate guanylyltransferase [Polysphondylium pallidum 
PN500]
Length=359

 Score =   355 bits (911),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 214/265 (81%), Gaps = 1/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++D G+PFFVLNSD+I ++PF +++ FHK+HG E +IMVTKV+EPSKYGVVV +E  G 
Sbjct  96   LLND-GQPFFVLNSDIICDFPFGDLLAFHKAHGKEGTIMVTKVEEPSKYGVVVYKEDDGA  154

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            +++FVEKP+ +VGNKINAGIY+ NPS+LD+IE +PTSIEKE+FPK+A E  LY M L GF
Sbjct  155  IQKFVEKPQQYVGNKINAGIYIFNPSILDRIEPRPTSIEKEIFPKMAEEGDLYCMPLDGF  214

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+D+++G+ LYL SL++K+  +LA+G  I+G VLVDETA I+ GCLIGP+V IG
Sbjct  215  WMDVGQPKDFLSGMGLYLNSLKQKAPERLATGPGIIGPVLVDETATIKPGCLIGPNVTIG  274

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P CVIE G RL   TV+ G  + K++ I S+IIGW ST+G+W R+EN ++LG+DVHI DE
Sbjct  275  PNCVIEEGARLVNTTVLEGATVGKNSWIKSTIIGWESTIGKWVRMENTSVLGKDVHIADE  334

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NGG +LPHK I SSI  PEI+M
Sbjct  335  LYINGGKILPHKSITSSIPEPEIIM  359



>ref|XP_003287195.1| mannose-1-phosphate guanylyltransferase [Dictyostelium purpureum]
 gb|EGC36249.1| mannose-1-phosphate guanylyltransferase [Dictyostelium purpureum]
Length=359

 Score =   355 bits (911),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 216/265 (82%), Gaps = 1/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++D GEPFFVLNSD+I ++PF +++ FHK+HGGE +IMVTKV+EPSKYGVVV +E TG+
Sbjct  96   LLND-GEPFFVLNSDIICDFPFADLLAFHKNHGGEGTIMVTKVEEPSKYGVVVYKEETGE  154

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + +FVEKP+++VGNKINAG+Y+ NPS+LD+I+ KPTSIEKE+FP +AA+N+LY M L GF
Sbjct  155  ILKFVEKPQVYVGNKINAGVYIFNPSILDRIQPKPTSIEKEIFPAMAADNQLYCMQLEGF  214

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+D+++G+ LYL SL+ K    L++G  I+G VL+D ++ IE GCLIGP+V IG
Sbjct  215  WMDVGQPKDFLSGMGLYLNSLKSKQPELLSTGTGIIGPVLIDPSSVIEPGCLIGPNVTIG  274

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P CVI+ G RL   TV+ G  I K++ I S+IIGW+S++G+W R+EN ++LGEDVH+ DE
Sbjct  275  PNCVIQEGARLINTTVLEGTTIGKNSWIKSTIIGWNSSIGKWVRMENTSVLGEDVHVSDE  334

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NGG +LPHK I SSI  PEI+M
Sbjct  335  LYINGGKILPHKSITSSIPEPEIIM  359



>dbj|BAN16547.1| ADB2008858, partial [Acytostelium subglobosum]
 dbj|GAM21573.1| hypothetical protein SAMD00019534_047480, partial [Acytostelium 
subglobosum LB1]
Length=366

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 215/265 (81%), Gaps = 1/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++D G+PFFVLNSD+I ++PF +++ +HK+HG E +IMVTKV+EPSKYGVVV +E +G 
Sbjct  103  LLND-GQPFFVLNSDIICDFPFADLLAYHKAHGKEGTIMVTKVEEPSKYGVVVYKEDSGL  161

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            ++RFVEKP+ +VGNKINAGIY+ NPS+LD+I+ KPTSIEKE+FP +A E  LY M L GF
Sbjct  162  IQRFVEKPQQYVGNKINAGIYIFNPSILDRIQPKPTSIEKEIFPAMAEEGNLYCMQLEGF  221

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+D++ G+ LYL SL++K+  KLASG  IVG VL+D TA I+ GCLIGP+V IG
Sbjct  222  WMDVGQPKDFLLGMGLYLNSLKQKTPEKLASGPGIVGPVLLDATAVIKPGCLIGPNVTIG  281

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P CVIE GVRL   TV+ GV + +++ + SSIIGW ST+G+W R+EN ++LG+DVHI DE
Sbjct  282  PNCVIEEGVRLVNTTVLEGVTVGRNSWVKSSIIGWESTIGKWVRMENTSVLGKDVHISDE  341

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NGG +LPHK I SSI +PEI+M
Sbjct  342  LYINGGKILPHKSITSSIESPEIIM  366



>ref|XP_008319281.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Cynoglossus 
semilaevis]
 ref|XP_008319282.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Cynoglossus 
semilaevis]
Length=360

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 214/265 (81%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+D   EPFFVLNSDVI ++PFK++++FH++HG E +I+VT+V+EPSKYGVVV E  +G+
Sbjct  96   LLDVDNEPFFVLNSDVICDFPFKDLLQFHQNHGNEGTIVVTRVEEPSKYGVVVFEAESGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            ++RFVEKP++FV NKINAGIY+ NPS+L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IQRFVEKPQVFVSNKINAGIYIFNPSMLSRIQLRPTSIEKEIFPFMAEEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL+SLR+++  +L +G   +GNVLVD TA+I E C IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLQSLRQQAPERLHTGPGFLGNVLVDPTAQIGENCTIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
               V+E GVR+ RCTV++G R++ H+ + S I+GW STVGQW R+EN+T+LGEDV + DE
Sbjct  276  ADVVVEDGVRIKRCTVLKGSRVRSHSWLESCIVGWRSTVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+ +P I+M
Sbjct  336  LYLNGANVLPHKSINESVPDPRIIM  360



>ref|XP_004581526.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Ochotona 
princeps]
Length=360

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 212/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI E+PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETPDPFFVLNSDVICEFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKE+FP +A E +LYAM LPGF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLRPTSIEKEIFPVMAQEGQLYAMELPGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW S VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRSRVGQWVRMENVTVLGEDVIVSDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_006010396.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Latimeria 
chalumnae]
Length=360

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ D+ +PFFVLNSDVI ++PF +MI FHK HG + +I+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLTDNSDPFFVLNSDVICDFPFVDMIRFHKHHGKQGTIVVTKVEEPSKYGVVVYEAETGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ NP++LD+I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYIFNPTLLDRIQLRPTSIEKEIFPVMAQEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL+S+R+K+   L +G    GNVLVD +AKI E C IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLQSMRQKTPEGLHTGPGFFGNVLVDPSAKIGENCNIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG VIE GVR+ RCT+++G RI+ H+ + S +IGW+S VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVIEDGVRIKRCTILKGSRIRSHSWLESCVIGWNSAVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKSISDSVPEPRIIM  360



>ref|XP_003500392.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Cricetulus 
griseus]
 ref|XP_007633002.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Cricetulus 
griseus]
Length=360

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETEDPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+PSVL +I+LKPTSIEKEVFP +A E +LYAM LPGF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPSVLQRIQLKPTSIEKEVFPVMAQEGQLYAMELPGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKHPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCVRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVSDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_006892962.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Elephantulus 
edwardii]
Length=360

 Score =   353 bits (907),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ EPFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETEEPFFVLNSDVICDFPFQAMVQFHRHHGQEGSIVVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+LNP+VL +I+L+PTSIEKEVFP +A E +LYAM LPGF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILNPAVLQRIQLQPTSIEKEVFPVMAKEGQLYAMELPGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_004368238.1| GDPmannose pyrophosphorylase [Acanthamoeba castellanii str. Neff]
 gb|ELR25483.1| GDPmannose pyrophosphorylase [Acanthamoeba castellanii str. Neff]
Length=359

 Score =   353 bits (906),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 213/265 (80%), Gaps = 1/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            ++++ GEPFFVLNSD+  EYP  +++ FHK+HG E +IMVTKV+EPSKYGVVV++E  G+
Sbjct  96   ILEEDGEPFFVLNSDITCEYPLADLLAFHKNHGKEGTIMVTKVEEPSKYGVVVLKEG-GQ  154

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            +++FVEKPK++VGNKINAGIY+ NP++L++IEL+PTSIEKEVFP +A + +L AM LPGF
Sbjct  155  IDKFVEKPKLYVGNKINAGIYIFNPTILNRIELRPTSIEKEVFPDMATQGQLCAMELPGF  214

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP DY+ G+ LYL SL+ +   KL +G   VG V+VDETAKI E CLIGP+V IG
Sbjct  215  WMDVGQPPDYLMGMALYLNSLKTRDPKKLRTGEGFVGPVMVDETAKIGENCLIGPNVIIG  274

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PGCVIE GVRL   TV+ G  I+ +  IS SIIGW S+VG+W R+EN+++LG+DVHI DE
Sbjct  275  PGCVIEDGVRLRDTTVLEGAVIRSNAWISLSIIGWQSSVGRWVRMENVSVLGQDVHIGDE  334

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NGG +LPHK I +SI  P+I+M
Sbjct  335  LYVNGGRILPHKAISTSIPEPDIIM  359



>ref|XP_637125.1| mannose-1-phosphate guanylyltransferase [Dictyostelium discoideum 
AX4]
 sp|Q54K39.1|GMPPB_DICDI RecName: Full=Mannose-1-phosphate guanyltransferase beta; AltName: 
Full=GDP-mannose pyrophosphorylase B; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase beta [Dictyostelium 
discoideum]
 gb|EAL63618.1| mannose-1-phosphate guanylyltransferase [Dictyostelium discoideum 
AX4]
Length=359

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 215/265 (81%), Gaps = 1/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++D GEPFFVLNSD+I ++PF +++ FHKSHGGE +IMVTKV+EPSKYGVVV +E  G+
Sbjct  96   LLND-GEPFFVLNSDIICDFPFADLLAFHKSHGGEGTIMVTKVEEPSKYGVVVYKEENGQ  154

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + +FVEKP+++VGNKINAG+Y+ NP++LD+I+ KPTSIEKE+FP +AA+++LY M L GF
Sbjct  155  ILKFVEKPQVYVGNKINAGVYIFNPTILDRIQPKPTSIEKEIFPAMAADSQLYCMQLEGF  214

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+D+++G+ LYL SL+ K    LA+G  I+G VL+D ++ IE GCLIGP+V IG
Sbjct  215  WMDVGQPKDFLSGMGLYLNSLKSKQPELLATGNGIIGPVLIDPSSVIEPGCLIGPNVTIG  274

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P CVI+ G RL   TV+ G  I K++ I S+IIGW+S++G+W R+EN ++LGEDVH+ DE
Sbjct  275  PNCVIQEGTRLVNTTVLEGTTIGKNSWIKSTIIGWNSSIGKWVRMENTSVLGEDVHVSDE  334

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NGG +LPHK I SSI  PEI+M
Sbjct  335  LYINGGKILPHKSITSSIPEPEIIM  359



>ref|XP_003448400.1| PREDICTED: mannose-1-phosphate guanyltransferase beta-like [Oreochromis 
niloticus]
Length=360

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 214/265 (81%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++D GEPFFVLNSDVI ++PFK+++++H++HG E +I+VT+V+EPSKYGVVV E  +G+
Sbjct  96   LLNDDGEPFFVLNSDVICDFPFKDLLQYHRNHGKEGTIVVTRVEEPSKYGVVVYEADSGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ NPS+L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYIFNPSMLSRIQLRPTSIEKEIFPVMAGEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL+S+R+ +  +L +G   +GNVLVD TA+I E C IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLQSVRQHAPERLRTGPGFLGNVLVDPTAQIGENCTIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE
Sbjct  276  AGVVVEDGVRIKRCTVLKGSRVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKSINESVPEPRIIM  360



>ref|XP_010755204.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Larimichthys 
crocea]
 ref|XP_010755212.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Larimichthys 
crocea]
Length=360

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 212/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++   EPFFVLNSDVI ++PFK++++FH++HG E +I+VT+V+EPSKYGVVV E  TG+
Sbjct  96   LLNVDNEPFFVLNSDVICDFPFKDLLQFHRNHGKEGTIVVTRVEEPSKYGVVVFENDTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            ++RFVEKP++FV NKINAG+Y+ NPS+L +I+L+PTSIEKE+FP +A E  LYAM L GF
Sbjct  156  IQRFVEKPQVFVSNKINAGMYIFNPSMLSRIQLRPTSIEKEIFPVMAGEGHLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL+SLR+ +  +L +G   +GNVLVD TA+I E C IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLQSLRQHTPERLRTGPGFLGNVLVDPTAQIGENCTIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE
Sbjct  276  AGVVVEDGVRIKRCTVLKGARVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKSINESVPEPRIIM  360



>ref|XP_005347941.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Microtus 
ochrogaster]
Length=360

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+LKPTSIEKE+FP +A E +LYAM LPGF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLKPTSIEKEIFPVMAQEGQLYAMELPGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKHPERLYSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_003936705.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Saimiri boliviensis boliviensis]
Length=360

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEVFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R  RI+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_007446277.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X1 [Lipotes vexillifer]
 ref|XP_007446278.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Lipotes vexillifer]
Length=360

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I E C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGENCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+L P I+M
Sbjct  336  LYLNGASVLPHKSIGESVLEPRIIM  360



>sp|Q9Y5P6.2|GMPPB_HUMAN RecName: Full=Mannose-1-phosphate guanyltransferase beta; AltName: 
Full=GDP-mannose pyrophosphorylase B; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase beta [Homo sapiens]
 gb|EAW65013.1| GDP-mannose pyrophosphorylase B, isoform CRA_b [Homo sapiens]
 gb|EAW65015.1| GDP-mannose pyrophosphorylase B, isoform CRA_b [Homo sapiens]
Length=360

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEVFPIMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R  RI+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>emb|CBN80660.1| Mannose-1-phosphate guanyltransferase beta [Dicentrarchus labrax]
Length=360

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 212/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++   EPFFVLNSDVI ++PFK++++FH++HG E +IMVT+V+EPSKYGVVV E  +G+
Sbjct  96   LLNVDNEPFFVLNSDVICDFPFKDLLQFHRNHGKEGTIMVTRVEEPSKYGVVVFETDSGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAGIY+ NPS+L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGIYIFNPSMLSRIQLRPTSIEKEIFPVMAEEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL+S+R+ +  +L +G   +GNV+VD TA+I E C IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLQSVRQHAPERLRTGPGFLGNVVVDPTAQIGENCTIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTVM+G R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE
Sbjct  276  AGVVVEDGVRIKRCTVMKGARVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKSINESVPEPRIIM  360



>ref|XP_002758401.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Callithrix 
jacchus]
Length=360

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEVFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R  RI+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_006783131.1| PREDICTED: mannose-1-phosphate guanyltransferase beta-like [Neolamprologus 
brichardi]
Length=360

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 154/265 (58%), Positives = 213/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++D  EPFFVLNSDVI ++PFK++++FH++HG E +I+VT+V+EPSKYGVVV E  +G+
Sbjct  96   LLNDDSEPFFVLNSDVICDFPFKDLLQFHRNHGKEGTIVVTRVEEPSKYGVVVYEADSGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ NPS+L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYIFNPSMLSRIQLRPTSIEKEIFPVMAGEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL+S+R+ +  +L +G   +GNVLVD TA+I E C IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLQSVRQHAPERLRTGPGFLGNVLVDPTAQIGENCTIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE
Sbjct  276  AGVVVEDGVRIKRCTVLKGSRVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKSINESVPEPRIIM  360



>emb|CDX90771.1| BnaA03g24510D [Brassica napus]
Length=347

 Score =   351 bits (900),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/254 (69%), Positives = 202/254 (80%), Gaps = 15/254 (6%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEES---  718
            LID+SG+PFFVLNSDVI EYP  EMIEFHK+H  EASIM         YGVVVMEE    
Sbjct  98   LIDESGKPFFVLNSDVICEYPLLEMIEFHKNHAAEASIM---------YGVVVMEEEGKE  148

Query  717  TGKVERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVL  538
              +VE FVEKPK FVG+KINAGIYLLNPSVLD IEL+ TSIEKE+FPKIA+E KLYAMVL
Sbjct  149  ESRVESFVEKPKHFVGDKINAGIYLLNPSVLDMIELRRTSIEKEIFPKIASEKKLYAMVL  208

Query  537  PGFWMDIGQPRDYITGLRLYLESLRKKSSPKL--ASGAHIVGNVLVDETAKIEEGCLIGP  364
            PGFWMDIGQP+DY+TG R+YL  LRK +  +L  +SG H++GNV+ DETA I E CLIGP
Sbjct  209  PGFWMDIGQPKDYLTGQRMYLRYLRKNAPEELLASSGDHVIGNVIADETAVIGERCLIGP  268

Query  363  DVAIGPGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDV  184
            DV IGPGCVIESGVRL  CTVMRG RIK+H C+S SI+GW STVG WARV N+T+LG+DV
Sbjct  269  DVVIGPGCVIESGVRLFGCTVMRGSRIKEHACVSDSIVGWDSTVGSWARVANITVLGKDV  328

Query  183  HICD-EIYSNGGVV  145
             + D E+YS+G  +
Sbjct  329  RVADAEVYSSGASI  342



>ref|XP_004760688.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Mustela 
putorius furo]
 ref|XP_004820136.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Mustela 
putorius furo]
Length=360

 Score =   351 bits (901),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ EPFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETAEPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A I   C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLYSGPGIVGNVLVDPSAHIGRNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+RG RI+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRGARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_005547199.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X3 [Macaca fascicularis]
Length=305

 Score =   349 bits (895),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  41   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  100

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  101  IHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEVFPIMAKEGQLYAMELQGF  160

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  161  WMDIGQPKDFLTGMCLFLQSLRQKHPERLYSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  220

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R  RI+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  221  PGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  280

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  281  LYLNGASVLPHKSIGESVPEPRIIM  305



>ref|NP_068806.1| mannose-1-phosphate guanyltransferase beta isoform 2 [Homo sapiens]
 ref|XP_516466.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Pan troglodytes]
 ref|XP_002813792.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Pongo abelii]
 ref|XP_003257124.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Nomascus 
leucogenys]
 ref|XP_003818901.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Pan paniscus]
 ref|XP_004034205.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Gorilla 
gorilla gorilla]
 gb|AAD38516.1|AF135421_1 GDP-mannose pyrophosphorylase B [Homo sapiens]
 gb|AAH01141.1| GDP-mannose pyrophosphorylase B [Homo sapiens]
 gb|AAH08033.1| GDP-mannose pyrophosphorylase B [Homo sapiens]
 dbj|BAF84389.1| unnamed protein product [Homo sapiens]
 gb|ADZ15722.1| GDP-mannose pyrophosphorylase B [synthetic construct]
 gb|AIC51297.1| GMPPB, partial [synthetic construct]
Length=360

 Score =   351 bits (900),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEVFPIMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R  RI+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>gb|KGL86216.1| Mannose-1-phosphate guanyltransferase beta, partial [Charadrius 
vociferus]
Length=274

 Score =   347 bits (891),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 207/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ + GEPFFVLNSDVI E+PF  +  FH+ HGGE S++VT+V+EP+KYGVVV E  TG+
Sbjct  10   LLAEGGEPFFVLNSDVICEFPFAALAHFHRQHGGEGSLVVTRVEEPAKYGVVVCEADTGR  69

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ +P +L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  70   ICRFVEKPRVFVSNKINAGLYIFSPGILQRIQLRPTSIEKEIFPAMAQEGQLYAMELQGF  129

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL++LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG
Sbjct  130  WMDIGQPKDFLTGMCMYLQALRAQHPEKLHSGPGVVGNVLVDPSAKIGSNCVIGPNVTIG  189

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE
Sbjct  190  AGVVVEDGVRIKRCTVLKGARIRSHSWLESCIVGWSCSVGQWGRMENVTVLGEDVIVNDE  249

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  250  LYLNGANVLPHKSIAESVPEPRIIM  274



>ref|XP_006744594.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X1 [Leptonychotes weddellii]
 ref|XP_006744595.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Leptonychotes weddellii]
Length=360

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFRAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V RFVEKP++FV NKINAG+Y+LNP+VL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  VHRFVEKPQVFVSNKINAGMYILNPAVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|NP_001087522.1| mannose-1-phosphate guanyltransferase beta-A [Xenopus laevis]
 sp|Q68EY9.1|GMPBA_XENLA RecName: Full=Mannose-1-phosphate guanyltransferase beta-A; AltName: 
Full=GDP-mannose pyrophosphorylase B-A; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase beta-A [Xenopus 
laevis]
 gb|AAH80059.1| MGC84017 protein [Xenopus laevis]
Length=360

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 212/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ EPFFVLNSDVI ++PF++M+ FHK HG E +I+VTKV+EPSKYGVVV E  +G+
Sbjct  96   LLTENSEPFFVLNSDVICDFPFEDMVRFHKHHGKEGTIVVTKVEEPSKYGVVVYETESGQ  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            ++RFVEKP++FV NKIN+G+Y+ +P+VLD+I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IQRFVEKPQVFVSNKINSGLYIFSPAVLDRIQLRPTSIEKEIFPAMAQEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL+S+R+K    L +G   +GNVLVD TAKI + C IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLQSVRQKHPEWLHAGPGFIGNVLVDPTAKIGQNCSIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG  +E GVR+ RCTVM+G R+  H+ + SSI+GW S+VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVTVEDGVRIKRCTVMKGSRLHSHSWLESSIVGWSSSVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKCISESVPEPRIIM  360



>gb|KFM01180.1| Mannose-1-phosphate guanyltransferase beta, partial [Aptenodytes 
forsteri]
Length=274

 Score =   347 bits (891),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 207/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ + GEPFFVLNSDVI E+PF  +  FH+ HGGE S++VT+V+EP+KYGVVV E  TG+
Sbjct  10   LLAEGGEPFFVLNSDVICEFPFAALAHFHRQHGGEGSLVVTRVEEPAKYGVVVSEADTGR  69

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ +P +L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  70   ICRFVEKPRVFVSNKINAGLYIFSPGILQRIQLRPTSIEKEIFPAMAQEGQLYAMELQGF  129

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL++LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG
Sbjct  130  WMDIGQPKDFLTGMCMYLQALRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIG  189

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE
Sbjct  190  AGVVVEDGVRIKRCTVLKGARIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDE  249

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  250  LYLNGANVLPHKSIAESVPEPRIIM  274



>ref|XP_004399306.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Odobenus 
rosmarus divergens]
Length=360

 Score =   350 bits (899),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+LNP+VL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILNPAVLQRIQLQPTSIEKEIFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_003982282.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Felis 
catus]
 ref|XP_007088581.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Panthera 
tigris altaica]
Length=360

 Score =   350 bits (899),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+LNP+VL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILNPAVLRRIQLQPTSIEKEIFPVMATEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_003894464.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Papio anubis]
 ref|XP_007982438.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Chlorocebus sabaeus]
 ref|XP_010367947.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Rhinopithecus 
roxellana]
Length=360

 Score =   350 bits (899),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEVFPIMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPERLYSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R  RI+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_004353971.1| mannose-1-phosphate guanylyltransferase [Dictyostelium fasciculatum]
 gb|EGG14534.1| mannose-1-phosphate guanylyltransferase [Dictyostelium fasciculatum]
Length=359

 Score =   350 bits (898),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 213/265 (80%), Gaps = 1/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++D G+PFFVLNSD+I ++PF +++++HK+HG E +IMVTKV+EPSKYGVVV +E  G+
Sbjct  96   LLND-GQPFFVLNSDIICDFPFGDLLQYHKAHGKEGTIMVTKVEEPSKYGVVVYKEENGQ  154

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + +FVEKP+ +VGNKINAGIY+ NPS+LD+I+ KPTSIEKE+FP +A+E++LY M L GF
Sbjct  155  ILKFVEKPQQYVGNKINAGIYIFNPSILDRIQPKPTSIEKEIFPAMASEDQLYCMQLEGF  214

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMD+GQP+D++ G+ LYL SL+ K   KLASG  I+G V++D +A I+ GCLIGP+V I 
Sbjct  215  WMDVGQPKDFLMGMGLYLNSLKNKEPEKLASGPDIIGPVMIDPSAIIKPGCLIGPNVTIA  274

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P CVIE G RL   TV++G  I K++ I SSIIGW ST+G+W R+EN ++LG+DVHI DE
Sbjct  275  PNCVIEEGARLVNTTVLQGATIGKNSWIKSSIIGWESTIGKWVRMENTSVLGKDVHIADE  334

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NGG +LPHK I SSI  PEI+M
Sbjct  335  LYINGGKILPHKSISSSIPEPEIIM  359



>ref|XP_008702343.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Ursus 
maritimus]
Length=339

 Score =   349 bits (896),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  75   LLSETSDPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  134

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+LNP+VL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  135  IHRFVEKPQVFVSNKINAGMYILNPAVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGF  194

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  195  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  254

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  255  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  314

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  315  LYLNGASVLPHKSIGESVPEPRIIM  339



>ref|XP_004664300.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Jaculus jaculus]
Length=360

 Score =   350 bits (897),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAGIY+L+P+VL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGIYILSPAVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG VIE GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVIEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|NP_001252910.1| mannose-1-phosphate guanyltransferase beta [Macaca mulatta]
 ref|XP_005547198.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Macaca fascicularis]
Length=360

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEVFPIMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKHPERLYSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R  RI+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_004451926.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Dasypus 
novemcinctus]
Length=360

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E +I+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGTILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEVFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSAHIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+RG  I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRGAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_007575815.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Poecilia 
formosa]
 ref|XP_008406573.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Poecilia 
reticulata]
Length=360

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++   EPFFVLNSDVI ++PFK++++FH+SHG E +I+VT+V+EPSKYGVVV E  +G+
Sbjct  96   LLNVDNEPFFVLNSDVICDFPFKDLLQFHRSHGQEGTIVVTRVEEPSKYGVVVYESESGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            ++RFVEKP++FV NKINAG+Y+ NPS+L +I+L+PTSIEKE+FP +A E  LYAM L GF
Sbjct  156  IQRFVEKPQVFVSNKINAGMYIFNPSMLSRIQLRPTSIEKEIFPVMAREGHLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL SLR+ +  +L +G   +GNVLVD TA+I E C IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLHSLRQHAPERLRTGPGFLGNVLVDPTAQIGENCTIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE
Sbjct  276  AGVVVEDGVRIKRCTVLKGSRVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKSINESVPEPRIIM  360



>gb|KFQ90789.1| Mannose-1-phosphate guanyltransferase beta, partial [Nipponia 
nippon]
Length=291

 Score =   347 bits (890),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 207/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ + GEPFFVLNSDVI E+PF  +  FH+ HGGE S++VT+V+EP+KYGVVV E  TG+
Sbjct  27   LLAEGGEPFFVLNSDVICEFPFAALAHFHRQHGGEGSLVVTRVEEPAKYGVVVSEADTGR  86

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ +P +L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  87   ICRFVEKPRVFVSNKINAGLYIFSPGILQRIQLRPTSIEKEIFPAMAQEGQLYAMELQGF  146

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL++LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG
Sbjct  147  WMDIGQPKDFLTGMCMYLQALRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIG  206

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE
Sbjct  207  AGVVVEDGVRIKRCTVLKGARIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDE  266

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  267  LYLNGANVLPHKSIAESVPEPRIIM  291



>ref|XP_003639816.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Canis 
lupus familiaris]
Length=360

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+LNP+VL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILNPTVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_009879625.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Charadrius 
vociferus]
Length=306

 Score =   347 bits (891),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 207/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ + GEPFFVLNSDVI E+PF  +  FH+ HGGE S++VT+V+EP+KYGVVV E  TG+
Sbjct  42   LLAEGGEPFFVLNSDVICEFPFAALAHFHRQHGGEGSLVVTRVEEPAKYGVVVCEADTGR  101

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ +P +L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  102  ICRFVEKPRVFVSNKINAGLYIFSPGILQRIQLRPTSIEKEIFPAMAQEGQLYAMELQGF  161

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL++LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG
Sbjct  162  WMDIGQPKDFLTGMCMYLQALRAQHPEKLHSGPGVVGNVLVDPSAKIGSNCVIGPNVTIG  221

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE
Sbjct  222  AGVVVEDGVRIKRCTVLKGARIRSHSWLESCIVGWSCSVGQWGRMENVTVLGEDVIVNDE  281

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  282  LYLNGANVLPHKSIAESVPEPRIIM  306



>gb|EMP33974.1| Mannose-1-phosphate guanyltransferase beta [Chelonia mydas]
Length=308

 Score =   347 bits (891),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 209/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ +S EPFFVLNSDVI ++PF +M+ FHK HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  44   LLTESSEPFFVLNSDVICDFPFTDMVRFHKHHGKEGSIVVTKVEEPSKYGVVVCEAETGR  103

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ NPS+L +I+L+PTSIEKE+FP +A + +LYAM L GF
Sbjct  104  IHRFVEKPQVFVSNKINAGMYIFNPSLLHRIQLRPTSIEKEIFPVMAQDGELYAMELQGF  163

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ ++L+SLR +   +L +G   VGNVLVD +A+I E C IGP+V IG
Sbjct  164  WMDIGQPKDFLTGMCMFLQSLRVQHPERLHAGPGFVGNVLVDPSAQIGENCTIGPNVTIG  223

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCT+++G RI+ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE
Sbjct  224  AGVVVEDGVRIKRCTILKGSRIRSHSWLESCIVGWLSSVGQWVRMENVTVLGEDVIVNDE  283

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  284  LYLNGANVLPHKSIAESVPEPRIIM  308



>ref|XP_004347896.1| mannose-1-phosphate guanyltransferase beta [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE93259.1| mannose-1-phosphate guanyltransferase beta [Capsaspora owczarzaki 
ATCC 30864]
Length=359

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 210/265 (79%), Gaps = 1/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            ++++   PFFVLNSDVI ++PF+EM+ FHK+HG E +I+VTKVDEPSKYGVVV     G 
Sbjct  96   ILNEGDSPFFVLNSDVICDFPFEEMVAFHKAHGKEGTILVTKVDEPSKYGVVVARPD-GC  154

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            +++FVEKP++FV NKINAGIYL N ++L +IEL+PTSIEKE FP +AA+ +L+AM L G+
Sbjct  155  IQKFVEKPQVFVSNKINAGIYLFNTAILKRIELRPTSIEKETFPAMAADQELFAMNLEGY  214

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++ G  LYLES+R K+   LA G + VGNVLVD +AKI  GC IGP+V IG
Sbjct  215  WMDIGQPKDFLAGSALYLESMRAKNPSMLAKGDNFVGNVLVDPSAKIGTGCKIGPNVVIG  274

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            P  +IE GVRL++ T++ G RIK H  ++SSIIGW ST+GQW R+EN+++LGEDV + DE
Sbjct  275  PNVIIEDGVRLAKATILNGSRIKSHAWLTSSIIGWRSTIGQWVRMENISVLGEDVMVKDE  334

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            IY NGG++LPHKEI +SI  P IVM
Sbjct  335  IYINGGMILPHKEIGTSIPEPSIVM  359



>gb|EPQ07262.1| Mannose-1-phosphate guanyltransferase beta [Myotis brandtii]
Length=305

 Score =   347 bits (891),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VT+V+EPSKYGVVV E  TG+
Sbjct  41   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTRVEEPSKYGVVVCEADTGR  100

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  101  IHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLRPTSIEKEVFPVMAKEGQLYAMELQGF  160

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  161  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  220

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  221  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  280

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  281  LYLNGASVLPHKSIGDSVPEPRIIM  305



>dbj|BAN82072.1| hypothetical protein, partial [Protobothrops flavoviridis]
Length=323

 Score =   348 bits (893),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 208/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ EPFFVLNSDVI ++PFK+M+ FH+ HG E +I+VTKV+EPSKYGVVV E  TG 
Sbjct  59   LLAENSEPFFVLNSDVICDFPFKDMVHFHRHHGKEGTIVVTKVEEPSKYGVVVCEADTGL  118

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+LNPSVL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  119  IHRFVEKPQVFVSNKINAGMYILNPSVLKRIQLRPTSIEKEIFPVMAEEGQLYAMELHGF  178

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ LYL+ LR K   +L SG   +GNVLVD +AKI   C IGP+V IG
Sbjct  179  WMDIGQPKDFLTGMCLYLQYLRLKQPERLHSGLGCMGNVLVDPSAKIGSNCSIGPNVTIG  238

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G RI+ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE
Sbjct  239  AGVVVEDGVRIKRCTVLKGSRIRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDE  298

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  299  LYLNGANVLPHKSIAESVPEPRIIM  323



>ref|XP_002920584.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Ailuropoda 
melanoleuca]
Length=360

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETSDPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+LNP+VL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILNPAVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_005074974.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Mesocricetus 
auratus]
Length=360

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETEDPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+PSVL +I+LKPTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPSVLRRIQLKPTSIEKEVFPVMAQEGQLYAMELSGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKHPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_009475176.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Nipponia 
nippon]
Length=331

 Score =   348 bits (893),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 207/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ + GEPFFVLNSDVI E+PF  +  FH+ HGGE S++VT+V+EP+KYGVVV E  TG+
Sbjct  67   LLAEGGEPFFVLNSDVICEFPFAALAHFHRQHGGEGSLVVTRVEEPAKYGVVVSEADTGR  126

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ +P +L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  127  ICRFVEKPRVFVSNKINAGLYIFSPGILQRIQLRPTSIEKEIFPAMAQEGQLYAMELQGF  186

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL++LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG
Sbjct  187  WMDIGQPKDFLTGMCMYLQALRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIG  246

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE
Sbjct  247  AGVVVEDGVRIKRCTVLKGARIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDE  306

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  307  LYLNGANVLPHKSIAESVPEPRIIM  331



>ref|XP_009089239.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Serinus canaria]
Length=360

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 206/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ + GEPFFVLNSDVI E+PF  +  FH+ HGGE S++VT+V+EP+KYGVVV E  TG+
Sbjct  96   LLAEDGEPFFVLNSDVICEFPFAALARFHRQHGGEGSLVVTRVEEPAKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ NP +L +I+L+PTSIEKE+FP +A + +LYAM L GF
Sbjct  156  ICRFVEKPRVFVSNKINAGLYIFNPGILQRIQLRPTSIEKEIFPAMAQDGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL++LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLQALRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV+ G RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE
Sbjct  276  AGVVVEDGVRIKRCTVLEGARIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKSIAESVPEPRIIM  360



>ref|XP_005522264.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Pseudopodoces humilis]
Length=360

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 206/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ + GEPFFVLNSDVI E+PF  +  FH+ HGGE S++VT+V+EP+KYGVVV E  TG+
Sbjct  96   LLAEDGEPFFVLNSDVICEFPFAALARFHRQHGGEGSLVVTRVEEPAKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ NP +L +I+L+PTSIEKE+FP +A + +LYAM L GF
Sbjct  156  ICRFVEKPRVFVSNKINAGLYIFNPGILQRIQLRPTSIEKEIFPAMAQDGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL++LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLQALRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV+ G RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE
Sbjct  276  AGVVVEDGVRIKRCTVLEGARIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKSISESVPEPRIIM  360



>ref|XP_006631022.1| PREDICTED: mannose-1-phosphate guanyltransferase beta-like [Lepisosteus 
oculatus]
Length=360

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 211/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ D+ EPFFVLNSDVI ++PF++M++FHK HG E +I+VTKV+EPSKYGVVV +   G+
Sbjct  96   LLTDNTEPFFVLNSDVICDFPFEDMLKFHKHHGKEGTIVVTKVEEPSKYGVVVYDGENGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ +P++LD+I+L+PTSIEKE+FP +A E  LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYIFSPTMLDRIQLRPTSIEKEIFPVMALEGHLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL+S+R+ S  KL +G+  VGNVLVD TA+I E C IGP+V +G
Sbjct  216  WMDIGQPKDFLTGMCMYLQSVRQHSPEKLRTGSGFVGNVLVDPTAQIGENCTIGPNVTLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G R+  H+ + S IIGW S+VGQW R+EN+T+LGEDV + DE
Sbjct  276  AGVVLEDGVRIKRCTVLKGARVHSHSWLESCIIGWSSSVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKSIAESVPEPRIIM  360



>ref|XP_004615299.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Sorex 
araneus]
Length=360

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/265 (60%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ EPFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETEEPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLRPTSIEKEVFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_005814035.1| PREDICTED: mannose-1-phosphate guanyltransferase beta-like [Xiphophorus 
maculatus]
Length=360

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L++   EPFFVLNSDVI ++PFK+++ FH+SHG E +I+VT+V+EPSKYGVVV E  +G+
Sbjct  96   LLNVDNEPFFVLNSDVICDFPFKDLLRFHRSHGQEGTIVVTRVEEPSKYGVVVYESDSGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            ++RFVEKP++FV NKINAG+Y+ NPS+L +I+L+PTSIEKE+FP +A E  LYAM L GF
Sbjct  156  IQRFVEKPQVFVSNKINAGMYIFNPSMLSRIQLRPTSIEKEIFPVMAREGHLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL SLR+ +  +L +G   +GNVLVD TA+I E C IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLHSLRQHAPERLRTGPGFLGNVLVDPTAQIGENCTIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE
Sbjct  276  AGVVVEDGVRIKRCTVLKGSRVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKSINESVPEPRIIM  360



>ref|XP_006171011.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Tupaia 
chinensis]
Length=360

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 209/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLRPTSIEKEVFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V +G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVTLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + + I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLGACIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSISESVPEPRIIM  360



>ref|XP_009279642.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Aptenodytes 
forsteri]
Length=338

 Score =   348 bits (893),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 207/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ + GEPFFVLNSDVI E+PF  +  FH+ HGGE S++VT+V+EP+KYGVVV E  TG+
Sbjct  74   LLAEGGEPFFVLNSDVICEFPFAALAHFHRQHGGEGSLVVTRVEEPAKYGVVVSEADTGR  133

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ +P +L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  134  ICRFVEKPRVFVSNKINAGLYIFSPGILQRIQLRPTSIEKEIFPAMAQEGQLYAMELQGF  193

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL++LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG
Sbjct  194  WMDIGQPKDFLTGMCMYLQALRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIG  253

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE
Sbjct  254  AGVVVEDGVRIKRCTVLKGARIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDE  313

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  314  LYLNGANVLPHKSIAESVPEPRIIM  338



>ref|XP_005326986.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X2 [Ictidomys tridecemlineatus]
Length=360

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHQHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEVFPIMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_006978396.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Peromyscus 
maniculatus bairdii]
Length=360

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+LKPTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLKPTSIEKEIFPVMAQEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKHPERLYSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_007888693.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Callorhinchus 
milii]
Length=360

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/265 (60%), Positives = 209/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+  + EPFFVLNSDVI E+PF+EM+ FHK HG E +I+VTKV+EPSKYGVV+ E   G+
Sbjct  96   LLTSNSEPFFVLNSDVICEFPFEEMVRFHKHHGKEGTIVVTKVEEPSKYGVVIYEAEIGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ +P++L++I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYIFSPTILNRIQLRPTSIEKEIFPVMAQEGELYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL+SLR K+  +L  G  IVGNVLVD +A I E C IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLQSLRHKAPERLHQGPGIVGNVLVDPSAWIGEKCSIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG VIE GVR+ RCTV++G RI+ H+ + S IIGW S VGQW R+EN+ +LGEDV + DE
Sbjct  276  PGVVIEDGVRIKRCTVLKGSRIRSHSWLESCIIGWSSDVGQWVRMENVAVLGEDVIVKDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P+I+M
Sbjct  336  LYLNGANVLPHKSIADSVPEPKIIM  360



>ref|NP_001231470.1| mannose-1-phosphate guanyltransferase beta [Sus scrofa]
Length=360

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ EPFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETAEPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLQPTSIEKEIFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGKNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_008153791.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Eptesicus 
fuscus]
Length=360

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+L+PTSIEKEVFP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLRPTSIEKEVFPVMAEEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKQPEQLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGDSVPEPRIIM  360



>ref|NP_808578.1| mannose-1-phosphate guanyltransferase beta [Mus musculus]
 ref|XP_006511822.1| PREDICTED: mannose-1-phosphate guanyltransferase beta isoform 
X1 [Mus musculus]
 sp|Q8BTZ7.1|GMPPB_MOUSE RecName: Full=Mannose-1-phosphate guanyltransferase beta; AltName: 
Full=GDP-mannose pyrophosphorylase B; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase beta [Mus musculus]
 dbj|BAC40266.1| unnamed protein product [Mus musculus]
 gb|AAH61207.1| Gmppb protein [Mus musculus]
 dbj|BAE34527.1| unnamed protein product [Mus musculus]
 dbj|BAE28361.1| unnamed protein product [Mus musculus]
 gb|EDL21259.1| GDP-mannose pyrophosphorylase B, isoform CRA_a [Mus musculus]
 gb|EDL21260.1| GDP-mannose pyrophosphorylase B, isoform CRA_a [Mus musculus]
Length=360

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+L+P+VL +I+LKPTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYILSPAVLQRIQLKPTSIEKEIFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I + C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKHPERLYSGPGIVGNVLVDPSARIGQNCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>ref|XP_005724499.1| PREDICTED: mannose-1-phosphate guanyltransferase beta-like [Pundamilia 
nyererei]
Length=360

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 153/265 (58%), Positives = 212/265 (80%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+++  EPFFVLNSDVI ++PFK++++FH +HG E +I+VT+V+EPSKYGVVV E  +G+
Sbjct  96   LLNNDSEPFFVLNSDVICDFPFKDLLQFHHNHGKEGTIVVTRVEEPSKYGVVVYEADSGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ NPS+L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  IHRFVEKPQVFVSNKINAGMYIFNPSMLSRIQLRPTSIEKEIFPVMAGEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL+S+R+ +  +L +G   +GNVLVD TA+I E C IGP+V IG
Sbjct  216  WMDIGQPKDFLTGMCMYLQSVRQHAPERLRTGPGFLGNVLVDPTAQIGENCTIGPNVTIG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G R++ H+ + S I+GW S+VGQW R+EN+T+LGEDV + DE
Sbjct  276  AGVVVEDGVRIKRCTVLKGSRVRSHSWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGANVLPHKSINESVPEPRIIM  360



>gb|KIY95803.1| hypothetical protein MNEG_12160 [Monoraphidium neglectum]
Length=328

 Score =   347 bits (891),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/292 (59%), Positives = 211/292 (72%), Gaps = 28/292 (10%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L D SG+PFFVLNSDV+ EYP K+M++FH S GGEA+I+VTKVD+PSKYGVVV +   GK
Sbjct  38   LDDGSGKPFFVLNSDVVCEYPLKDMLDFHTSSGGEATILVTKVDDPSKYGVVVTD-GEGK  96

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEV------------------  583
            VERFVEKP++FVG+KINAGIY++NPSVL++IEL+PTSIEKEV                  
Sbjct  97   VERFVEKPQVFVGDKINAGIYVINPSVLNRIELRPTSIEKEVRARFTKEAQSAAAAAAAA  156

Query  582  ---------FPKIAAENKLYAMVLPGFWMDIGQPRDYITGLRLYLESLRKKSSPKLASGA  430
                     FP +A + KL+A  LPG+WMD+GQP+DY+ GL L+L SLR      LASGA
Sbjct  157  GRAMGGIWVFPHVATDGKLFAFTLPGYWMDVGQPKDYLLGLNLHLASLRSSRPADLASGA  216

Query  429  HIVGNVLVDETAKIEEGCLIGPDVAIGPGCVIESGVRLSRCTVMRGVRIKKHTCISSSII  250
             I GNVLV  +AKI  G LIGPDV+IG GCVI  GVRLS C +MRGV+IK H  +  SII
Sbjct  217  GISGNVLVAPSAKIGSGSLIGPDVSIGEGCVIGEGVRLSNCVIMRGVKIKNHAKVDRSII  276

Query  249  GWHSTVGQWARVENMTILGEDVHICDEIYSNGGVVLPHKEIKSSILNPEIVM  94
            GW S +G W+R+E  +ILG+DV I DE++ NG  VLPHKEIK S+L P I++
Sbjct  277  GWDSQIGAWSRLEGHSILGKDVQIKDELFLNGATVLPHKEIKESVLQPTIIL  328



>ref|XP_005141643.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Melopsittacus 
undulatus]
Length=294

 Score =   346 bits (887),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 207/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ + GEPFFVLNSDVI E+PF  + +FH+ HGGE S++VT+V+EP+KYGVVV E  TG+
Sbjct  30   LLAEDGEPFFVLNSDVICEFPFTALAQFHRHHGGEGSLVVTRVEEPAKYGVVVSEPDTGR  89

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ +P +L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  90   ICRFVEKPRVFVSNKINAGLYIFSPGILQRIQLRPTSIEKEIFPAMAQEGQLYAMELQGF  149

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL++LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG
Sbjct  150  WMDIGQPKDFLTGMCMYLQALRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIG  209

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV+ G RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE
Sbjct  210  AGVVVEDGVRIKRCTVLEGARIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDE  269

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  270  LYLNGANVLPHKSISESVPEPRIIM  294



>tpg|DAA16917.1| TPA: mannose-1-phosphate guanyltransferase beta [Bos taurus]
Length=360

 Score =   348 bits (893),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 210/265 (79%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ ++ +PFFVLNSDVI ++PF+ M++FH+ HG E SI+VTKV+EPSKYGVVV E  TG+
Sbjct  96   LLCETADPFFVLNSDVICDFPFEAMVQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGR  155

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            V RFVEKP++FV NKINAG+Y+L+PSVL +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  156  VHRFVEKPQVFVSNKINAGVYILSPSVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGF  215

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ L+L+SLR+K   +L SG  IVGNVLVD +A+I E C IGP+V++G
Sbjct  216  WMDIGQPKDFLTGMCLFLQSLRQKHPEQLCSGPGIVGNVLVDPSARIGENCSIGPNVSLG  275

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
            PG V+E GV + RCTV+R   I+ H+ + S I+GW   VGQW R+EN+T+LGEDV + DE
Sbjct  276  PGVVVEDGVCIRRCTVLRDAHIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDE  335

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  336  LYLNGASVLPHKSIGESVPEPRIIM  360



>gb|KGL84089.1| Mannose-1-phosphate guanyltransferase beta-A, partial [Tinamus 
guttatus]
Length=274

 Score =   345 bits (885),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 156/265 (59%), Positives = 207/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ + GEPFFVLNSDVI E+PF  +  FH+ HGGE SI+VT+V+EP+KYGVVV E  +G+
Sbjct  10   LLAEDGEPFFVLNSDVICEFPFAALASFHRHHGGEGSIIVTRVEEPAKYGVVVSEPDSGR  69

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ +P++L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  70   ICRFVEKPRVFVSNKINAGLYMFSPAILRRIQLRPTSIEKEIFPAMAQEGQLYAMELQGF  129

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL SLR +   +L SG  IVGNVLVD +AKI   C+IGP+V IG
Sbjct  130  WMDIGQPKDFLTGMCMYLHSLRIQHPERLHSGPGIVGNVLVDPSAKIGANCIIGPNVTIG  189

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE
Sbjct  190  AGVVVEDGVRIKRCTVLKGARIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDE  249

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  250  LYLNGANVLPHKSIAESVPEPRIIM  274



>ref|XP_005229990.1| PREDICTED: mannose-1-phosphate guanyltransferase beta [Falco 
peregrinus]
Length=342

 Score =   347 bits (891),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 207/265 (78%), Gaps = 0/265 (0%)
 Frame = -2

Query  888  LIDDSGEPFFVLNSDVISEYPFKEMIEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGK  709
            L+ + GEPFFVLNSDVI E+PF  +  FH+ HGGE S++VT+V+EP+KYGVVV E  TG+
Sbjct  78   LLAEGGEPFFVLNSDVICEFPFAALARFHRQHGGEGSLVVTRVEEPAKYGVVVSEADTGR  137

Query  708  VERFVEKPKIFVGNKINAGIYLLNPSVLDQIELKPTSIEKEVFPKIAAENKLYAMVLPGF  529
            + RFVEKP++FV NKINAG+Y+ +P +L +I+L+PTSIEKE+FP +A E +LYAM L GF
Sbjct  138  ICRFVEKPRVFVSNKINAGLYIFSPGILQRIQLRPTSIEKEIFPAMAQEGQLYAMELQGF  197

Query  528  WMDIGQPRDYITGLRLYLESLRKKSSPKLASGAHIVGNVLVDETAKIEEGCLIGPDVAIG  349
            WMDIGQP+D++TG+ +YL++LR +   KL SG  +VGNVLVD +AKI   C+IGP+V IG
Sbjct  198  WMDIGQPKDFLTGMCMYLQALRAQHPEKLHSGPGVVGNVLVDPSAKIGANCVIGPNVTIG  257

Query  348  PGCVIESGVRLSRCTVMRGVRIKKHTCISSSIIGWHSTVGQWARVENMTILGEDVHICDE  169
             G V+E GVR+ RCTV++G RI+ H+ + S I+GW  +VGQW R+EN+T+LGEDV + DE
Sbjct  258  AGVVVEDGVRIKRCTVLKGARIRSHSWLESCIVGWSCSVGQWVRMENVTVLGEDVIVNDE  317

Query  168  IYSNGGVVLPHKEIKSSILNPEIVM  94
            +Y NG  VLPHK I  S+  P I+M
Sbjct  318  LYLNGANVLPHKSIAESVPEPRIIM  342



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1956020332800