BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF039E11

Length=918
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011098348.1|  PREDICTED: mpv17-like protein isoform X2           416   2e-141   Sesamum indicum [beniseed]
ref|XP_011098346.1|  PREDICTED: mpv17-like protein isoform X1           416   3e-141   Sesamum indicum [beniseed]
ref|XP_009769985.1|  PREDICTED: uncharacterized protein LOC104220752    415   5e-141   Nicotiana sylvestris
ref|XP_009594216.1|  PREDICTED: uncharacterized protein LOC104090749    413   3e-140   Nicotiana tomentosiformis
ref|XP_004244201.1|  PREDICTED: uncharacterized protein LOC101247444    412   6e-140   Solanum lycopersicum
ref|XP_006360143.1|  PREDICTED: uncharacterized protein LOC102590255    411   2e-139   Solanum tuberosum [potatoes]
ref|XP_007021315.1|  Peroxisomal membrane 22 kDa family protein i...    410   6e-139   Theobroma cacao [chocolate]
ref|XP_006370309.1|  hypothetical protein POPTR_0001s41510g             406   2e-137   Populus trichocarpa [western balsam poplar]
ref|XP_011042502.1|  PREDICTED: uncharacterized protein LOC105138177    406   2e-137   Populus euphratica
emb|CBI20352.3|  unnamed protein product                                401   4e-137   Vitis vinifera
ref|XP_010278296.1|  PREDICTED: uncharacterized protein LOC104612557    404   9e-137   Nelumbo nucifera [Indian lotus]
ref|XP_002284644.1|  PREDICTED: mpv17-like protein isoform X1           404   1e-136   Vitis vinifera
ref|XP_010092169.1|  Peroxisomal membrane protein 2                     405   1e-136   
gb|EYU26408.1|  hypothetical protein MIMGU_mgv1a007901mg                404   1e-136   Erythranthe guttata [common monkey flower]
ref|XP_010644223.1|  PREDICTED: uncharacterized protein LOC100253...    404   1e-136   Vitis vinifera
ref|XP_011029433.1|  PREDICTED: mpv17-like protein                      404   2e-136   Populus euphratica
ref|XP_004149288.1|  PREDICTED: uncharacterized protein LOC101205134    404   2e-136   Cucumis sativus [cucumbers]
ref|XP_007021317.1|  Peroxisomal membrane 22 kDa family protein i...    404   2e-136   
ref|XP_008452277.1|  PREDICTED: uncharacterized protein LOC103493...    403   3e-136   Cucumis melo [Oriental melon]
ref|XP_008226678.1|  PREDICTED: uncharacterized protein LOC103326248    403   3e-136   Prunus mume [ume]
gb|KGN56219.1|  hypothetical protein Csa_3G100790                       404   6e-136   Cucumis sativus [cucumbers]
ref|XP_008452276.1|  PREDICTED: uncharacterized protein LOC103493...    402   9e-136   Cucumis melo [Oriental melon]
ref|XP_004291669.1|  PREDICTED: uncharacterized protein LOC101306984    402   1e-135   Fragaria vesca subsp. vesca
ref|XP_010545803.1|  PREDICTED: uncharacterized protein LOC104818056    401   2e-135   Tarenaya hassleriana [spider flower]
ref|XP_002317517.2|  hypothetical protein POPTR_0011s12440g             401   2e-135   Populus trichocarpa [western balsam poplar]
ref|XP_007211442.1|  hypothetical protein PRUPE_ppa007209mg             401   2e-135   Prunus persica
gb|EPS62403.1|  hypothetical protein M569_12387                         395   3e-135   Genlisea aurea
ref|XP_006650305.1|  PREDICTED: peroxisomal membrane protein 2-like     393   3e-134   Oryza brachyantha
ref|XP_010924060.1|  PREDICTED: uncharacterized protein LOC105046...    399   3e-134   Elaeis guineensis
gb|KDP24169.1|  hypothetical protein JCGZ_25826                         397   3e-134   Jatropha curcas
emb|CDP05871.1|  unnamed protein product                                398   4e-134   Coffea canephora [robusta coffee]
emb|CDY26037.1|  BnaC06g05870D                                          397   4e-134   Brassica napus [oilseed rape]
emb|CDY53804.1|  BnaA06g01790D                                          397   4e-134   Brassica napus [oilseed rape]
ref|XP_009147654.1|  PREDICTED: uncharacterized protein LOC103871177    397   6e-134   Brassica rapa
ref|XP_002517962.1|  Peroxisomal membrane protein, putative             395   1e-133   
ref|XP_009378495.1|  PREDICTED: uncharacterized protein LOC103966...    396   1e-133   
ref|XP_009378494.1|  PREDICTED: uncharacterized protein LOC103966...    396   1e-133   Pyrus x bretschneideri [bai li]
gb|KFK35762.1|  hypothetical protein AALP_AA4G033000                    395   2e-133   Arabis alpina [alpine rockcress]
ref|XP_006392859.1|  hypothetical protein EUTSA_v10011607mg             395   2e-133   Eutrema salsugineum [saltwater cress]
gb|KDP38924.1|  hypothetical protein JCGZ_00681                         395   2e-133   Jatropha curcas
ref|XP_010268765.1|  PREDICTED: uncharacterized protein LOC104605628    396   3e-133   Nelumbo nucifera [Indian lotus]
ref|NP_001151402.1|  mpv17 / PMP22 family protein                       394   4e-133   Zea mays [maize]
ref|XP_008366686.1|  PREDICTED: uncharacterized protein LOC103430324    395   5e-133   Malus domestica [apple tree]
ref|NP_564615.3|  peroxisomal membrane Mpv17/PMP22 family protein       394   9e-133   Arabidopsis thaliana [mouse-ear cress]
gb|AFW68287.1|  hypothetical protein ZEAMMB73_230689                    390   2e-132   
ref|XP_004982515.1|  PREDICTED: uncharacterized protein LOC101756875    392   3e-132   
ref|XP_010921049.1|  PREDICTED: uncharacterized protein LOC105044749    393   3e-132   Elaeis guineensis
ref|XP_009334618.1|  PREDICTED: uncharacterized protein LOC103927419    393   4e-132   Pyrus x bretschneideri [bai li]
ref|XP_008800139.1|  PREDICTED: uncharacterized protein LOC103714610    391   5e-132   
ref|NP_001050563.1|  Os03g0583800                                       392   5e-132   
ref|XP_009397791.1|  PREDICTED: uncharacterized protein LOC103982557    392   6e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006366011.1|  PREDICTED: protein SYM1-like                       390   6e-132   Solanum tuberosum [potatoes]
gb|EEC75642.1|  hypothetical protein OsI_12389                          392   7e-132   Oryza sativa Indica Group [Indian rice]
ref|NP_001136458.1|  hypothetical protein                               391   8e-132   
ref|XP_008681255.1|  PREDICTED: hypothetical protein isoform X2         391   8e-132   
gb|KHF98025.1|  Peroxisomal membrane 2                                  392   9e-132   Gossypium arboreum [tree cotton]
ref|XP_010060525.1|  PREDICTED: uncharacterized protein LOC104448413    391   9e-132   Eucalyptus grandis [rose gum]
gb|KCW67302.1|  hypothetical protein EUGRSUZ_F01090                     392   1e-131   Eucalyptus grandis [rose gum]
gb|KJB62726.1|  hypothetical protein B456_009G432500                    391   2e-131   Gossypium raimondii
ref|XP_002466876.1|  hypothetical protein SORBIDRAFT_01g015680          390   2e-131   Sorghum bicolor [broomcorn]
gb|KJB62719.1|  hypothetical protein B456_009G432500                    390   2e-131   Gossypium raimondii
gb|KJB62715.1|  hypothetical protein B456_009G432500                    390   3e-131   Gossypium raimondii
gb|KJB62714.1|  hypothetical protein B456_009G432500                    392   3e-131   Gossypium raimondii
gb|KJB62718.1|  hypothetical protein B456_009G432500                    390   4e-131   Gossypium raimondii
ref|XP_009766316.1|  PREDICTED: protein SYM1                            389   4e-131   Nicotiana sylvestris
ref|XP_006464706.1|  PREDICTED: uncharacterized protein LOC102611604    389   5e-131   Citrus sinensis [apfelsine]
gb|KJB79961.1|  hypothetical protein B456_013G074900                    388   7e-131   Gossypium raimondii
gb|KDO74163.1|  hypothetical protein CISIN_1g017634mg                   385   8e-131   Citrus sinensis [apfelsine]
gb|KDO74161.1|  hypothetical protein CISIN_1g017634mg                   389   8e-131   Citrus sinensis [apfelsine]
gb|KDO74162.1|  hypothetical protein CISIN_1g017634mg                   389   8e-131   Citrus sinensis [apfelsine]
ref|XP_003562336.1|  PREDICTED: uncharacterized protein LOC100846887    388   1e-130   Brachypodium distachyon [annual false brome]
ref|XP_006305136.1|  hypothetical protein CARUB_v10009510mg             389   1e-130   Capsella rubella
ref|XP_006841712.1|  hypothetical protein AMTR_s00003p00254020          387   3e-130   
ref|XP_010675607.1|  PREDICTED: protein SYM1-like                       386   3e-130   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006451942.1|  hypothetical protein CICLE_v10008646mg             387   3e-130   
ref|XP_006447327.1|  hypothetical protein CICLE_v10015813mg             386   4e-130   Citrus clementina [clementine]
gb|KDO40771.1|  hypothetical protein CISIN_1g019056mg                   386   5e-130   Citrus sinensis [apfelsine]
ref|XP_011085340.1|  PREDICTED: peroxisomal membrane protein 2          385   5e-130   Sesamum indicum [beniseed]
ref|XP_010500911.1|  PREDICTED: mpv17-like protein                      386   8e-130   Camelina sativa [gold-of-pleasure]
ref|XP_006451944.1|  hypothetical protein CICLE_v10008646mg             386   2e-129   
ref|XP_011039751.1|  PREDICTED: protein SYM1 isoform X1                 384   3e-129   Populus euphratica
gb|KHG05370.1|  Peroxisomal membrane 2                                  385   3e-129   Gossypium arboreum [tree cotton]
ref|XP_006371588.1|  hypothetical protein POPTR_0019s13430g             383   7e-129   Populus trichocarpa [western balsam poplar]
ref|XP_010479814.1|  PREDICTED: uncharacterized protein LOC104758621    384   1e-128   Camelina sativa [gold-of-pleasure]
ref|XP_010462139.1|  PREDICTED: uncharacterized protein LOC104742787    383   1e-128   Camelina sativa [gold-of-pleasure]
gb|EMT03498.1|  Peroxisomal membrane protein 2                          378   2e-128   
ref|XP_007043533.1|  Peroxisomal membrane 22 kDa family protein         385   4e-128   
dbj|BAJ94190.1|  predicted protein                                      380   6e-128   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002891718.1|  hypothetical protein ARALYDRAFT_474411             380   2e-127   
ref|XP_004487310.1|  PREDICTED: protein SYM1-like isoform X1            379   3e-127   
ref|XP_010657274.1|  PREDICTED: mpv17-like protein                      379   3e-127   Vitis vinifera
ref|XP_010522636.1|  PREDICTED: protein SYM1                            377   4e-127   Tarenaya hassleriana [spider flower]
ref|XP_010051673.1|  PREDICTED: uncharacterized protein LOC104440...    379   4e-127   
ref|XP_004248154.1|  PREDICTED: protein SYM1                            378   4e-127   Solanum lycopersicum
ref|XP_004487311.1|  PREDICTED: protein SYM1-like isoform X2            377   7e-127   Cicer arietinum [garbanzo]
gb|EMS63851.1|  Peroxisomal membrane protein 2                          374   8e-127   Triticum urartu
gb|KJB62727.1|  hypothetical protein B456_009G432500                    376   1e-126   Gossypium raimondii
ref|XP_002874865.1|  hypothetical protein ARALYDRAFT_490222             377   2e-126   
gb|ABR17136.1|  unknown                                                 374   3e-126   Picea sitchensis
emb|CDP14740.1|  unnamed protein product                                375   4e-126   Coffea canephora [robusta coffee]
ref|XP_008455339.1|  PREDICTED: mpv17-like protein                      376   6e-126   Cucumis melo [Oriental melon]
ref|XP_003543349.1|  PREDICTED: peroxisomal membrane protein 2          374   1e-125   Glycine max [soybeans]
ref|XP_010095804.1|  Protein SYM1                                       375   1e-125   Morus notabilis
gb|KEH39092.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...    374   1e-125   Medicago truncatula
ref|NP_974505.1|  peroxisomal membrane (Mpv17/PMP22) family protein     375   1e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134349.1|  PREDICTED: protein SYM1                            374   1e-125   Brassica rapa
gb|KHN36615.1|  Peroxisomal membrane protein 2                          377   1e-125   Glycine soja [wild soybean]
ref|NP_192250.2|  peroxisomal membrane (Mpv17/PMP22) family protein     374   2e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396570.1|  hypothetical protein EUTSA_v10028802mg             374   2e-125   Eutrema salsugineum [saltwater cress]
gb|KEH39090.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...    374   2e-125   Medicago truncatula
emb|CDY48204.1|  BnaCnng15950D                                          373   3e-125   Brassica napus [oilseed rape]
ref|XP_004487676.1|  PREDICTED: uncharacterized protein LOC101505712    374   4e-125   Cicer arietinum [garbanzo]
ref|XP_009623041.1|  PREDICTED: protein SYM1                            374   4e-125   Nicotiana tomentosiformis
gb|KEH38794.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...    374   4e-125   Medicago truncatula
gb|AAP40491.1|  unknown protein                                         372   6e-125   Arabidopsis thaliana [mouse-ear cress]
gb|EYU26133.1|  hypothetical protein MIMGU_mgv1a009627mg                372   9e-125   Erythranthe guttata [common monkey flower]
ref|XP_003539526.1|  PREDICTED: peroxisomal membrane protein 2-like     372   1e-124   
gb|KHN04274.1|  Peroxisomal membrane protein 2                          372   1e-124   Glycine soja [wild soybean]
emb|CDX90887.1|  BnaA03g25670D                                          371   2e-124   
ref|XP_003543260.1|  PREDICTED: uncharacterized protein LOC100786706    372   3e-124   Glycine max [soybeans]
gb|KHN36788.1|  Peroxisomal membrane protein 2                          372   3e-124   Glycine soja [wild soybean]
ref|XP_010422462.1|  PREDICTED: LOW QUALITY PROTEIN: mpv17-like p...    372   3e-124   
ref|XP_003539587.1|  PREDICTED: uncharacterized protein LOC100805057    372   3e-124   Glycine max [soybeans]
gb|KFK30935.1|  hypothetical protein AALP_AA6G045100                    370   3e-124   Arabis alpina [alpine rockcress]
ref|XP_006288235.1|  hypothetical protein CARUB_v10001476mg             370   3e-124   Capsella rubella
ref|XP_010455892.1|  PREDICTED: protein SYM1-like                       370   5e-124   Camelina sativa [gold-of-pleasure]
ref|XP_007149878.1|  hypothetical protein PHAVU_005G106400g             369   7e-124   Phaseolus vulgaris [French bean]
ref|XP_008353524.1|  PREDICTED: PXMP2/4 family protein 1-like           370   9e-124   Malus domestica [apple tree]
ref|XP_007149619.1|  hypothetical protein PHAVU_005G085000g             371   1e-123   Phaseolus vulgaris [French bean]
ref|XP_004137017.1|  PREDICTED: uncharacterized protein LOC101214701    370   1e-123   Cucumis sativus [cucumbers]
ref|XP_004304121.1|  PREDICTED: protein SYM1                            368   4e-123   Fragaria vesca subsp. vesca
ref|XP_004155526.1|  PREDICTED: uncharacterized protein LOC101223761    368   1e-122   
ref|XP_009357078.1|  PREDICTED: uncharacterized protein LOC103947838    366   5e-122   Pyrus x bretschneideri [bai li]
ref|XP_008230247.1|  PREDICTED: mpv17-like protein isoform X1           366   6e-122   
ref|XP_008230248.1|  PREDICTED: mpv17-like protein isoform X2           365   7e-122   
ref|XP_007217251.1|  hypothetical protein PRUPE_ppa007825mg             365   9e-122   Prunus persica
ref|XP_010687649.1|  PREDICTED: uncharacterized protein LOC104901742    365   2e-121   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008379554.1|  PREDICTED: uncharacterized protein LOC103442533    364   3e-121   
gb|EMT31197.1|  Peroxisomal membrane protein 2                          358   9e-121   
gb|KJB79964.1|  hypothetical protein B456_013G074900                    359   2e-119   Gossypium raimondii
gb|KJB62721.1|  hypothetical protein B456_009G432500                    358   4e-119   Gossypium raimondii
gb|EMS63743.1|  Protein SYM1                                            354   6e-119   Triticum urartu
gb|KEH39091.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...    356   3e-118   Medicago truncatula
ref|XP_002966359.1|  hypothetical protein SELMODRAFT_66864              344   4e-115   
ref|XP_002978201.1|  hypothetical protein SELMODRAFT_56885              343   1e-114   
ref|XP_001774069.1|  predicted protein                                  330   2e-109   
ref|XP_001765838.1|  predicted protein                                  325   1e-107   
dbj|BAD34004.1|  peroxisomal membrane protein-like                      306   2e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008386298.1|  PREDICTED: uncharacterized protein LOC103448811    293   4e-95    
ref|NP_564616.1|  peroxisomal membrane Mpv17/PMP22 family protein       294   2e-94    Arabidopsis thaliana [mouse-ear cress]
gb|KDO74155.1|  hypothetical protein CISIN_1g017634mg                   293   1e-93    Citrus sinensis [apfelsine]
gb|ABF97329.1|  peroxisomal membrane protein, putative, expressed       291   3e-93    Oryza sativa Japonica Group [Japonica rice]
gb|KDO74164.1|  hypothetical protein CISIN_1g017634mg                   288   4e-92    Citrus sinensis [apfelsine]
ref|XP_008230249.1|  PREDICTED: uncharacterized protein LOC103329...    286   8e-92    
ref|XP_008230251.1|  PREDICTED: uncharacterized protein LOC103329...    286   2e-91    Prunus mume [ume]
ref|XP_008230250.1|  PREDICTED: uncharacterized protein LOC103329...    285   2e-91    Prunus mume [ume]
ref|XP_006451945.1|  hypothetical protein CICLE_v10008646mg             286   2e-91    
ref|XP_008230252.1|  PREDICTED: uncharacterized protein LOC103329...    285   3e-91    
gb|KDO74165.1|  hypothetical protein CISIN_1g017634mg                   285   1e-90    Citrus sinensis [apfelsine]
gb|KJB79963.1|  hypothetical protein B456_013G074900                    283   1e-90    Gossypium raimondii
gb|KDO40772.1|  hypothetical protein CISIN_1g019056mg                   283   2e-90    Citrus sinensis [apfelsine]
gb|KJB62720.1|  hypothetical protein B456_009G432500                    282   1e-89    Gossypium raimondii
ref|XP_006447326.1|  hypothetical protein CICLE_v10015813mg             280   3e-89    
gb|KJB62723.1|  hypothetical protein B456_009G432500                    281   3e-89    Gossypium raimondii
ref|XP_011039752.1|  PREDICTED: uncharacterized protein LOC105136...    279   6e-89    Populus euphratica
gb|KJB62724.1|  hypothetical protein B456_009G432500                    281   7e-89    Gossypium raimondii
gb|KDO40773.1|  hypothetical protein CISIN_1g019056mg                   279   8e-89    Citrus sinensis [apfelsine]
gb|KJB79962.1|  hypothetical protein B456_013G074900                    279   1e-88    Gossypium raimondii
ref|XP_010051684.1|  PREDICTED: uncharacterized protein LOC104440...    277   5e-88    Eucalyptus grandis [rose gum]
gb|ABF97328.1|  peroxisomal membrane protein, putative, expressed       271   1e-85    Oryza sativa Japonica Group [Japonica rice]
gb|EEE59409.1|  hypothetical protein OsJ_11557                          262   1e-83    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ27617.1|  hypothetical protein OsJ_11561                          214   6e-63    Oryza sativa Japonica Group [Japonica rice]
gb|AAT76331.1|  putative peroxisomal membrane protein, 5'-partial       206   1e-62    Oryza sativa Japonica Group [Japonica rice]
gb|ABR25909.1|  mpv17/pmp22 family protein                              197   2e-59    Oryza sativa Indica Group [Indian rice]
gb|ACJ84916.1|  unknown                                                 194   5e-57    Medicago truncatula
gb|EWM29375.1|  peroxisomal membrane 22 kda (mpv17 pmp22) family ...    197   1e-55    Nannochloropsis gaditana
emb|CBJ48801.1|  conserved unknown protein                              193   2e-55    Ectocarpus siliculosus
ref|XP_010924061.1|  PREDICTED: uncharacterized protein LOC105046...    189   1e-53    
gb|KDO74166.1|  hypothetical protein CISIN_1g017634mg                   186   2e-53    Citrus sinensis [apfelsine]
ref|XP_002183832.1|  predicted protein                                  181   8e-52    Phaeodactylum tricornutum CCAP 1055/1
gb|EEE59413.1|  hypothetical protein OsJ_11563                          178   2e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002294377.1|  predicted protein                                  177   2e-50    Thalassiosira pseudonana CCMP1335
gb|AAD11583.1|  hypothetical protein                                    178   2e-50    Arabidopsis thaliana [mouse-ear cress]
gb|KCW89501.1|  hypothetical protein EUGRSUZ_A01792                     178   4e-50    Eucalyptus grandis [rose gum]
gb|EJK64618.1|  hypothetical protein THAOC_14631                        180   7e-50    Thalassiosira oceanica
ref|XP_002509068.1|  predicted protein                                  176   4e-48    Micromonas commoda
ref|XP_002176482.1|  predicted protein                                  164   1e-45    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_003061699.1|  predicted protein                                  168   1e-44    Micromonas pusilla CCMP1545
ref|XP_009035372.1|  hypothetical protein AURANDRAFT_4597               156   2e-42    Aureococcus anophagefferens
emb|CBJ27831.1|  conserved unknown protein                              152   1e-39    Ectocarpus siliculosus
gb|EWM27713.1|  peroxisomal membrane 22 kda (mpv17 pmp22) family ...    155   4e-39    Nannochloropsis gaditana
ref|XP_002177278.1|  predicted protein                                  145   8e-38    Phaeodactylum tricornutum CCAP 1055/1
gb|ACU17682.1|  unknown                                                 143   1e-37    Glycine max [soybeans]
ref|XP_002287745.1|  predicted protein                                  135   2e-34    Thalassiosira pseudonana CCMP1335
gb|EJK58198.1|  hypothetical protein THAOC_21696                        134   3e-32    Thalassiosira oceanica
emb|CBJ31093.1|  conserved unknown protein                              132   7e-32    Ectocarpus siliculosus
ref|XP_005783132.1|  hypothetical protein EMIHUDRAFT_46294              122   7e-30    Emiliania huxleyi CCMP1516
gb|AFK40557.1|  unknown                                                 113   7e-28    Medicago truncatula
gb|AFK33326.1|  unknown                                                 112   2e-27    Medicago truncatula
ref|XP_002530181.1|  conserved hypothetical protein                     118   3e-27    
ref|XP_002183376.1|  predicted protein                                  115   5e-27    Phaeodactylum tricornutum CCAP 1055/1
emb|CBN79011.1|  peroxisomal membrane protein-related                   114   2e-26    Ectocarpus siliculosus
emb|CBN79193.1|  conserved unknown protein                              115   2e-26    Ectocarpus siliculosus
gb|AFK44918.1|  unknown                                                 105   7e-25    Lotus japonicus
gb|EWM28728.1|  Mpv17/PMP22                                             109   2e-24    Nannochloropsis gaditana
ref|XP_005707818.1|  peroxisomal membrane MPV17/PMP22-like protei...    107   3e-24    Galdieria sulphuraria
gb|EWM28134.1|  mpv17-like protein                                      107   1e-23    Nannochloropsis gaditana
ref|XP_005707552.1|  peroxisomal membrane MPV17/PMP22-like protein      107   2e-23    Galdieria sulphuraria
ref|XP_005706778.1|  peroxisomal membrane protein-related protein       106   3e-23    Galdieria sulphuraria
emb|CBJ27540.1|  conserved unknown protein                              106   4e-23    Ectocarpus siliculosus
ref|XP_005535986.1|  similar to peroxisomal membrane protein PMP22      106   4e-23    Cyanidioschyzon merolae strain 10D
ref|XP_005538717.1|  similar to peroxisomal membrane protein PMP22      103   1e-22    Cyanidioschyzon merolae strain 10D
ref|XP_009040828.1|  hypothetical protein AURANDRAFT_15607              102   1e-22    Aureococcus anophagefferens
ref|XP_005776476.1|  putative peroxisomal membrane protein              103   4e-22    Emiliania huxleyi CCMP1516
gb|ACJ84917.1|  unknown                                               97.8    5e-22    Medicago truncatula
gb|ADM21186.1|  peroxisomal membrane-like protein                       102   7e-22    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001090480.1|  uncharacterized protein LOC779393                  100   1e-21    Xenopus laevis [clawed frog]
ref|XP_002287363.1|  predicted protein                                99.8    1e-21    Thalassiosira pseudonana CCMP1335
ref|XP_004359177.1|  pmp22 family protein                               100   2e-21    Cavenderia fasciculata
ref|XP_004345890.1|  PXMP2/4 family protein 3, putative               99.4    2e-21    Acanthamoeba castellanii str. Neff
gb|EWM26132.1|  mpv17-like protein                                    99.4    3e-21    Nannochloropsis gaditana
gb|EJK66898.1|  hypothetical protein THAOC_12131                      98.2    5e-21    Thalassiosira oceanica
ref|XP_007233539.1|  PREDICTED: peroxisomal membrane protein 2-like   97.1    2e-20    
gb|KIY95410.1|  Protein sym1                                          98.6    3e-20    Monoraphidium neglectum
ref|XP_009039064.1|  hypothetical protein AURANDRAFT_29835            95.1    5e-20    Aureococcus anophagefferens
ref|XP_004350783.1|  pmp22 family protein                             94.7    2e-19    Cavenderia fasciculata
ref|XP_005782690.1|  putative peroxisomal membrane protein            96.3    2e-19    Emiliania huxleyi CCMP1516
ref|XP_005788772.1|  hypothetical protein EMIHUDRAFT_122535           96.7    3e-19    Emiliania huxleyi CCMP1516
gb|EJK54998.1|  hypothetical protein THAOC_25323                      94.4    4e-19    Thalassiosira oceanica
ref|XP_005703050.1|  peroxisomal membrane MPV17/PMP22-like protein    93.2    5e-19    Galdieria sulphuraria
gb|EMT24041.1|  hypothetical protein F775_24733                       90.5    1e-18    
ref|XP_005645051.1|  hypothetical protein COCSUDRAFT_67394            91.7    2e-18    Coccomyxa subellipsoidea C-169
ref|XP_005710823.1|  unnamed protein product                          91.3    9e-18    Chondrus crispus [carageen]
ref|XP_002180247.1|  predicted protein                                88.2    2e-17    Phaeodactylum tricornutum CCAP 1055/1
ref|NP_001039473.1|  peroxisomal membrane protein 2                   88.2    2e-17    Bos taurus [bovine]
ref|XP_007181381.1|  PREDICTED: peroxisomal membrane protein 2        88.2    2e-17    Balaenoptera acutorostrata scammoni
gb|EFA78150.1|  pmp22 family protein                                  91.7    3e-17    Heterostelium album PN500
ref|XP_005651770.1|  hypothetical protein COCSUDRAFT_55247            89.0    4e-17    Coccomyxa subellipsoidea C-169
gb|AGO13267.1|  AaceriAFR120Cp                                        87.0    4e-17    Saccharomycetaceae sp. 'Ashbya aceri'
gb|ESX01924.1|  Protein required for ethanol metabolism               87.4    4e-17    Ogataea parapolymorpha DL-1
ref|XP_003384042.1|  PREDICTED: protein SYM1-like                     87.4    6e-17    Amphimedon queenslandica
ref|XP_006298370.1|  hypothetical protein CARUB_v10014441mg           88.2    6e-17    Capsella rubella
ref|XP_009657846.1|  SYM1 protein                                     85.9    1e-16    Verticillium dahliae VdLs.17
ref|XP_006078314.1|  PREDICTED: peroxisomal membrane protein 2        85.9    2e-16    Bubalus bubalis [domestic water buffalo]
ref|XP_004332855.1|  protein sym1, putative                           85.1    2e-16    Acanthamoeba castellanii str. Neff
ref|XP_009032753.1|  hypothetical protein AURANDRAFT_19073            84.7    2e-16    Aureococcus anophagefferens
gb|KIY95774.1|  Protein SYM1                                          84.7    2e-16    Monoraphidium neglectum
emb|CDX71197.1|  BnaC07g04760D                                        85.9    3e-16    
ref|XP_006209527.1|  PREDICTED: peroxisomal membrane protein 2        84.7    3e-16    Vicugna pacos
ref|XP_001691305.1|  predicted protein                                84.7    3e-16    Chlamydomonas reinhardtii
ref|NP_985667.1|  AFR120Cp                                            84.3    4e-16    Eremothecium gossypii ATCC 10895
ref|XP_006346324.1|  PREDICTED: PXMP2/4 family protein 4-like         85.1    5e-16    Solanum tuberosum [potatoes]
ref|XP_008274806.1|  PREDICTED: peroxisomal membrane protein 2        84.0    6e-16    Stegastes partitus
dbj|GAM22026.1|  hypothetical protein SAMD00019534_052010             84.0    8e-16    Acytostelium subglobosum LB1
ref|XP_004230709.1|  PREDICTED: PXMP2/4 family protein 4              84.7    8e-16    Solanum lycopersicum
ref|XP_011088050.1|  PREDICTED: PXMP2/4 family protein 4-like         84.7    1e-15    Sesamum indicum [beniseed]
ref|XP_006175085.1|  PREDICTED: peroxisomal membrane protein 2        83.2    1e-15    Camelus ferus
gb|KIW80472.1|  hypothetical protein Z517_07088                       82.8    1e-15    Fonsecaea pedrosoi CBS 271.37
gb|ETI56565.1|  hypothetical protein F443_00974                       83.6    1e-15    Phytophthora parasitica P1569
dbj|BAO40318.1|  protein SYM1                                         83.2    1e-15    Kluyveromyces marxianus DMKU3-1042
ref|XP_011397434.1|  Protein SYM1                                     85.5    1e-15    Auxenochlorella protothecoides
ref|XP_010946653.1|  PREDICTED: peroxisomal membrane protein 2        83.2    1e-15    Camelus bactrianus [camel]
ref|XP_502197.1|  YALI0C23815p                                        83.2    1e-15    Yarrowia lipolytica CLIB122
ref|XP_008890633.1|  hypothetical protein PPTG_00831                  83.6    1e-15    Phytophthora parasitica INRA-310
ref|XP_005855482.1|  hypothetical protein NGA_0131200                 82.0    1e-15    Nannochloropsis gaditana CCMP526
ref|XP_007953227.1|  PREDICTED: peroxisomal membrane protein 2        83.2    1e-15    Orycteropus afer afer
ref|XP_009595436.1|  PREDICTED: PXMP2/4 family protein 4-like         84.0    2e-15    Nicotiana tomentosiformis
ref|XP_006901037.1|  PREDICTED: peroxisomal membrane protein 2        82.8    2e-15    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|NP_001062843.2|  Os09g0315000                                     79.7    2e-15    
gb|ADE76561.1|  unknown                                               84.0    2e-15    Picea sitchensis
ref|XP_006874132.1|  PREDICTED: peroxisomal membrane protein 2        82.4    2e-15    Chrysochloris asiatica
ref|XP_002556376.1|  KLTH0H11660p                                     82.4    3e-15    Lachancea thermotolerans CBS 6340
ref|XP_005846970.1|  hypothetical protein CHLNCDRAFT_58100            86.3    3e-15    Chlorella variabilis
ref|XP_002753219.2|  PREDICTED: peroxisomal membrane protein 2        82.0    3e-15    Callithrix jacchus [common marmoset]
ref|XP_004346946.1|  Mpv17 protein                                    82.0    3e-15    Capsaspora owczarzaki ATCC 30864
gb|KIW37163.1|  hypothetical protein PV06_10782                       81.3    4e-15    Exophiala oligosperma
ref|XP_002894782.1|  conserved hypothetical protein                   81.6    5e-15    Phytophthora infestans T30-4
ref|XP_009757999.1|  PREDICTED: PXMP2/4 family protein 4-like         82.8    5e-15    Nicotiana sylvestris
ref|XP_006640259.1|  PREDICTED: peroxisomal membrane protein 2-like   81.6    5e-15    Lepisosteus oculatus
ref|XP_002908293.1|  conserved hypothetical protein                   81.6    5e-15    
ref|XP_010517857.1|  PREDICTED: protein SYM1-like                     82.4    5e-15    
ref|XP_010488928.1|  PREDICTED: protein SYM1-like                     82.4    6e-15    
ref|XP_010467271.1|  PREDICTED: protein SYM1-like                     82.0    7e-15    
ref|XP_003002638.1|  SYM1                                             80.5    7e-15    
gb|KIV94522.1|  hypothetical protein PV10_02282                       80.5    8e-15    
gb|KIW61680.1|  hypothetical protein PV05_01773                       80.5    8e-15    
gb|ELR59638.1|  Peroxisomal membrane protein 2                        80.9    8e-15    
ref|XP_010894669.1|  PREDICTED: peroxisomal membrane protein 2        80.9    8e-15    
gb|ETM55915.1|  hypothetical protein L914_00909                       80.9    1e-14    
ref|XP_001784115.1|  predicted protein                                80.1    1e-14    
gb|KHN32813.1|  PXMP2/4 family protein 4                              80.5    2e-14    
ref|XP_003792935.1|  PREDICTED: peroxisomal membrane protein 2        80.1    2e-14    
gb|EHK40338.1|  hypothetical protein TRIATDRAFT_302717                79.7    2e-14    
ref|XP_006299560.1|  hypothetical protein CARUB_v10015735mg           80.9    2e-14    
ref|XP_004611169.1|  PREDICTED: peroxisomal membrane protein 2        80.1    2e-14    
gb|ETI56561.1|  hypothetical protein F443_00970                       80.1    2e-14    
ref|XP_008890629.1|  hypothetical protein PPTG_00827                  79.7    2e-14    
ref|XP_006784311.1|  PREDICTED: peroxisomal membrane protein 2-like   79.7    2e-14    
ref|XP_003451697.1|  PREDICTED: peroxisomal membrane protein 2-like   79.7    2e-14    
ref|NP_113775.1|  peroxisomal membrane protein 2                      79.7    2e-14    
gb|KFK39987.1|  hypothetical protein AALP_AA3G315400                  80.5    2e-14    
ref|XP_005722246.1|  PREDICTED: peroxisomal membrane protein 2-like   79.3    2e-14    
emb|CBK20905.2|  unnamed protein product                              79.3    2e-14    
emb|CDW91795.1|  mpv17 pmp22 family protein                           80.5    3e-14    
emb|CDR36304.1|  CYFA0S01e00364g1_1                                   79.3    3e-14    
ref|NP_179092.1|  Mpv17/PMP22 family protein                          80.1    3e-14    
ref|XP_003421311.1|  PREDICTED: peroxisomal membrane protein 2        79.3    3e-14    
ref|XP_008416906.1|  PREDICTED: peroxisomal membrane protein 2        79.3    3e-14    
gb|KIW30179.1|  hypothetical protein PV07_05941                       79.0    3e-14    
ref|XP_003284959.1|  hypothetical protein DICPUDRAFT_28562            79.0    3e-14    
ref|XP_005916423.1|  PREDICTED: peroxisomal membrane protein 2-like   79.3    3e-14    
ref|XP_008787156.1|  PREDICTED: PXMP2/4 family protein 4-like         80.1    3e-14    
ref|XP_002291546.1|  predicted protein                                77.8    4e-14    
ref|XP_002176518.1|  predicted protein                                79.7    4e-14    
ref|XP_007231359.1|  PREDICTED: mpv17-like protein                    79.0    4e-14    
ref|XP_005186741.1|  PREDICTED: mpv17-like protein 2                  79.0    4e-14    
gb|ESA19537.1|  hypothetical protein GLOINDRAFT_134941                78.6    4e-14    
ref|XP_004544619.1|  PREDICTED: peroxisomal membrane protein 2-like   79.0    4e-14    
ref|XP_005795057.1|  PREDICTED: peroxisomal membrane protein 2-like   79.0    4e-14    
ref|XP_003974957.1|  PREDICTED: peroxisomal membrane protein 2-like   78.6    5e-14    
gb|KEH44032.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...  79.7    5e-14    
ref|XP_010905281.1|  PREDICTED: PXMP2/4 family protein 3-like         79.7    5e-14    
emb|CAG08513.1|  unnamed protein product                              78.2    5e-14    
gb|KIX93815.1|  hypothetical protein Z520_10440                       78.2    6e-14    
ref|XP_009523527.1|  hypothetical protein PHYSODRAFT_259603           78.6    6e-14    
ref|XP_456102.1|  hypothetical protein                                78.6    6e-14    
gb|EFX03442.1|  integral membrane protein mpv17 pmp22 family          77.8    6e-14    
ref|NP_001004607.1|  peroxisomal membrane protein 2                   78.2    6e-14    
ref|XP_002908286.1|  conserved hypothetical protein                   78.6    6e-14    
ref|XP_005643719.1|  hypothetical protein COCSUDRAFT_67996            81.3    7e-14    
ref|XP_003994613.1|  PREDICTED: peroxisomal membrane protein 2 is...  78.2    7e-14    
emb|CDW53985.1|  protein Mpv17                                        77.8    8e-14    
ref|XP_011297995.1|  PREDICTED: protein Mpv17                         77.8    8e-14    
ref|XP_009039118.1|  hypothetical protein AURANDRAFT_29752            77.4    8e-14    
gb|KIW98790.1|  hypothetical protein Z519_00453                       77.4    9e-14    
emb|CAI59818.2|  MPV17 protein                                        77.8    9e-14    
ref|XP_006412301.1|  hypothetical protein EUTSA_v10025993mg           79.0    9e-14    
ref|XP_007739255.1|  protein sym1                                     77.4    9e-14    
ref|XP_008155520.1|  PREDICTED: peroxisomal membrane protein 2        77.4    1e-13    
ref|XP_004017595.1|  PREDICTED: peroxisomal membrane protein 2        77.0    1e-13    
ref|XP_010530711.1|  PREDICTED: PXMP2/4 family protein 3-like         78.6    1e-13    
ref|XP_007559215.1|  PREDICTED: peroxisomal membrane protein 2 is...  77.4    1e-13    
ref|XP_004252742.1|  PREDICTED: protein SYM1-like                     78.6    1e-13    
ref|NP_567940.1|  Peroxisomal membrane protein Mpv17/PMP22            78.6    1e-13    
ref|XP_003707052.1|  PREDICTED: protein Mpv17-like                    77.4    1e-13    
gb|KIW17783.1|  hypothetical protein PV08_04978                       77.0    1e-13    
gb|KDN41878.1|  protein SYM1                                          77.4    1e-13    
gb|KFH45512.1|  hypothetical protein ACRE_036540                      77.0    1e-13    
ref|XP_008454382.1|  PREDICTED: PXMP2/4 family protein 4              79.0    1e-13    
ref|XP_006409625.1|  hypothetical protein EUTSA_v10022822mg           78.2    1e-13    
ref|XP_004289787.1|  PREDICTED: PXMP2/4 family protein 4-like         78.2    2e-13    
ref|XP_009523536.1|  hypothetical protein PHYSODRAFT_496960           77.4    2e-13    
gb|EDM14056.1|  peroxisomal membrane protein 2, isoform CRA_b         77.0    2e-13    
gb|KDQ07535.1|  hypothetical protein BOTBODRAFT_38731                 77.0    2e-13    
ref|XP_010751763.1|  PREDICTED: peroxisomal membrane protein 2        77.0    2e-13    
ref|NP_001248516.1|  peroxisomal membrane protein 2                   77.0    2e-13    
ref|XP_004496888.1|  PREDICTED: PXMP2/4 family protein 4-like         78.2    2e-13    
ref|XP_006285322.1|  hypothetical protein CARUB_v10006709mg           77.8    2e-13    
ref|XP_001649412.1|  AAEL004577-PA                                    77.0    2e-13    
ref|XP_007627415.1|  PREDICTED: peroxisomal membrane protein 2 is...  76.6    2e-13    
ref|XP_004779651.1|  PREDICTED: peroxisomal membrane protein 2        76.6    2e-13    
ref|XP_006681871.1|  hypothetical protein BATDEDRAFT_14086            76.6    2e-13    
ref|XP_009764499.1|  PREDICTED: PXMP2/4 family protein 4-like         77.4    2e-13    
ref|XP_008003501.1|  PREDICTED: peroxisomal membrane protein 2        76.6    2e-13    
emb|CDY49382.1|  BnaA03g50710D                                        77.8    3e-13    
ref|XP_006562124.1|  PREDICTED: protein Mpv17-like                    76.3    3e-13    
ref|XP_011399850.1|  PXMP2/4 family protein 4                         76.3    3e-13    
ref|XP_005705249.1|  peroxisomal membrane MPV17/PMP22-like protein    76.6    3e-13    
ref|XP_009138218.1|  PREDICTED: PXMP2/4 family protein 4-like         77.4    4e-13    
ref|XP_009587200.1|  PREDICTED: PXMP2/4 family protein 4-like         77.0    4e-13    
ref|NP_061133.1|  peroxisomal membrane protein 2                      76.3    4e-13    
ref|XP_001624885.1|  predicted protein                                76.3    4e-13    
ref|XP_002867146.1|  hypothetical protein ARALYDRAFT_491288           77.0    4e-13    
gb|KIK46270.1|  hypothetical protein CY34DRAFT_9819                   76.3    4e-13    
emb|CDX72437.1|  BnaC07g44590D                                        77.4    4e-13    
ref|XP_003907459.1|  PREDICTED: peroxisomal membrane protein 2        75.9    4e-13    
ref|XP_006342660.1|  PREDICTED: protein SYM1-like                     77.0    4e-13    
ref|XP_003645247.1|  hypothetical protein Ecym_2728                   75.9    4e-13    
ref|XP_007233216.1|  PREDICTED: mpv17-like protein 2-like             76.3    5e-13    
gb|KIW08577.1|  hypothetical protein PV09_00541                       75.9    5e-13    
ref|XP_001276424.1|  integral membrane protein, Mpv17/PMP22 famil...  75.9    5e-13    
ref|XP_011405251.1|  PREDICTED: mpv17-like protein 2                  76.3    5e-13    
gb|EZA47821.1|  Protein Mpv17                                         75.5    5e-13    
gb|AFK37482.1|  unknown                                               76.6    5e-13    
ref|XP_002885942.1|  hypothetical protein ARALYDRAFT_480374           76.6    6e-13    
ref|XP_003501778.1|  PREDICTED: peroxisomal membrane protein 2 is...  75.5    7e-13    
ref|XP_008236428.1|  PREDICTED: protein SYM1-like                     76.3    7e-13    
ref|XP_007297121.1|  Mpv17/PMP22 family protein                       75.1    7e-13    
ref|XP_005535923.1|  similar to peroxisomal membrane protein PMP22    77.4    7e-13    
gb|EPS65622.1|  hypothetical protein M569_09156                       75.1    7e-13    
ref|XP_010028381.1|  PREDICTED: PXMP2/4 family protein 4              76.6    7e-13    
ref|XP_007897040.1|  PREDICTED: mpv17-like protein 2                  75.5    8e-13    
gb|EYU37589.1|  hypothetical protein MIMGU_mgv1a011998mg              76.3    8e-13    
ref|XP_009603125.1|  PREDICTED: PXMP2/4 family protein 4-like         75.9    9e-13    
ref|XP_007151917.1|  hypothetical protein PHAVU_004G086700g           75.9    9e-13    
gb|ABA98698.2|  peroxisomal membrane protein 22 kDa, putative, ex...  76.3    9e-13    
ref|XP_002963480.1|  hypothetical protein SELMODRAFT_79996            75.1    9e-13    
gb|EGA57584.1|  Sym1p                                                 75.1    9e-13    
ref|XP_005691553.1|  PREDICTED: peroxisomal membrane protein 2        75.1    1e-12    
ref|XP_003937174.1|  PREDICTED: peroxisomal membrane protein 2        74.3    1e-12    
emb|CEP61700.1|  LALA0S03e08878g1_1                                   75.1    1e-12    
ref|XP_007201355.1|  hypothetical protein PRUPE_ppa010201mg           75.9    1e-12    
ref|XP_010376879.1|  PREDICTED: peroxisomal membrane protein 2        74.7    1e-12    
ref|NP_001141905.1|  uncharacterized protein LOC100274053             75.9    1e-12    
ref|XP_001016227.1|  Mpv17 / PMP22 family protein                     74.7    1e-12    
gb|EMF16791.1|  Mpv17_PMP22-domain-containing protein                 74.7    1e-12    
ref|XP_008674384.1|  PREDICTED: PXMP2/4 family protein 4-like         75.5    1e-12    
ref|XP_973581.1|  PREDICTED: peroxisomal membrane protein PMP22       74.7    1e-12    
emb|CAA19872.1|  putative protein                                     77.8    1e-12    
gb|KEH25967.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...  75.5    1e-12    
ref|XP_005085389.1|  PREDICTED: peroxisomal membrane protein 2        74.7    1e-12    
dbj|GAM25355.1|  hypothetical protein SAMD00019534_085300             74.3    1e-12    
ref|XP_968777.1|  PREDICTED: mpv17-like protein 2                     74.7    1e-12    
gb|KIV78268.1|  hypothetical protein PV11_10000                       74.3    1e-12    
ref|XP_010688400.1|  PREDICTED: protein sym-1                         75.1    1e-12    
ref|XP_005843120.1|  hypothetical protein CHLNCDRAFT_141568           75.1    1e-12    
ref|XP_006599453.1|  PREDICTED: PXMP2/4 family protein 4-like         76.3    1e-12    
emb|CEJ88834.1|  Putative Protein SYM1                                73.9    2e-12    
ref|XP_002988190.1|  hypothetical protein SELMODRAFT_127764           74.3    2e-12    
ref|XP_004635895.1|  PREDICTED: peroxisomal membrane protein 2        74.3    2e-12    
emb|CDH49613.1|  protein sym1                                         74.3    2e-12    
ref|XP_010547955.1|  PREDICTED: protein SYM1-like                     75.5    2e-12    
ref|XP_963854.2|  sym-1                                               73.9    2e-12    
gb|AEE62437.1|  unknown                                               74.7    2e-12    
ref|XP_010277092.1|  PREDICTED: protein SYM1                          75.5    2e-12    
ref|XP_003695695.1|  PREDICTED: protein Mpv17-like                    73.9    2e-12    
ref|XP_001845069.1|  sym-1                                            73.6    2e-12    
ref|XP_004385076.1|  PREDICTED: peroxisomal membrane protein 2        73.9    2e-12    
ref|XP_011001710.1|  PREDICTED: PXMP2/4 family protein 4              75.1    2e-12    
ref|XP_006984153.1|  PREDICTED: peroxisomal membrane protein 2        73.9    2e-12    
ref|XP_010437706.1|  PREDICTED: PXMP2/4 family protein 4-like         75.1    2e-12    
ref|XP_011092520.1|  PREDICTED: PXMP2/4 family protein 4              75.1    2e-12    
ref|XP_010687500.1|  PREDICTED: PXMP2/4 family protein 4-like         75.1    2e-12    
gb|KIP02680.1|  hypothetical protein PHLGIDRAFT_32113                 73.9    2e-12    
ref|XP_001509760.1|  PREDICTED: peroxisomal membrane protein 2        73.9    3e-12    
ref|XP_007920307.1|  hypothetical protein MYCFIDRAFT_71100            73.6    3e-12    
ref|XP_002956366.1|  hypothetical protein VOLCADRAFT_107206           73.9    3e-12    
emb|CCF32955.1|  sym-1                                                73.2    3e-12    
ref|XP_006612128.1|  PREDICTED: protein Mpv17-like                    73.6    3e-12    
ref|XP_003760802.1|  PREDICTED: mpv17-like protein 2                  73.2    3e-12    
gb|KEQ61379.1|  putative integral membrane protein, Mpv17/PMP22 f...  73.6    3e-12    
emb|CDQ80777.1|  unnamed protein product                              75.1    3e-12    
emb|CDW84001.1|  peroxisomal membrane protein 2                       73.6    3e-12    
ref|XP_002938322.1|  PREDICTED: mpv17-like protein-like isoform X1    73.6    3e-12    
ref|XP_003814640.1|  PREDICTED: peroxisomal membrane protein 2 is...  73.6    3e-12    
gb|ELT94432.1|  hypothetical protein CAPTEDRAFT_146770                73.9    3e-12    
ref|XP_001607629.1|  PREDICTED: protein Mpv17-like                    73.2    3e-12    
ref|XP_009523526.1|  hypothetical protein PHYSODRAFT_359986           73.9    3e-12    
gb|ETM55914.1|  hypothetical protein L914_00908                       73.9    3e-12    
ref|XP_009018313.1|  hypothetical protein HELRODRAFT_80158            73.2    3e-12    
ref|NP_001087474.1|  mpv17-like protein                               73.6    3e-12    
ref|XP_002606466.1|  hypothetical protein BRAFLDRAFT_126947           73.2    3e-12    
ref|XP_010272158.1|  PREDICTED: PXMP2/4 family protein 3-like         74.7    3e-12    
gb|ETO85238.1|  hypothetical protein F444_00982                       73.9    3e-12    
gb|ETK96349.1|  hypothetical protein L915_00914                       73.9    4e-12    
ref|XP_008890632.1|  hypothetical protein PPTG_00830                  73.9    4e-12    
ref|XP_009395607.1|  PREDICTED: protein SYM1-like isoform X2          74.3    4e-12    
ref|XP_003519967.1|  PREDICTED: protein SYM1-like                     74.3    4e-12    
ref|XP_008718885.1|  hypothetical protein HMPREF1541_06327            72.8    4e-12    
ref|XP_004152269.1|  PREDICTED: PXMP2/4 family protein 4-like         74.3    4e-12    
ref|XP_004489899.1|  PREDICTED: PXMP2/4 family protein 4-like         73.6    4e-12    
ref|XP_005350406.1|  PREDICTED: mpv17-like protein isoform X1         73.2    4e-12    
ref|XP_005993375.1|  PREDICTED: peroxisomal membrane protein 2 is...  73.2    4e-12    
gb|KIX00264.1|  hypothetical protein Z518_10403                       72.8    4e-12    
gb|EPS64697.1|  hypothetical protein M569_10085                       72.8    5e-12    
ref|XP_004709684.1|  PREDICTED: peroxisomal membrane protein 2        72.8    5e-12    
ref|XP_009470234.1|  PREDICTED: mpv17-like protein 2                  73.9    5e-12    
emb|CDP22545.1|  Putative protein sym-1                               72.8    5e-12    
ref|XP_003390621.1|  PREDICTED: mpv17-like protein 2                  73.2    6e-12    
ref|XP_004538970.1|  PREDICTED: mpv17-like protein-like               72.8    6e-12    
ref|XP_011074370.1|  PREDICTED: PXMP2/4 family protein 3-like         73.6    6e-12    
emb|CDY54475.1|  BnaA09g52780D                                        73.6    6e-12    
gb|KHN96844.1|  Mpv17/PMP22                                           72.4    6e-12    
ref|XP_004962916.1|  PREDICTED: PXMP2/4 family protein 4-like         73.6    6e-12    
ref|XP_010895811.1|  PREDICTED: mpv17-like protein 2                  72.8    7e-12    
gb|ETI56563.1|  hypothetical protein F443_00972                       73.2    7e-12    
ref|XP_008890631.1|  hypothetical protein PPTG_00829                  73.2    7e-12    
ref|XP_635703.1|  pmp22 family protein                                72.4    7e-12    
ref|XP_007753564.1|  protein sym1                                     72.0    7e-12    
ref|XP_001594898.1|  hypothetical protein SS1G_04706                  72.4    7e-12    
gb|ETN64189.1|  sym-1                                                 72.8    8e-12    
ref|XP_002491920.1|  Protein required for ethanol metabolism          72.4    8e-12    
gb|ERS96861.1|  hypothetical protein HMPREF1624_07070                 72.0    8e-12    
gb|EFQ30791.1|  Mpv17/PMP22 family protein                            72.0    8e-12    
ref|XP_005458613.1|  PREDICTED: mpv17-like protein-like isoform X1    72.8    8e-12    
ref|XP_003388107.1|  PREDICTED: mpv17-like protein 2                  72.0    9e-12    
ref|XP_004238099.1|  PREDICTED: protein SYM1-like                     73.2    1e-11    
gb|KDN69708.1|  putative Mpv17/PMP22 family protein                   71.6    1e-11    
ref|XP_007126875.1|  PREDICTED: peroxisomal membrane protein 2        71.6    1e-11    
ref|XP_002865451.1|  hypothetical protein ARALYDRAFT_917372           73.2    1e-11    
ref|XP_006790689.1|  PREDICTED: mpv17-like protein-like               72.4    1e-11    
ref|XP_006664584.1|  PREDICTED: PXMP2/4 family protein 4-like         72.0    1e-11    
ref|XP_001220940.1|  hypothetical protein CHGG_01719                  72.0    1e-11    
ref|XP_007489288.1|  PREDICTED: mpv17-like protein 2                  72.4    1e-11    
ref|XP_007714977.1|  hypothetical protein COCCADRAFT_28442            72.0    1e-11    
ref|XP_005705980.1|  peroxisomal membrane MPV17/PMP22-like protein    72.0    1e-11    
gb|KEQ87254.1|  putative integral membrane protein, Mpv17/PMP22 f...  71.6    1e-11    
gb|EDZ70530.1|  YLR251Wp-like protein                                 72.0    1e-11    
ref|NP_013352.1|  Sym1p                                               71.6    1e-11    
ref|XP_007143101.1|  hypothetical protein PHAVU_007G043600g           72.8    1e-11    



>ref|XP_011098348.1| PREDICTED: mpv17-like protein isoform X2 [Sesamum indicum]
Length=376

 Score =   416 bits (1069),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 196/218 (90%), Positives = 205/218 (94%), Gaps = 1/218 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRYAPQHNWSAYEEALK NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  158  IDHDYWHGWTLYEILRYAPQHNWSAYEEALKTNPVLAKMVISGVVYSVGDWIAQCYEGKP  217

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GFTLHGSLSHYYY FCEALFPFDDWWVVPAKVAFDQT WSA+WNS
Sbjct  218  LFEFDRARMFRSGLLGFTLHGSLSHYYYQFCEALFPFDDWWVVPAKVAFDQTAWSAVWNS  277

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+T+LG LRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  278  IYYTLLGVLRLESPLSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  337

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN-PPSVGPSQ  268
            LIWVTILSTYSNEKSEARISE  VEA +  P S GPS+
Sbjct  338  LIWVTILSTYSNEKSEARISEAPVEANATLPSSKGPSE  375



>ref|XP_011098346.1| PREDICTED: mpv17-like protein isoform X1 [Sesamum indicum]
Length=379

 Score =   416 bits (1068),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 196/218 (90%), Positives = 205/218 (94%), Gaps = 1/218 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRYAPQHNWSAYEEALK NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  158  IDHDYWHGWTLYEILRYAPQHNWSAYEEALKTNPVLAKMVISGVVYSVGDWIAQCYEGKP  217

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GFTLHGSLSHYYY FCEALFPFDDWWVVPAKVAFDQT WSA+WNS
Sbjct  218  LFEFDRARMFRSGLLGFTLHGSLSHYYYQFCEALFPFDDWWVVPAKVAFDQTAWSAVWNS  277

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+T+LG LRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  278  IYYTLLGVLRLESPLSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  337

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN-PPSVGPSQ  268
            LIWVTILSTYSNEKSEARISE  VEA +  P S GPS+
Sbjct  338  LIWVTILSTYSNEKSEARISEAPVEANATLPSSKGPSE  375



>ref|XP_009769985.1| PREDICTED: uncharacterized protein LOC104220752 [Nicotiana sylvestris]
Length=375

 Score =   415 bits (1067),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 193/217 (89%), Positives = 202/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWT++EILRYAPQHNW AYEEALK NPVLAKMVISGVVYSLGDWIAQCYEGKP
Sbjct  158  IDHDYWHGWTVYEILRYAPQHNWIAYEEALKRNPVLAKMVISGVVYSLGDWIAQCYEGKP  217

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDRARM RSGL GFTLHGSLSHYYY FCEALFPF DWWVVP KVAFDQTVWSAIWNS
Sbjct  218  LFDFDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPVKVAFDQTVWSAIWNS  277

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TVLG LR ESP +IFSELKATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  278  IYYTVLGVLRFESPLAIFSELKATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  337

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEAR+SE SVEA   PPS+GP Q
Sbjct  338  LIWVTILSTYSNEKSEARVSEASVEAEMQPPSIGPPQ  374



>ref|XP_009594216.1| PREDICTED: uncharacterized protein LOC104090749 [Nicotiana tomentosiformis]
Length=375

 Score =   413 bits (1062),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 192/217 (88%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWT++EILRYAPQHNW AYEEALK NPVLAKMVISGVVYSLGDWIAQCYEGKP
Sbjct  158  IDHDYWHGWTIYEILRYAPQHNWIAYEEALKRNPVLAKMVISGVVYSLGDWIAQCYEGKP  217

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDRARM RSGL GFTLHGSLSHYYY  CEALFPF DWWVVP KVAFDQTVWSAIWNS
Sbjct  218  LFDFDRARMLRSGLVGFTLHGSLSHYYYQICEALFPFQDWWVVPVKVAFDQTVWSAIWNS  277

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TVLG LR ESP +IFSELKATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  278  IYYTVLGILRFESPLTIFSELKATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  337

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEAR+SE SVEA   PPS+GP Q
Sbjct  338  LIWVTILSTYSNEKSEARVSEASVEAEMQPPSIGPPQ  374



>ref|XP_004244201.1| PREDICTED: uncharacterized protein LOC101247444 [Solanum lycopersicum]
Length=376

 Score =   412 bits (1060),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 193/217 (89%), Positives = 201/217 (93%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  159  IDHDYWHGWTLFEILRYAPQHNWVAYEEALKRNPVLAKMVISGVVYSVGDWIAQCYEGKP  218

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRARM RSGL GFTLHGSLSHYYY FCEALFPF+DWWVVP KVAFDQTVWSAIWNS
Sbjct  219  LFEIDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPVKVAFDQTVWSAIWNS  278

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLG LRLESP +IFSELKATF PMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  279  IYFTVLGILRLESPLAIFSELKATFLPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  338

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            L+WVTILSTYSNEKSE+R+SE  VEA + PPSV P Q
Sbjct  339  LVWVTILSTYSNEKSESRVSEVIVEAEAQPPSVSPPQ  375



>ref|XP_006360143.1| PREDICTED: uncharacterized protein LOC102590255 [Solanum tuberosum]
Length=371

 Score =   411 bits (1056),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 192/217 (88%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  154  IDHDYWHGWTLFEILRYAPQHNWVAYEEALKRNPVLAKMVISGVVYSVGDWIAQCYEGKP  213

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRARM RSGL GFTLHGSLSHYYY FCEALFPF+DWWVVP KVAFDQTVWSAIWNS
Sbjct  214  LFEIDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPVKVAFDQTVWSAIWNS  273

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLG LR ESP +IFSELKATF PMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  274  IYFTVLGILRFESPLAIFSELKATFLPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  333

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSE+R+SE  VEA + PPS+ P Q
Sbjct  334  LIWVTILSTYSNEKSESRVSEVIVEAEAQPPSISPPQ  370



>ref|XP_007021315.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007021316.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12840.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12841.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
Length=386

 Score =   410 bits (1054),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 191/217 (88%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDHNYW GWTL+EILRYAPQHNWSAYEE LK NPVLAKMVISGVVYSLGDWIAQC+EGKP
Sbjct  165  IDHNYWQGWTLYEILRYAPQHNWSAYEEVLKTNPVLAKMVISGVVYSLGDWIAQCFEGKP  224

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFP  DWWVVPAKV FDQT W+A+WNS
Sbjct  225  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPSQDWWVVPAKVVFDQTAWAAVWNS  284

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  285  IYFTVLGFLRLESPISIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  344

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E   EA S+ P VGPS+
Sbjct  345  LIWVTILSTYSNEKSEARIAEAPAEANSSLPPVGPSE  381



>ref|XP_006370309.1| hypothetical protein POPTR_0001s41510g [Populus trichocarpa]
 gb|ABK96261.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP66878.1| hypothetical protein POPTR_0001s41510g [Populus trichocarpa]
Length=369

 Score =   406 bits (1043),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDHNYWHGWTLFEILRYAPQHNWSAYEEALK NPVLAKM+ISG+VYSLGDWIAQCYEGKP
Sbjct  153  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKTNPVLAKMMISGIVYSLGDWIAQCYEGKP  212

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE+DR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT+W+A WNS
Sbjct  213  LFEYDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTLWAAAWNS  272

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFT LGFLRLESP SIFSEL ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  273  IYFTALGFLRLESPASIFSELTATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  332

Query  378  LIWVTILSTYSNEKSEARISEESVEA  301
            LIWVTILSTYSNEKSEARISE +VEA
Sbjct  333  LIWVTILSTYSNEKSEARISEAAVEA  358



>ref|XP_011042502.1| PREDICTED: uncharacterized protein LOC105138177 [Populus euphratica]
Length=369

 Score =   406 bits (1043),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 199/213 (93%), Gaps = 1/213 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDHNYWHGWTLFEILRYAPQHNWSAYEEALK NPVLAKM+ISG+VYSLGDWIAQCYEGKP
Sbjct  153  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKTNPVLAKMMISGIVYSLGDWIAQCYEGKP  212

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE+DR RMFRSGL GFT HGSLSHYYY FCE LFPF DWWVVPAKVAFDQT+W+A WNS
Sbjct  213  LFEYDRTRMFRSGLVGFTFHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTLWAAAWNS  272

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFT LGFLRLESP SIFSEL ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  273  IYFTALGFLRLESPASIFSELTATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  332

Query  378  LIWVTILSTYSNEKSEARISEESVEAT-SNPPS  283
            LIWVTILSTYSNEKSEARISE +VEA+ S+ PS
Sbjct  333  LIWVTILSTYSNEKSEARISEAAVEASFSSLPS  365



>emb|CBI20352.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   401 bits (1030),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 186/217 (86%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEILRYAPQHNWSAYEEALK NPV AKMVISGVVYSLGDWIAQCYEGKP
Sbjct  45   IDADYWHGWTIFEILRYAPQHNWSAYEEALKTNPVFAKMVISGVVYSLGDWIAQCYEGKP  104

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARM RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQT+W+A+WNS
Sbjct  105  LFEFDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTLWAAVWNS  164

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TV+GFLR +SP ++F EL+ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  165  IYYTVVGFLRFDSPANVFGELRATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  224

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEAR+SE S EA SN P  G  +
Sbjct  225  LIWVTILSTYSNEKSEARVSEASAEAASNSPPTGSPE  261



>ref|XP_010278296.1| PREDICTED: uncharacterized protein LOC104612557 [Nelumbo nucifera]
Length=379

 Score =   404 bits (1039),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 189/217 (87%), Positives = 199/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRYAPQHNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  163  IDHDYWHGWTLYEILRYAPQHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GF LHGSLSHYYY FCEALFPF +WWVVPAKVAFDQT WSA+WNS
Sbjct  223  LFEFDRARMFRSGLVGFCLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTAWSAVWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ +LGFLRLESP +IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  283  IYYVILGFLRLESPANIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  342

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEAR SE S+E  S  P  G  +
Sbjct  343  LIWVTILSTYSNEKSEARNSEASLETKSISPLPGAEE  379



>ref|XP_002284644.1| PREDICTED: mpv17-like protein isoform X1 [Vitis vinifera]
Length=371

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEILRYAPQHNWSAYEEALK NPV AKMVISGVVYSLGDWIAQCYEGKP
Sbjct  154  IDADYWHGWTIFEILRYAPQHNWSAYEEALKTNPVFAKMVISGVVYSLGDWIAQCYEGKP  213

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARM RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQT+W+A+WNS
Sbjct  214  LFEFDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTLWAAVWNS  273

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TV+GFLR +SP ++F EL+ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  274  IYYTVVGFLRFDSPANVFGELRATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  333

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVG  277
            LIWVTILSTYSNEKSEAR+SE S EA SN P  G
Sbjct  334  LIWVTILSTYSNEKSEARVSEASAEAASNSPPTG  367



>ref|XP_010092169.1| Peroxisomal membrane protein 2 [Morus notabilis]
 gb|EXB50359.1| Peroxisomal membrane protein 2 [Morus notabilis]
Length=393

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 191/217 (88%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTLFEILRYAPQHNWSAYEEALK NPV AKMVISGVVYS+GDWIAQCYEGKP
Sbjct  157  IDQDYWHGWTLFEILRYAPQHNWSAYEEALKTNPVFAKMVISGVVYSVGDWIAQCYEGKP  216

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKV FDQT WSA+WNS
Sbjct  217  LFEFDRARMFRSGLVGFTLHGSLSHYYYQFCEALFPFHDWWVVPAKVVFDQTAWSAVWNS  276

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TVLGFLRLESP SIFSELKATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  277  IYYTVLGFLRLESPASIFSELKATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  336

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARISE  VE      +V P +
Sbjct  337  LIWVTILSTYSNEKSEARISEAPVEVNLISSNVTPPE  373



>gb|EYU26408.1| hypothetical protein MIMGU_mgv1a007901mg [Erythranthe guttata]
Length=392

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 191/218 (88%), Positives = 202/218 (93%), Gaps = 1/218 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL EILRYAPQHNWSAYE ALK NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  174  IDHDYWHGWTLLEILRYAPQHNWSAYESALKTNPVLAKMVISGVVYSVGDWIAQCYEGKP  233

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRAR+FRSGL GFTLHGSLSHYYYHFCEALFPFDDWWVVPAKV FDQTVWSAIWNS
Sbjct  234  IFEFDRARLFRSGLVGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVLFDQTVWSAIWNS  293

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFT+LG LR ESP +IFSE KATF PMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCVE
Sbjct  294  IYFTLLGVLRFESPANIFSEWKATFLPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCVE  353

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN-PPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E  VEA ++ PP  GPS+
Sbjct  354  LIWVTILSTYSNEKSEARITEAPVEANASLPPVKGPSE  391



>ref|XP_010644223.1| PREDICTED: uncharacterized protein LOC100253839 isoform X2 [Vitis 
vinifera]
Length=370

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 186/214 (87%), Positives = 198/214 (93%), Gaps = 0/214 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEILRYAPQHNWSAYEEALK NPV AKMVISGVVYSLGDWIAQCYEGKP
Sbjct  154  IDADYWHGWTIFEILRYAPQHNWSAYEEALKTNPVFAKMVISGVVYSLGDWIAQCYEGKP  213

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARM RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQT+W+A+WNS
Sbjct  214  LFEFDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTLWAAVWNS  273

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TV+GFLR +SP ++F EL+ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  274  IYYTVVGFLRFDSPANVFGELRATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  333

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVG  277
            LIWVTILSTYSNEKSEAR+SE S EA SN P  G
Sbjct  334  LIWVTILSTYSNEKSEARVSEASAEAASNSPPTG  367



>ref|XP_011029433.1| PREDICTED: mpv17-like protein [Populus euphratica]
Length=370

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNWSAYEEALK NPVLAKM+ISGVVYS+GDWIAQCYEGKP
Sbjct  153  IDHDYWHGWTLFEILRYAPQHNWSAYEEALKTNPVLAKMMISGVVYSVGDWIAQCYEGKP  212

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR RMFRSG+ GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT+W+A WNS
Sbjct  213  IFEFDRTRMFRSGIVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTMWAAAWNS  272

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLRLESP SIFSEL ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  273  IYFTVLGFLRLESPASIFSELTATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  332

Query  378  LIWVTILSTYSNEKSEARISEESVEA  301
            LIWVTILSTYSNEKSEARISE +VEA
Sbjct  333  LIWVTILSTYSNEKSEARISEATVEA  358



>ref|XP_004149288.1| PREDICTED: uncharacterized protein LOC101205134 [Cucumis sativus]
 ref|XP_004171301.1| PREDICTED: uncharacterized protein LOC101228605 [Cucumis sativus]
Length=376

 Score =   404 bits (1037),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 188/217 (87%), Positives = 200/217 (92%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNWSAYEEALK +PVLAKMVISGVVYSLGDWIAQC+EGKP
Sbjct  159  IDQDYWHGWTLYEILRYAPQHNWSAYEEALKTHPVLAKMVISGVVYSLGDWIAQCFEGKP  218

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GF+LHGSLSHYYYHFCE LFPF DWWVVPAKVAFDQT WSA+WNS
Sbjct  219  LFEFDRTRMFRSGLVGFSLHGSLSHYYYHFCEGLFPFQDWWVVPAKVAFDQTAWSAVWNS  278

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  279  IYFVVLGFLRLESPVSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  338

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARISE + + +S+P     +Q
Sbjct  339  LIWVTILSTYSNEKSEARISEVATDLSSDPLPTDSTQ  375



>ref|XP_007021317.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma 
cacao]
 gb|EOY12842.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma 
cacao]
Length=391

 Score =   404 bits (1038),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 191/222 (86%), Positives = 199/222 (90%), Gaps = 5/222 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDHNYW GWTL+EILRYAPQHNWSAYEE LK NPVLAKMVISGVVYSLGDWIAQC+EGKP
Sbjct  165  IDHNYWQGWTLYEILRYAPQHNWSAYEEVLKTNPVLAKMVISGVVYSLGDWIAQCFEGKP  224

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEA-----LFPFDDWWVVPAKVAFDQTVWS  574
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE      LFP  DWWVVPAKV FDQT W+
Sbjct  225  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEVIILHYLFPSQDWWVVPAKVVFDQTAWA  284

Query  573  AIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLW  394
            A+WNSIYFTVLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLW
Sbjct  285  AVWNSIYFTVLGFLRLESPISIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLW  344

Query  393  VDCVELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            VDCVELIWVTILSTYSNEKSEARI+E   EA S+ P VGPS+
Sbjct  345  VDCVELIWVTILSTYSNEKSEARIAEAPAEANSSLPPVGPSE  386



>ref|XP_008452277.1| PREDICTED: uncharacterized protein LOC103493348 isoform X2 [Cucumis 
melo]
Length=376

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNWSAYEEALK +PVLAKMVISGVVYSLGDWIAQC+EGKP
Sbjct  159  IDQDYWHGWTLYEILRYAPQHNWSAYEEALKTHPVLAKMVISGVVYSLGDWIAQCFEGKP  218

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GF+LHGSLSHYYYHFCE LFPF DWWVVPAKVAFDQT WSA+WNS
Sbjct  219  LFEFDRTRMFRSGLVGFSLHGSLSHYYYHFCEGLFPFQDWWVVPAKVAFDQTAWSAVWNS  278

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  279  IYFVVLGFLRLESPVSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  338

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN  292
            LIWVTILSTYSNEKSEARISE + +++S+
Sbjct  339  LIWVTILSTYSNEKSEARISEVATDSSSD  367



>ref|XP_008226678.1| PREDICTED: uncharacterized protein LOC103326248 [Prunus mume]
Length=378

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 190/215 (88%), Positives = 196/215 (91%), Gaps = 0/215 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTLFEILRYAPQHNWSAYEEALK NPVLAKMVISGVVYS+GDWIAQC+EGKP
Sbjct  161  IDQDYWHGWTLFEILRYAPQHNWSAYEEALKTNPVLAKMVISGVVYSIGDWIAQCFEGKP  220

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RM RSGL GFTLHGSLSHYYY FCE L PF DWWVVPAKVAFDQTVW+AIWNS
Sbjct  221  LFEFDRTRMLRSGLVGFTLHGSLSHYYYQFCEELIPFQDWWVVPAKVAFDQTVWAAIWNS  280

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ESP  IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  281  IYFTVLGFLRFESPIDIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  340

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  274
            LIWVTILSTYSNEKSEARISE  VEA S+  +  P
Sbjct  341  LIWVTILSTYSNEKSEARISEAPVEANSSSSNTSP  375



>gb|KGN56219.1| hypothetical protein Csa_3G100790 [Cucumis sativus]
Length=412

 Score =   404 bits (1037),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 187/210 (89%), Positives = 198/210 (94%), Gaps = 0/210 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNWSAYEEALK +PVLAKMVISGVVYSLGDWIAQC+EGKP
Sbjct  195  IDQDYWHGWTLYEILRYAPQHNWSAYEEALKTHPVLAKMVISGVVYSLGDWIAQCFEGKP  254

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GF+LHGSLSHYYYHFCE LFPF DWWVVPAKVAFDQT WSA+WNS
Sbjct  255  LFEFDRTRMFRSGLVGFSLHGSLSHYYYHFCEGLFPFQDWWVVPAKVAFDQTAWSAVWNS  314

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  315  IYFVVLGFLRLESPVSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  374

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNP  289
            LIWVTILSTYSNEKSEARISE + + +S+P
Sbjct  375  LIWVTILSTYSNEKSEARISEVATDLSSDP  404



>ref|XP_008452276.1| PREDICTED: uncharacterized protein LOC103493348 isoform X1 [Cucumis 
melo]
Length=382

 Score =   402 bits (1033),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNWSAYEEALK +PVLAKMVISGVVYSLGDWIAQC+EGKP
Sbjct  159  IDQDYWHGWTLYEILRYAPQHNWSAYEEALKTHPVLAKMVISGVVYSLGDWIAQCFEGKP  218

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GF+LHGSLSHYYYHFCE LFPF DWWVVPAKVAFDQT WSA+WNS
Sbjct  219  LFEFDRTRMFRSGLVGFSLHGSLSHYYYHFCEGLFPFQDWWVVPAKVAFDQTAWSAVWNS  278

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  279  IYFVVLGFLRLESPVSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  338

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN  292
            LIWVTILSTYSNEKSEARISE + +++S+
Sbjct  339  LIWVTILSTYSNEKSEARISEVATDSSSD  367



>ref|XP_004291669.1| PREDICTED: uncharacterized protein LOC101306984 [Fragaria vesca 
subsp. vesca]
Length=377

 Score =   402 bits (1032),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 185/215 (86%), Positives = 200/215 (93%), Gaps = 0/215 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT++EILRYAPQHNW+AYEEALK NPVLAKMVISGVVYSLGDWIAQC+EGKP
Sbjct  160  IDQDYWHGWTIYEILRYAPQHNWTAYEEALKANPVLAKMVISGVVYSLGDWIAQCFEGKP  219

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GFTLHGSLSHYYY  CE LFPF  WWVVP KVAFDQT+W+AIWNS
Sbjct  220  LFEFDRARMFRSGLVGFTLHGSLSHYYYQICEELFPFQGWWVVPVKVAFDQTIWAAIWNS  279

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLRLESP +I+SELKATFWPMLTAGWKLWPFAHL+TYG+IPVEQRLLWVDCVE
Sbjct  280  IYFTVLGFLRLESPINIYSELKATFWPMLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCVE  339

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  274
            LIWVTILSTYSNEKSEARIS+   EA+SN P++ P
Sbjct  340  LIWVTILSTYSNEKSEARISDAPAEASSNSPNISP  374



>ref|XP_010545803.1| PREDICTED: uncharacterized protein LOC104818056 [Tarenaya hassleriana]
Length=377

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 186/217 (86%), Positives = 198/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW+AYEEALK NP+LAKMVISGVVYSLGDWIAQCYEGKP
Sbjct  160  IDHDYWHGWTLFEILRYAPQHNWTAYEEALKRNPILAKMVISGVVYSLGDWIAQCYEGKP  219

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARM RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQT WSAIWNS
Sbjct  220  LFEFDRARMLRSGLVGFTLHGSLSHFYYQFCEELFPFRDWWVVPVKVAFDQTAWSAIWNS  279

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ESP SIF EL+ATF PMLTAGWKLWPFAHLITYG+IP+EQRLLWVDCVE
Sbjct  280  IYFTVLGFLRFESPISIFKELRATFLPMLTAGWKLWPFAHLITYGLIPLEQRLLWVDCVE  339

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARISE +++ TS+     PS+
Sbjct  340  LIWVTILSTYSNEKSEARISEAAIDPTSSSTFTDPSK  376



>ref|XP_002317517.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa]
 gb|EEE98129.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa]
Length=370

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNWSAYEEALK NPVLAKM+ISGVVYS+GDWIAQCYEGKP
Sbjct  153  IDHDYWHGWTLFEILRYAPQHNWSAYEEALKTNPVLAKMMISGVVYSVGDWIAQCYEGKP  212

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR RMFRSG+ GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT+W+A WNS
Sbjct  213  IFEFDRTRMFRSGVVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTLWAAAWNS  272

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLRLESP SIFSEL ATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  273  IYFTVLGFLRLESPASIFSELTATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  332

Query  378  LIWVTILSTYSNEKSEARISEESVEA  301
            LIWVTILSTYSNEKSEARISE +VEA
Sbjct  333  LIWVTILSTYSNEKSEARISEATVEA  358



>ref|XP_007211442.1| hypothetical protein PRUPE_ppa007209mg [Prunus persica]
 gb|EMJ12641.1| hypothetical protein PRUPE_ppa007209mg [Prunus persica]
Length=378

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/215 (87%), Positives = 196/215 (91%), Gaps = 0/215 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNWSAYEEALK NPVLAKMVISGVVYS+GDWIAQC+EGKP
Sbjct  161  IDQDYWHGWTLYEILRYAPQHNWSAYEEALKTNPVLAKMVISGVVYSVGDWIAQCFEGKP  220

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RM RSGL GFTLHGSLSHYYY FCE L PF DWWVVPAKVAFDQTVW+AIWNS
Sbjct  221  LFEFDRTRMLRSGLVGFTLHGSLSHYYYQFCEELIPFQDWWVVPAKVAFDQTVWAAIWNS  280

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ESP  IFSELKATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCVE
Sbjct  281  IYFTVLGFLRFESPIDIFSELKATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCVE  340

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  274
            LIWVTILSTYSNEKSEARISE  VEA S+  +  P
Sbjct  341  LIWVTILSTYSNEKSEARISEAPVEANSSSSNTSP  375



>gb|EPS62403.1| hypothetical protein M569_12387, partial [Genlisea aurea]
Length=247

 Score =   395 bits (1016),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWT +E+LRYAPQHNW AYEEALK NPVL+KM ISGVVYS+GDWIAQCYEGKP
Sbjct  35   IDHDYWHGWTFYEVLRYAPQHNWIAYEEALKTNPVLSKMAISGVVYSVGDWIAQCYEGKP  94

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR RMFRSGL GFTLHGSLSHYYYH CE LFPFD+WWVVPAKVAFDQT+WSA+WNS
Sbjct  95   IFEFDRLRMFRSGLLGFTLHGSLSHYYYHLCEDLFPFDEWWVVPAKVAFDQTIWSAVWNS  154

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+T+LG LRLESP +IFSELKATFWPMLTAGWKLWPFAHLITYGV+P+EQRLLWVDCVE
Sbjct  155  IYYTLLGVLRLESPVAIFSELKATFWPMLTAGWKLWPFAHLITYGVVPLEQRLLWVDCVE  214

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSV  280
            L+WVTILSTYSNEKSEARISE ++EA +NP  V
Sbjct  215  LVWVTILSTYSNEKSEARISEVAIEADTNPTEV  247



>ref|XP_006650305.1| PREDICTED: peroxisomal membrane protein 2-like [Oryza brachyantha]
Length=238

 Score =   393 bits (1009),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  25   VDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKP  84

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKVAFDQT WSA+WNS
Sbjct  85   IFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVAFDQTAWSAMWNS  144

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLR ESP++ FSELK+TFWPMLTAGWKLWPFAHL+TYG+IPVEQRLLWVDCVE
Sbjct  145  IYFVVLGFLRFESPSTTFSELKSTFWPMLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCVE  204

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN  292
            LIWVTILSTYSNEKSEAR SE++  A ++
Sbjct  205  LIWVTILSTYSNEKSEARNSEDASTANAS  233



>ref|XP_010924060.1| PREDICTED: uncharacterized protein LOC105046999 isoform X1 [Elaeis 
guineensis]
Length=389

 Score =   399 bits (1024),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 197/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNW+AYEEALK NPVLAKMVISGVVYSLGDWIAQCYEGKP
Sbjct  171  IDRDYWHGWTLYEILRYAPQHNWTAYEEALKTNPVLAKMVISGVVYSLGDWIAQCYEGKP  230

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDRARMFRSG+ GFTLHGSLSHYYY FCE+LFPF DWWVVPAKV FDQT W+AIWNS
Sbjct  231  LFDFDRARMFRSGVVGFTLHGSLSHYYYQFCESLFPFQDWWVVPAKVLFDQTAWAAIWNS  290

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLGFLR ESP +IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  291  IYYAVLGFLRFESPANIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  350

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSV  280
            L+WVTILSTYSNEKSEAR SE   E+ + PP+V
Sbjct  351  LVWVTILSTYSNEKSEARNSEAMSESNATPPAV  383



>gb|KDP24169.1| hypothetical protein JCGZ_25826 [Jatropha curcas]
Length=354

 Score =   397 bits (1020),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 185/217 (85%), Positives = 199/217 (92%), Gaps = 1/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+E+LRY P+HNW AYE+ALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  138  IDHDYWHGWTLYEVLRYVPEHNWIAYEQALKTNPVLAKMAISGIVYSIGDWIAQCYEGKP  197

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR RMFRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVWSAIWNS
Sbjct  198  IFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWSAIWNS  257

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ESP +IFSEL ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  258  IYFTVLGFLRFESPANIFSELTATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  317

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSE+RISE + E+  N  S  PS+
Sbjct  318  LIWVTILSTYSNEKSESRISEATSESDPN-SSTNPSE  353



>emb|CDP05871.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   398 bits (1022),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRY PQHNWSAYEEALK NPV AKM+ISGVVYS+GDWIAQCYEGKP
Sbjct  167  IDSDYWHGWTLYEILRYVPQHNWSAYEEALKTNPVFAKMMISGVVYSVGDWIAQCYEGKP  226

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDRARMFRSGL GFTLHGSLSHYYYHFCEALFP DDWWVVPAKV FDQT WSA+WNS
Sbjct  227  LLEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPSDDWWVVPAKVVFDQTFWSAVWNS  286

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ V+G LRLESP SIF ELKATFWPMLTAGWKLWPFAHLITYGVIP+EQRLLWVDCVE
Sbjct  287  IYYAVVGALRLESPASIFGELKATFWPMLTAGWKLWPFAHLITYGVIPIEQRLLWVDCVE  346

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSV  280
            LIWVTILSTYSNEKSE+RISE++ E   NP S+
Sbjct  347  LIWVTILSTYSNEKSESRISEQAAEENVNPASI  379



>emb|CDY26037.1| BnaC06g05870D [Brassica napus]
Length=352

 Score =   397 bits (1019),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 188/218 (86%), Positives = 198/218 (91%), Gaps = 1/218 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  134  IDHDYWHGWTLFEILRYAPQHNWLAYEEALKRNPVLAKMVISGVVYSVGDWIAQCYEGKP  193

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVPAKVAFDQTVWSAIWNS
Sbjct  194  LFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPAKVAFDQTVWSAIWNS  253

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLRLESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCVE
Sbjct  254  IYFTVLGFLRLESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCVE  313

Query  378  LIWVTILSTYSNEKSEARISEESVE-ATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARISE  +E  +S+   + PS+
Sbjct  314  LIWVTILSTYSNEKSEARISESVIENPSSSTTPIDPSK  351



>emb|CDY53804.1| BnaA06g01790D [Brassica napus]
Length=373

 Score =   397 bits (1021),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 199/218 (91%), Gaps = 1/218 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  144  IDHDYWHGWTLFEILRYAPQHNWLAYEEALKRNPVLAKMVISGVVYSVGDWIAQCYEGKP  203

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVPAKVAFDQTVWSAIWNS
Sbjct  204  LFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPAKVAFDQTVWSAIWNS  263

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLRLESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCVE
Sbjct  264  IYFTVLGFLRLESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCVE  323

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS-VGPSQ  268
            LIWVTILSTYSNEKSEAR+SE  +E +S+  + + PS+
Sbjct  324  LIWVTILSTYSNEKSEARLSESVIENSSSSTTPIDPSK  361



>ref|XP_009147654.1| PREDICTED: uncharacterized protein LOC103871177 [Brassica rapa]
Length=362

 Score =   397 bits (1019),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 199/218 (91%), Gaps = 1/218 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  144  IDHDYWHGWTLFEILRYAPQHNWLAYEEALKRNPVLAKMVISGVVYSVGDWIAQCYEGKP  203

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVPAKVAFDQTVWSAIWNS
Sbjct  204  LFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPAKVAFDQTVWSAIWNS  263

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLRLESP SIF EL+ATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCVE
Sbjct  264  IYFTVLGFLRLESPLSIFKELEATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCVE  323

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS-VGPSQ  268
            LIWVTILSTYSNEKSEARISE  +E +S+  + + PS+
Sbjct  324  LIWVTILSTYSNEKSEARISESVIENSSSSTTPIDPSK  361



>ref|XP_002517962.1| Peroxisomal membrane protein, putative [Ricinus communis]
 gb|EEF44480.1| Peroxisomal membrane protein, putative [Ricinus communis]
Length=344

 Score =   395 bits (1016),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+E+LRY P+HNW AYE+ALK NPVL KM ISG+VYS+GDWIAQCYEGKP
Sbjct  125  IDHDYWHGWTLYEVLRYVPEHNWIAYEQALKSNPVLTKMAISGIVYSIGDWIAQCYEGKP  184

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR RMFRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVW+AIWNS
Sbjct  185  IFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWAAIWNS  244

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLR ESP +IFSEL ATFWPMLTAGWKLWPF+HLITYGVIPVEQRLLWVDCVE
Sbjct  245  IYFLVLGFLRFESPANIFSELTATFWPMLTAGWKLWPFSHLITYGVIPVEQRLLWVDCVE  304

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            LIWVTILSTYSNEKSEAR SE ++EATS   S
Sbjct  305  LIWVTILSTYSNEKSEARTSEATIEATSKSSS  336



>ref|XP_009378495.1| PREDICTED: uncharacterized protein LOC103966976 isoform X2 [Pyrus 
x bretschneideri]
Length=379

 Score =   396 bits (1018),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/215 (86%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWTL+EILRYAPQHNWSAYEEALK NPVLAKMVISGVVYS+GDWIAQC+EGKP
Sbjct  163  VDQDYWHGWTLYEILRYAPQHNWSAYEEALKTNPVLAKMVISGVVYSVGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RM RSGL GFTLHGSLSHYYY  CE L PF DWWVVPAKVAFDQTVW+AIWNS
Sbjct  223  LLEFDRTRMLRSGLVGFTLHGSLSHYYYQLCEELIPFQDWWVVPAKVAFDQTVWAAIWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ESP SIFSELKATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCVE
Sbjct  283  IYFTVLGFLRFESPISIFSELKATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCVE  342

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  274
            LIWVTILSTYSNEKSEARISE   E  S+    GP
Sbjct  343  LIWVTILSTYSNEKSEARISEAPAEGNSSSSDTGP  377



>ref|XP_009378494.1| PREDICTED: uncharacterized protein LOC103966976 isoform X1 [Pyrus 
x bretschneideri]
Length=380

 Score =   396 bits (1018),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 185/215 (86%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWTL+EILRYAPQHNWSAYEEALK NPVLAKMVISGVVYS+GDWIAQC+EGKP
Sbjct  163  VDQDYWHGWTLYEILRYAPQHNWSAYEEALKTNPVLAKMVISGVVYSVGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RM RSGL GFTLHGSLSHYYY  CE L PF DWWVVPAKVAFDQTVW+AIWNS
Sbjct  223  LLEFDRTRMLRSGLVGFTLHGSLSHYYYQLCEELIPFQDWWVVPAKVAFDQTVWAAIWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ESP SIFSELKATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCVE
Sbjct  283  IYFTVLGFLRFESPISIFSELKATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCVE  342

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  274
            LIWVTILSTYSNEKSEARISE   E  S+    GP
Sbjct  343  LIWVTILSTYSNEKSEARISEAPAEGNSSSSDTGP  377



>gb|KFK35762.1| hypothetical protein AALP_AA4G033000 [Arabis alpina]
Length=352

 Score =   395 bits (1015),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 183/212 (86%), Positives = 193/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQH+W AYEEALK NPVLAKMVISG+VYS+GDWIAQCYEGKP
Sbjct  139  IDHDYWHGWTLFEILRYAPQHSWIAYEEALKRNPVLAKMVISGIVYSVGDWIAQCYEGKP  198

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR+ RSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KV FDQTVWSAIWNS
Sbjct  199  LFEIDRARIVRSGLVGFTLHGSLSHYYYQFCEVLFPFQDWWVVPVKVVFDQTVWSAIWNS  258

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLRLESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCVE
Sbjct  259  IYFTVLGFLRLESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCVE  318

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            LIWVTILSTYSNEKSE RIS+  +E +S  PS
Sbjct  319  LIWVTILSTYSNEKSETRISDSVIETSSVDPS  350



>ref|XP_006392859.1| hypothetical protein EUTSA_v10011607mg [Eutrema salsugineum]
 gb|ESQ30145.1| hypothetical protein EUTSA_v10011607mg [Eutrema salsugineum]
Length=359

 Score =   395 bits (1015),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  147  IDHDYWHGWTLFEILRYAPQHNWIAYEEALKRNPVLAKMVISGVVYSVGDWIAQCYEGKP  206

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KV FDQTVWSAIWNS
Sbjct  207  LFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVVFDQTVWSAIWNS  266

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLRLESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCVE
Sbjct  267  IYFTVLGFLRLESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCVE  326

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNP  289
            LIWVTILSTYSNEKSEARISE  V+ + +P
Sbjct  327  LIWVTILSTYSNEKSEARISESVVDTSIDP  356



>gb|KDP38924.1| hypothetical protein JCGZ_00681 [Jatropha curcas]
Length=375

 Score =   395 bits (1016),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/217 (83%), Positives = 197/217 (91%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YW GWT++EILRYAPQHNWSAYEEALK NPVLAKM+ISGVVYS+GDWIAQC+EGKP
Sbjct  158  IDHDYWQGWTIYEILRYAPQHNWSAYEEALKTNPVLAKMMISGVVYSIGDWIAQCFEGKP  217

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GF LHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WNS
Sbjct  218  LFEFDRARMFRSGLVGFMLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWNS  277

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ V+GFLRL+SP +IFSEL+ATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCVE
Sbjct  278  IYYIVVGFLRLDSPATIFSELRATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCVE  337

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI E   EA SN  S G ++
Sbjct  338  LIWVTILSTYSNEKSEARIPETQTEAGSNSLSKGSAE  374



>ref|XP_010268765.1| PREDICTED: uncharacterized protein LOC104605628 [Nelumbo nucifera]
Length=386

 Score =   396 bits (1017),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRYAPQHNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  169  IDHDYWHGWTLYEILRYAPQHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKP  228

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GF+LHGSLSHYYY FCEALFPF DWWVVPAKV FDQT W+AIWNS
Sbjct  229  LFEFDRARMFRSGLVGFSLHGSLSHYYYQFCEALFPFQDWWVVPAKVIFDQTAWAAIWNS  288

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ +LGFLR ESP++IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  289  IYYVILGFLRFESPSNIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  348

Query  378  LIWVTILSTYSNEKSEARISE  316
            L+WVTILSTYSNEKSEAR SE
Sbjct  349  LVWVTILSTYSNEKSEARNSE  369



>ref|NP_001151402.1| mpv17 / PMP22 family protein [Zea mays]
 gb|ACG42715.1| mpv17 / PMP22 family protein [Zea mays]
 tpg|DAA50134.1| TPA: mpv17 / PMP22 family protein [Zea mays]
Length=353

 Score =   394 bits (1012),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 197/210 (94%), Gaps = 4/210 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  140  VDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKP  199

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQTVWSAIWNS
Sbjct  200  IFDFDRARMFRSGLVGFTLHGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTVWSAIWNS  259

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESPT+I+SELK+TFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  260  IYFVVLGFLRLESPTTIYSELKSTFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  319

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNP  289
            L+WVTILSTYSNEKSEAR S    ++TS P
Sbjct  320  LVWVTILSTYSNEKSEARNS----DSTSTP  345



>ref|XP_008366686.1| PREDICTED: uncharacterized protein LOC103430324 [Malus domestica]
Length=374

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 196/215 (91%), Gaps = 0/215 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWTL+EILRYAPQHNWSAYE+ALK NPVLAKMVISGVVYS+GDWIAQC+EGKP
Sbjct  157  VDQDYWHGWTLYEILRYAPQHNWSAYEDALKTNPVLAKMVISGVVYSVGDWIAQCFEGKP  216

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR+RM RSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQTVW+AIWNS
Sbjct  217  LFEFDRSRMLRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTVWAAIWNS  276

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTV+GFLR ESP SIFSEL ATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCVE
Sbjct  277  IYFTVVGFLRFESPISIFSELTATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCVE  336

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  274
            L+WVTILSTYSNEKSEARISE   E  S+  +  P
Sbjct  337  LVWVTILSTYSNEKSEARISEAPAEDISSSSNTSP  371



>ref|NP_564615.3| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
 gb|AAG52277.1|AC019018_14 unknown protein; 54928-56750 [Arabidopsis thaliana]
 gb|AAK60317.1|AF385726_1 At1g52870/F14G24_14 [Arabidopsis thaliana]
 gb|AAN72239.1| At1g52870/F14G24_14 [Arabidopsis thaliana]
 gb|AEE32862.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
Length=366

 Score =   394 bits (1011),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK+NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  148  IDHDYWHGWTLFEILRYAPQHNWIAYEEALKQNPVLAKMVISGVVYSVGDWIAQCYEGKP  207

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQTVWSAIWNS
Sbjct  208  LFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVAFDQTVWSAIWNS  267

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCVE
Sbjct  268  IYFTVLGFLRFESPISIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCVE  327

Query  378  LIWVTILSTYSNEKSEARISEESVE  304
            LIWVTILSTYSNEKSEARISE  +E
Sbjct  328  LIWVTILSTYSNEKSEARISESVIE  352



>gb|AFW68287.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
Length=294

 Score =   390 bits (1003),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 198/212 (93%), Gaps = 4/212 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  81   VDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKP  140

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQT+WSAIWNS
Sbjct  141  IFDFDRARMFRSGLVGFTLHGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTIWSAIWNS  200

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESPT+I++ELK+TFWPMLTAGWKLWPFAHL+TYGV+PVEQRLLWVDCVE
Sbjct  201  IYFVVLGFLRLESPTTIYNELKSTFWPMLTAGWKLWPFAHLVTYGVVPVEQRLLWVDCVE  260

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            L+WVTILSTYSNEKSEAR S    ++TS P +
Sbjct  261  LVWVTILSTYSNEKSEARNS----DSTSTPAA  288



>ref|XP_004982515.1| PREDICTED: uncharacterized protein LOC101756875 [Setaria italica]
Length=356

 Score =   392 bits (1007),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 198/213 (93%), Gaps = 4/213 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  143  VDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKP  202

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQT+WSAIWNS
Sbjct  203  IFDFDRARMFRSGLVGFTLHGSLSHYYYHVCEALFPFKDWWVVPAKVAFDQTIWSAIWNS  262

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESPT+I+SELK+TFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCVE
Sbjct  263  IYFVVLGFLRLESPTTIYSELKSTFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCVE  322

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSV  280
            LIWVTILSTYSNEKSEAR S    + TS P ++
Sbjct  323  LIWVTILSTYSNEKSEARNS----DGTSTPDAL  351



>ref|XP_010921049.1| PREDICTED: uncharacterized protein LOC105044749 [Elaeis guineensis]
Length=391

 Score =   393 bits (1010),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 186/217 (86%), Positives = 196/217 (90%), Gaps = 6/217 (3%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNW+AYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  178  IDRDYWHGWTLYEILRYAPQHNWTAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKP  237

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDRARMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKV FDQT W+AIWNS
Sbjct  238  LFDFDRARMFRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVVFDQTAWAAIWNS  297

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLGFLR ESP +IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  298  IYYAVLGFLRFESPANIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  357

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            L+WVTILSTYSNEKSEAR SE      SN PS  P +
Sbjct  358  LVWVTILSTYSNEKSEARNSE------SNDPSAVPEE  388



>ref|XP_009334618.1| PREDICTED: uncharacterized protein LOC103927419 [Pyrus x bretschneideri]
Length=379

 Score =   393 bits (1009),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWTL+EILRYAPQHNWSAYE+ALK NPVLAKMVISGVVYS+GDWIAQC+EGKP
Sbjct  162  VDQDYWHGWTLYEILRYAPQHNWSAYEDALKTNPVLAKMVISGVVYSVGDWIAQCFEGKP  221

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RM RSGL GFTLHGSLSHYYY FCE L PF DWWVVPAKVAFDQTVW+AIWNS
Sbjct  222  LFEFDRTRMLRSGLVGFTLHGSLSHYYYQFCEELIPFQDWWVVPAKVAFDQTVWAAIWNS  281

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTV+GFLR ESP SIFSEL ATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCVE
Sbjct  282  IYFTVVGFLRFESPISIFSELTATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCVE  341

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  274
            L+WVTILSTYSNEKSEARISE   E  S+  +  P
Sbjct  342  LVWVTILSTYSNEKSEARISEAPAEDISSSSNTSP  376



>ref|XP_008800139.1| PREDICTED: uncharacterized protein LOC103714610, partial [Phoenix 
dactylifera]
Length=351

 Score =   391 bits (1005),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 195/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YW GWTL+EILRYAPQHNW+AYEEALK NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  132  IDSDYWQGWTLYEILRYAPQHNWTAYEEALKTNPVLAKMVISGVVYSVGDWIAQCYEGKP  191

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDRARMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKV FDQT W+AIWNS
Sbjct  192  LFDFDRARMFRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVLFDQTAWAAIWNS  251

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LR ESP +IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  252  IYYAVLGLLRFESPANIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  311

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            L+WVTILSTYSNEKSEAR +E   E+ +  PS  P +
Sbjct  312  LVWVTILSTYSNEKSEARNTEAMSESNAKSPSAIPEE  348



>ref|NP_001050563.1| Os03g0583800 [Oryza sativa Japonica Group]
 gb|AAS07184.1| putative peroxisomal membrane protein [Oryza sativa Japonica 
Group]
 gb|ABF97327.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12477.1| Os03g0583800 [Oryza sativa Japonica Group]
 dbj|BAG89204.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94010.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   392 bits (1006),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 197/209 (94%), Gaps = 2/209 (1%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  145  VDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKP  204

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWNS
Sbjct  205  IFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWNS  264

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP +I SELK+TFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVE
Sbjct  265  IYFVVLGFLRLESPATISSELKSTFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVE  324

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN  292
            LIWVTILSTYSNEKSEAR SE++  +TSN
Sbjct  325  LIWVTILSTYSNEKSEARNSEDA--STSN  351



>ref|XP_009397791.1| PREDICTED: uncharacterized protein LOC103982557 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 197/216 (91%), Gaps = 2/216 (1%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID  YWHGWTL+EILRYAPQHNW+AYEEALK NPVLAKM+ISG+VYSLGDWIAQCYEGKP
Sbjct  168  IDSEYWHGWTLYEILRYAPQHNWTAYEEALKTNPVLAKMMISGIVYSLGDWIAQCYEGKP  227

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDRARMFRSGL GF+LHGSLSHYYYHFCEALFPF DWW VPAKV FDQT WSAIWNS
Sbjct  228  LFDFDRARMFRSGLVGFSLHGSLSHYYYHFCEALFPFQDWWTVPAKVVFDQTAWSAIWNS  287

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LRLESP +IF+EL+ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  288  IYYVVLGILRLESPANIFTELRATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  347

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPS  271
            LIWVTILSTYSNEKSEAR S+ +++  SN  SV  +
Sbjct  348  LIWVTILSTYSNEKSEARNSDATLD--SNVKSVSAA  381



>ref|XP_006366011.1| PREDICTED: protein SYM1-like [Solanum tuberosum]
Length=335

 Score =   390 bits (1003),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH YWHGWTL+EILRYAP+HNW AYEEALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  118  IDHEYWHGWTLYEILRYAPEHNWIAYEEALKANPVLAKMAISGIVYSVGDWIAQCYEGKP  177

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GF+LHGSLSHYYY FCEALFP +DWWVVPAKVAFDQT+WSAIWNS
Sbjct  178  LLEFDRTRMFRSGLVGFSLHGSLSHYYYQFCEALFPSNDWWVVPAKVAFDQTIWSAIWNS  237

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLES ++IF EL+ATFWPMLTAGWKLWPFAHLITYGVIP+EQRLLWVDCVE
Sbjct  238  IYFVVLGFLRLESASNIFGELRATFWPMLTAGWKLWPFAHLITYGVIPLEQRLLWVDCVE  297

Query  378  LIWVTILSTYSNEKSEARISEESVEA  301
            L+WVTILSTYSNEKSEARISEE  EA
Sbjct  298  LVWVTILSTYSNEKSEARISEELSEA  323



>gb|EEC75642.1| hypothetical protein OsI_12389 [Oryza sativa Indica Group]
Length=369

 Score =   392 bits (1006),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/213 (86%), Positives = 199/213 (93%), Gaps = 2/213 (1%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  142  VDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKP  201

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWNS
Sbjct  202  IFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWNS  261

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP +I SELK+TFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVE
Sbjct  262  IYFVVLGFLRLESPATISSELKSTFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVE  321

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSV  280
            LIWVTILSTYSNEKSEAR SE++  +TSN  +V
Sbjct  322  LIWVTILSTYSNEKSEARNSEDA--STSNASNV  352



>ref|NP_001136458.1| hypothetical protein [Zea mays]
 ref|XP_008681254.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF81975.1| unknown [Zea mays]
 gb|ACR38508.1| unknown [Zea mays]
 gb|ACR38595.1| unknown [Zea mays]
 gb|AFW68288.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
 gb|AFW68289.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
Length=351

 Score =   391 bits (1004),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 197/210 (94%), Gaps = 4/210 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  138  VDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKP  197

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQT+WSAIWNS
Sbjct  198  IFDFDRARMFRSGLVGFTLHGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTIWSAIWNS  257

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESPT+I++ELK+TFWPMLTAGWKLWPFAHL+TYGV+PVEQRLLWVDCVE
Sbjct  258  IYFVVLGFLRLESPTTIYNELKSTFWPMLTAGWKLWPFAHLVTYGVVPVEQRLLWVDCVE  317

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNP  289
            L+WVTILSTYSNEKSEAR S    ++TS P
Sbjct  318  LVWVTILSTYSNEKSEARNS----DSTSTP  343



>ref|XP_008681255.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=348

 Score =   391 bits (1004),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 197/210 (94%), Gaps = 4/210 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  138  VDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKP  197

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQT+WSAIWNS
Sbjct  198  IFDFDRARMFRSGLVGFTLHGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTIWSAIWNS  257

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESPT+I++ELK+TFWPMLTAGWKLWPFAHL+TYGV+PVEQRLLWVDCVE
Sbjct  258  IYFVVLGFLRLESPTTIYNELKSTFWPMLTAGWKLWPFAHLVTYGVVPVEQRLLWVDCVE  317

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNP  289
            L+WVTILSTYSNEKSEAR S    ++TS P
Sbjct  318  LVWVTILSTYSNEKSEARNS----DSTSTP  343



>gb|KHF98025.1| Peroxisomal membrane 2 [Gossypium arboreum]
Length=381

 Score =   392 bits (1006),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 197/218 (90%), Gaps = 1/218 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID NYW GWT++EI+RYAPQHNWSAYEEAL+ NPVLAKMVISG+VYS+GDWIAQC+EGKP
Sbjct  163  IDQNYWQGWTIYEIVRYAPQHNWSAYEEALRTNPVLAKMVISGIVYSIGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A+WNS
Sbjct  223  LFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAVWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF +LGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCVE
Sbjct  283  IYFVILGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCVE  342

Query  378  LIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  343  LIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPE  380



>ref|XP_010060525.1| PREDICTED: uncharacterized protein LOC104448413 [Eucalyptus grandis]
 gb|KCW67301.1| hypothetical protein EUGRSUZ_F01090 [Eucalyptus grandis]
Length=373

 Score =   391 bits (1005),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT++EI+RYAP HNWSAYEEALK NPVLAKMVISGVVYS+GDWIAQC+EGKP
Sbjct  155  IDSDYWHGWTIYEIVRYAPLHNWSAYEEALKTNPVLAKMVISGVVYSVGDWIAQCFEGKP  214

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQTVW+AIWNS
Sbjct  215  LFEFDRTRMFRSGLVGFTLHGSLSHYYYEFCEELFPFQDWWVVPVKVAFDQTVWAAIWNS  274

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+T LGFLRLESP +IF+ELKATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  275  IYYTALGFLRLESPINIFTELKATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  334

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E   EA     S+ P +
Sbjct  335  LIWVTILSTYSNEKSEARIAEVPAEANPGAQSLNPPE  371



>gb|KCW67302.1| hypothetical protein EUGRSUZ_F01090 [Eucalyptus grandis]
Length=381

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT++EI+RYAP HNWSAYEEALK NPVLAKMVISGVVYS+GDWIAQC+EGKP
Sbjct  155  IDSDYWHGWTIYEIVRYAPLHNWSAYEEALKTNPVLAKMVISGVVYSVGDWIAQCFEGKP  214

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQTVW+AIWNS
Sbjct  215  LFEFDRTRMFRSGLVGFTLHGSLSHYYYEFCEELFPFQDWWVVPVKVAFDQTVWAAIWNS  274

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+T LGFLRLESP +IF+ELKATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  275  IYYTALGFLRLESPINIFTELKATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  334

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E   EA     S+ P +
Sbjct  335  LIWVTILSTYSNEKSEARIAEVPAEANPGAQSLNPPE  371



>gb|KJB62726.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=382

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 196/218 (90%), Gaps = 1/218 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID NYW GWT++EI+RYAPQHNWSAYEEAL+ NPVLAKMVISG+VYS+GDWIAQC+EGKP
Sbjct  163  IDQNYWQGWTIYEIVRYAPQHNWSAYEEALRTNPVLAKMVISGIVYSIGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WNS
Sbjct  223  LFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCVE
Sbjct  283  IYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCVE  342

Query  378  LIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  343  LIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPE  380



>ref|XP_002466876.1| hypothetical protein SORBIDRAFT_01g015680 [Sorghum bicolor]
 gb|EER93874.1| hypothetical protein SORBIDRAFT_01g015680 [Sorghum bicolor]
Length=367

 Score =   390 bits (1002),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 196/210 (93%), Gaps = 4/210 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  153  VDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKP  212

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQT+WSAIWNS
Sbjct  213  IFDFDRARMFRSGLVGFTLHGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTIWSAIWNS  272

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESPT+I+ ELK+TFWPMLTAGWKLWPFAHL+TYGV+PVEQRLLWVDCVE
Sbjct  273  IYFVVLGFLRLESPTTIYGELKSTFWPMLTAGWKLWPFAHLVTYGVVPVEQRLLWVDCVE  332

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNP  289
            L+WVTILSTYSNEKSEAR S    ++TS P
Sbjct  333  LVWVTILSTYSNEKSEARNS----DSTSTP  358



>gb|KJB62719.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62725.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=380

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 196/218 (90%), Gaps = 1/218 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID NYW GWT++EI+RYAPQHNWSAYEEAL+ NPVLAKMVISG+VYS+GDWIAQC+EGKP
Sbjct  163  IDQNYWQGWTIYEIVRYAPQHNWSAYEEALRTNPVLAKMVISGIVYSIGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WNS
Sbjct  223  LFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCVE
Sbjct  283  IYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCVE  342

Query  378  LIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  343  LIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPE  380



>gb|KJB62715.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62716.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62717.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62722.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62728.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=382

 Score =   390 bits (1003),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 196/218 (90%), Gaps = 1/218 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID NYW GWT++EI+RYAPQHNWSAYEEAL+ NPVLAKMVISG+VYS+GDWIAQC+EGKP
Sbjct  163  IDQNYWQGWTIYEIVRYAPQHNWSAYEEALRTNPVLAKMVISGIVYSIGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WNS
Sbjct  223  LFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCVE
Sbjct  283  IYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCVE  342

Query  378  LIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  343  LIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPE  380



>gb|KJB62714.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=418

 Score =   392 bits (1007),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/260 (74%), Positives = 214/260 (82%), Gaps = 9/260 (3%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID NYW GWT++EI+RYAPQHNWSAYEEAL+ NPVLAKMVISG+VYS+GDWIAQC+EGKP
Sbjct  163  IDQNYWQGWTIYEIVRYAPQHNWSAYEEALRTNPVLAKMVISGIVYSIGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WNS
Sbjct  223  LFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCVE
Sbjct  283  IYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCVE  342

Query  378  LIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ*TDRKPRSGEKIGGRSVCVLLF  202
            LIWVTILSTYSNEKSEARISE +  EA+S  P VGP +   RK    +   G   CV  +
Sbjct  343  LIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPEAGHRKISQKQ---GEITCV-CY  398

Query  201  LSSDSILFVEGRGFGIYEWR  142
            +++   L+V+     +Y WR
Sbjct  399  VNAVFCLYVQ----KLYFWR  414



>gb|KJB62718.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=391

 Score =   390 bits (1003),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 196/218 (90%), Gaps = 1/218 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID NYW GWT++EI+RYAPQHNWSAYEEAL+ NPVLAKMVISG+VYS+GDWIAQC+EGKP
Sbjct  163  IDQNYWQGWTIYEIVRYAPQHNWSAYEEALRTNPVLAKMVISGIVYSIGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WNS
Sbjct  223  LFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCVE
Sbjct  283  IYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCVE  342

Query  378  LIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  343  LIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPE  380



>ref|XP_009766316.1| PREDICTED: protein SYM1 [Nicotiana sylvestris]
Length=335

 Score =   389 bits (998),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWT +EILRYAP+HNW AYEEALK NPVLAKM ISG+VY+LGDWIAQCYEGKP
Sbjct  118  IDHDYWHGWTFYEILRYAPEHNWIAYEEALKTNPVLAKMAISGIVYALGDWIAQCYEGKP  177

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GF+LHGSLSHYYY FCEALFP +DWWVVPAKVAFDQT+W+A+WNS
Sbjct  178  LLEFDRTRMFRSGLVGFSLHGSLSHYYYQFCEALFPSNDWWVVPAKVAFDQTIWAAVWNS  237

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLGFLRLES  +IF ELK TFWPMLTAGWKLWPFAHLITYGVIP+EQRLLWVDC+E
Sbjct  238  IYYVVLGFLRLESAANIFGELKTTFWPMLTAGWKLWPFAHLITYGVIPLEQRLLWVDCIE  297

Query  378  LIWVTILSTYSNEKSEARISEESVEA  301
            L+WVTILSTYSNEKSEARISEES+EA
Sbjct  298  LVWVTILSTYSNEKSEARISEESLEA  323



>ref|XP_006464706.1| PREDICTED: uncharacterized protein LOC102611604 [Citrus sinensis]
 gb|KDO74156.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74157.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74158.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74159.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74160.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=365

 Score =   389 bits (1000),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEI+RYAP HNW+AYEEALK NPVLAKMVISGVVYSLGDWIAQC++GKP
Sbjct  148  IDQDYWHGWTIFEIVRYAPLHNWTAYEEALKTNPVLAKMVISGVVYSLGDWIAQCFQGKP  207

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WNS
Sbjct  208  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWNS  267

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVE
Sbjct  268  IYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVE  327

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  328  LIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  364



>gb|KJB79961.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=345

 Score =   388 bits (997),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 196/217 (90%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+E+LRY PQHNW AYE+ALK NPV+AKM ISG+VYS+GDWIAQCYEGKP
Sbjct  129  IDHDYWHGWTLYEVLRYVPQHNWIAYEQALKANPVIAKMAISGIVYSIGDWIAQCYEGKP  188

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDR RMFRSGL GFTLHGSLSHYYY FCEALFP DDWWVVPAKV FDQTVW+AIWNS
Sbjct  189  LFDFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPSDDWWVVPAKVIFDQTVWAAIWNS  248

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLGFLR ES  +I+ ELKATFWPMLTAGWKLWPFAH+ITYGVIP+EQRLLWVDCVE
Sbjct  249  IYYVVLGFLRFESSANIYKELKATFWPMLTAGWKLWPFAHVITYGVIPIEQRLLWVDCVE  308

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E +++A SN  +  P +
Sbjct  309  LIWVTILSTYSNEKSEARITEPTMDADSNSSNNPPEE  345



>gb|KDO74163.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=257

 Score =   385 bits (988),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEI+RYAP HNW+AYEEALK NPVLAKMVISGVVYSLGDWIAQC++GKP
Sbjct  40   IDQDYWHGWTIFEIVRYAPLHNWTAYEEALKTNPVLAKMVISGVVYSLGDWIAQCFQGKP  99

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WNS
Sbjct  100  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWNS  159

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVE
Sbjct  160  IYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVE  219

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  220  LIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  256



>gb|KDO74161.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=367

 Score =   389 bits (999),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEI+RYAP HNW+AYEEALK NPVLAKMVISGVVYSLGDWIAQC++GKP
Sbjct  148  IDQDYWHGWTIFEIVRYAPLHNWTAYEEALKTNPVLAKMVISGVVYSLGDWIAQCFQGKP  207

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WNS
Sbjct  208  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWNS  267

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVE
Sbjct  268  IYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVE  327

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  328  LIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  364



>gb|KDO74162.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=368

 Score =   389 bits (999),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 193/217 (89%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEI+RYAP HNW+AYEEALK NPVLAKMVISGVVYSLGDWIAQC++GKP
Sbjct  148  IDQDYWHGWTIFEIVRYAPLHNWTAYEEALKTNPVLAKMVISGVVYSLGDWIAQCFQGKP  207

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WNS
Sbjct  208  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWNS  267

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVE
Sbjct  268  IYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVE  327

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  328  LIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  364



>ref|XP_003562336.1| PREDICTED: uncharacterized protein LOC100846887 [Brachypodium 
distachyon]
Length=359

 Score =   388 bits (997),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  147  VDQDYWHGWTIFEILRYMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKP  206

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR RMFRSGL GFTLHGSLSHYYYHFCE+LFPF DWW VP KVAFDQT WSA+WNS
Sbjct  207  IFEFDRTRMFRSGLVGFTLHGSLSHYYYHFCESLFPFKDWWAVPVKVAFDQTAWSALWNS  266

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLR ESP +IFSELK+TF+PMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  267  IYFVVLGFLRFESPVTIFSELKSTFFPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  326

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN  292
            LIWVTILSTYSNEKSEARIS+ S    S 
Sbjct  327  LIWVTILSTYSNEKSEARISDASTSTDSQ  355



>ref|XP_006305136.1| hypothetical protein CARUB_v10009510mg [Capsella rubella]
 gb|EOA38034.1| hypothetical protein CARUB_v10009510mg [Capsella rubella]
Length=366

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK+NPVLAKMVISG+VYS+GDWIAQCYEGKP
Sbjct  148  IDHDYWHGWTLFEILRYAPQHNWVAYEEALKQNPVLAKMVISGIVYSVGDWIAQCYEGKP  207

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQTVWSAIWNS
Sbjct  208  LFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVAFDQTVWSAIWNS  267

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLRLESP SIF ELKATF+PMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVE
Sbjct  268  IYFTVLGFLRLESPISIFKELKATFFPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVE  327

Query  378  LIWVTILSTYSNEKSEAR  325
            LIWVTILSTYSNEKSEAR
Sbjct  328  LIWVTILSTYSNEKSEAR  345



>ref|XP_006841712.1| hypothetical protein AMTR_s00003p00254020 [Amborella trichopoda]
 gb|ERN03387.1| hypothetical protein AMTR_s00003p00254020 [Amborella trichopoda]
Length=367

 Score =   387 bits (995),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 182/212 (86%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK NPVLAKMVISGVVYSLGDWIAQC EGKP
Sbjct  152  IDHDYWHGWTLFEILRYAPQHNWIAYEEALKTNPVLAKMVISGVVYSLGDWIAQCCEGKP  211

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKV FDQT W+A+WNS
Sbjct  212  LFEFDRARMFRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVLFDQTAWAAVWNS  271

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            +Y+ V+G LR ESP +IF ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  272  VYYVVVGLLRFESPANIFGELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  331

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            LIWVTILSTYSNEKSEAR SE   E  +   S
Sbjct  332  LIWVTILSTYSNEKSEARHSEALSEPNAKSSS  363



>ref|XP_010675607.1| PREDICTED: protein SYM1-like [Beta vulgaris subsp. vulgaris]
Length=337

 Score =   386 bits (992),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWT++EILRYAPQHNWSAYEE LK NPV AKMVISGVVYS+GDWIAQCYEGKP
Sbjct  124  IDHDYWHGWTVYEILRYAPQHNWSAYEELLKTNPVFAKMVISGVVYSVGDWIAQCYEGKP  183

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDR RM RSGL GF LHGSLSHYYY  CEALFPF  WWVVP KVAFDQT+WSAIWNS
Sbjct  184  LFDFDRTRMVRSGLAGFALHGSLSHYYYEVCEALFPFQGWWVVPLKVAFDQTIWSAIWNS  243

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLG +RLESP SIF ELKATFWP+LTAGWKLWPFAHL+TYG+IPVEQRLLWVDCVE
Sbjct  244  IYFIVLGLMRLESPISIFKELKATFWPLLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCVE  303

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            LIWVTILSTYSNEKSEAR+SE S E+T + PS
Sbjct  304  LIWVTILSTYSNEKSEARLSEASSESTISDPS  335



>ref|XP_006451942.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 ref|XP_006451943.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 ref|XP_006451946.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65182.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65183.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65186.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=368

 Score =   387 bits (995),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEI+RYAP HNW+AYE ALK NPVLAKMVISGVVYSLGDWIAQC+EGKP
Sbjct  151  IDQDYWHGWTIFEIVRYAPLHNWTAYEAALKTNPVLAKMVISGVVYSLGDWIAQCFEGKP  210

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WNS
Sbjct  211  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWNS  270

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVE
Sbjct  271  IYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVE  330

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  331  LIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  367



>ref|XP_006447327.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
 ref|XP_006491636.1| PREDICTED: uncharacterized protein LOC102614505 isoform X1 [Citrus 
sinensis]
 gb|ESR60567.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
Length=346

 Score =   386 bits (992),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM ISG+VY +GDWIAQCYEGKP
Sbjct  130  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMAISGIVYFIGDWIAQCYEGKP  189

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FD  RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVW+A+WNS
Sbjct  190  LFDFDLQRMFRSGLVGFTLHGSLSHYYYKFCEALFPFQDWWVVPAKVAFDQTVWAAVWNS  249

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLR ES  +IFSELK+TFWPMLTAGWKLWPFAHL+TY VIPVEQRLLWVDCVE
Sbjct  250  IYFVVLGFLRFESAANIFSELKSTFWPMLTAGWKLWPFAHLVTYSVIPVEQRLLWVDCVE  309

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVG  277
            LIWVTILSTYSNEKSEARI E + EA S+  S+ 
Sbjct  310  LIWVTILSTYSNEKSEARILEATTEANSDSSSIS  343



>gb|KDO40771.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=346

 Score =   386 bits (992),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 177/214 (83%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM ISG+VY +GDWIAQCYEGKP
Sbjct  130  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMAISGIVYFIGDWIAQCYEGKP  189

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FD  RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVW+A+WNS
Sbjct  190  LFDFDLQRMFRSGLVGFTLHGSLSHYYYKFCEALFPFQDWWVVPAKVAFDQTVWAAVWNS  249

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLR ES  +IFSELK+TFWPMLTAGWKLWPFAHL+TY VIPVEQRLLWVDCVE
Sbjct  250  IYFVVLGFLRFESAANIFSELKSTFWPMLTAGWKLWPFAHLVTYSVIPVEQRLLWVDCVE  309

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVG  277
            LIWVTILSTYSNEKSEARI E + EA S+  S+ 
Sbjct  310  LIWVTILSTYSNEKSEARILEATTEANSDSSSIS  343



>ref|XP_011085340.1| PREDICTED: peroxisomal membrane protein 2 [Sesamum indicum]
Length=333

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 196/212 (92%), Gaps = 1/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+E+LRYAP+HNW+AYEEALK +PVLAKM+ISG+VYSLGDWIAQCYEGKP
Sbjct  119  IDHDYWHGWTLYEVLRYAPEHNWNAYEEALKTHPVLAKMMISGIVYSLGDWIAQCYEGKP  178

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCEALFP  DWWVVPAKVAFDQ+VW+A+WNS
Sbjct  179  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPSKDWWVVPAKVAFDQSVWAAVWNS  238

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+  LGFLRLESP +IF ELK+TFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  239  IYYVALGFLRLESPVNIFGELKSTFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  298

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            +IWVTILSTYSNEKSE R+SE S +A + P S
Sbjct  299  IIWVTILSTYSNEKSEMRMSEAS-DAEAGPSS  329



>ref|XP_010500911.1| PREDICTED: mpv17-like protein [Camelina sativa]
Length=370

 Score =   386 bits (992),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK+NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  152  IDHDYWHGWTLFEILRYAPQHNWIAYEEALKQNPVLAKMVISGVVYSVGDWIAQCYEGKP  211

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQTVWSAIWNS
Sbjct  212  LFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVAFDQTVWSAIWNS  271

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCVE
Sbjct  272  IYFTVLGFLRFESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCVE  331

Query  378  LIWVTILSTYSNEKSEARI  322
            LIWVTILSTYSNEKSE RI
Sbjct  332  LIWVTILSTYSNEKSETRI  350



>ref|XP_006451944.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65184.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=380

 Score =   386 bits (991),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/217 (82%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEI+RYAP HNW+AYE ALK NPVLAKMVISGVVYSLGDWIAQC+EGKP
Sbjct  151  IDQDYWHGWTIFEIVRYAPLHNWTAYEAALKTNPVLAKMVISGVVYSLGDWIAQCFEGKP  210

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WNS
Sbjct  211  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWNS  270

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVE
Sbjct  271  IYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVE  330

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  331  LIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  367



>ref|XP_011039751.1| PREDICTED: protein SYM1 isoform X1 [Populus euphratica]
Length=352

 Score =   384 bits (987),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  133  IDHDYWHGWTLYEILRYLPEHNWIAYEQALKANPVLAKMAISGIVYSIGDWIAQCYEGKP  192

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR R FRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVW+A+WNS
Sbjct  193  IFEFDRTRTFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWAAVWNS  252

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+  +G LR ESP +IFSELKATFW MLTAGWKLWPFAHLITYGVIP+EQRLLWVDCVE
Sbjct  253  IYYVAIGLLRFESPDNIFSELKATFWLMLTAGWKLWPFAHLITYGVIPLEQRLLWVDCVE  312

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN  292
            LIWVTILSTYSNEKSEARIS+ ++EA S+
Sbjct  313  LIWVTILSTYSNEKSEARISDTTLEANSS  341



>gb|KHG05370.1| Peroxisomal membrane 2 [Gossypium arboreum]
Length=362

 Score =   385 bits (988),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 196/217 (90%), Gaps = 4/217 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+E+LRY P+HNW AYE+ALK NPV+AKM ISG+VYS+GDWIAQCYEGKP
Sbjct  132  IDHDYWHGWTLYEVLRYVPEHNWIAYEQALKANPVIAKMAISGIVYSIGDWIAQCYEGKP  191

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDR RMFRSGL GFTLHGSLSH+YY FCEALFPF+DWWVVPAKV FDQTVW+AIWNS
Sbjct  192  LFDFDRTRMFRSGLVGFTLHGSLSHHYYQFCEALFPFNDWWVVPAKVIFDQTVWAAIWNS  251

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLGFLR ES  +I+ ELKATFWPMLTAGWKLWPFAH+ITYGVIPVEQRLLWVDCVE
Sbjct  252  IYYVVLGFLRFESSANIYKELKATFWPMLTAGWKLWPFAHVITYGVIPVEQRLLWVDCVE  311

Query  378  LIWVTILSTYSNEKSEARISEESVEATS----NPPSV  280
            LIWVTILSTYSNEKSEARI+E  ++A S    NPP V
Sbjct  312  LIWVTILSTYSNEKSEARITEPMMDADSNSLNNPPEV  348



>ref|XP_006371588.1| hypothetical protein POPTR_0019s13430g [Populus trichocarpa]
 gb|ERP49385.1| hypothetical protein POPTR_0019s13430g [Populus trichocarpa]
Length=349

 Score =   383 bits (984),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  133  IDHDYWHGWTLYEILRYLPEHNWIAYEQALKANPVLAKMAISGMVYSIGDWIAQCYEGKP  192

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR R FRSGL GF+LHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVW+A+WNS
Sbjct  193  IFEFDRTRTFRSGLVGFSLHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWAALWNS  252

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+  LG LR ESP +IFSELKATFW MLTAGWKLWPFAHLITYGVIP+EQRLLWVDCVE
Sbjct  253  IYYVALGLLRFESPDNIFSELKATFWLMLTAGWKLWPFAHLITYGVIPLEQRLLWVDCVE  312

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN  292
            LIWVTILSTYSNEKSEARIS+ ++EA S+
Sbjct  313  LIWVTILSTYSNEKSEARISDTTLEANSS  341



>ref|XP_010479814.1| PREDICTED: uncharacterized protein LOC104758621 [Camelina sativa]
Length=367

 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK+NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  149  IDHDYWHGWTLFEILRYAPQHNWIAYEEALKQNPVLAKMVISGVVYSVGDWIAQCYEGKP  208

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KV +DQTVWSAIWNS
Sbjct  209  LFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVVYDQTVWSAIWNS  268

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ESP SIF ELKATF+PMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  269  IYFTVLGFLRFESPLSIFKELKATFFPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  328

Query  378  LIWVTILSTYSNEKSEAR  325
            LIWVTILSTYSNEKSE R
Sbjct  329  LIWVTILSTYSNEKSETR  346



>ref|XP_010462139.1| PREDICTED: uncharacterized protein LOC104742787 [Camelina sativa]
Length=370

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK+NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  152  IDHDYWHGWTLFEILRYAPQHNWIAYEEALKQNPVLAKMVISGVVYSVGDWIAQCYEGKP  211

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQTVWSAIWNS
Sbjct  212  LFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVAFDQTVWSAIWNS  271

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ESP SI  ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCVE
Sbjct  272  IYFTVLGFLRFESPLSIVKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCVE  331

Query  378  LIWVTILSTYSNEKSEARI  322
            LIWVTILSTYSNEKSE RI
Sbjct  332  LIWVTILSTYSNEKSETRI  350



>gb|EMT03498.1| Peroxisomal membrane protein 2 [Aegilops tauschii]
Length=237

 Score =   378 bits (970),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  25   VDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKP  84

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR RMFRSGL GFTLHGSLSHYYYHFCE+LFPF DWW VP KVAFDQT WSA+WNS
Sbjct  85   IFEFDRTRMFRSGLVGFTLHGSLSHYYYHFCESLFPFKDWWAVPVKVAFDQTAWSALWNS  144

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF  LGFLR ESP++I+ ELKATF+PMLTAGWKLWPFAHLITYGV+P+EQRLLWVDCVE
Sbjct  145  IYFVALGFLRWESPSTIYKELKATFFPMLTAGWKLWPFAHLITYGVVPIEQRLLWVDCVE  204

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            LIWVTILSTYSNEKSEARI ++S    +   S
Sbjct  205  LIWVTILSTYSNEKSEARILDDSSTTDTQDNS  236



>ref|XP_007043533.1| Peroxisomal membrane 22 kDa family protein [Theobroma cacao]
 gb|EOX99364.1| Peroxisomal membrane 22 kDa family protein [Theobroma cacao]
Length=451

 Score =   385 bits (989),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 192/215 (89%), Gaps = 4/215 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFE+ RY P+HNW AYE+ALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  235  IDHDYWHGWTLFEVFRYVPEHNWIAYEQALKANPVLAKMTISGIVYSIGDWIAQCYEGKP  294

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDR RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKV FDQTVW+AIWNS
Sbjct  295  LFDFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVVFDQTVWAAIWNS  354

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLGFLR ES  +I+ ELKATFWPMLTAGWKLWPFAH+ITYGVIPVEQRLLWVDCVE
Sbjct  355  IYYVVLGFLRFESSANIYRELKATFWPMLTAGWKLWPFAHMITYGVIPVEQRLLWVDCVE  414

Query  378  LIWVTILSTYSNEKSEARI----SEESVEATSNPP  286
            LIWVTILSTYSNEKSEARI     EE   ++SNPP
Sbjct  415  LIWVTILSTYSNEKSEARILDARLEEDSSSSSNPP  449



>dbj|BAJ94190.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   380 bits (977),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  127  VDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKP  186

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR RMFRSGL GFTLHGSLSHYYYHFCE+LFPF DWW VP KVAFDQT WSA+WNS
Sbjct  187  IFEFDRTRMFRSGLVGFTLHGSLSHYYYHFCESLFPFKDWWAVPVKVAFDQTAWSALWNS  246

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF  LGFLR ESP +IFSELKATF+PMLTAGWKLWPFAHLITYGV+P+EQRLLWVDCVE
Sbjct  247  IYFVALGFLRWESPFTIFSELKATFFPMLTAGWKLWPFAHLITYGVVPIEQRLLWVDCVE  306

Query  378  LIWVTILSTYSNEKSEARISEES  310
            LIWVTILSTYSNEKSEARI ++S
Sbjct  307  LIWVTILSTYSNEKSEARILDDS  329



>ref|XP_002891718.1| hypothetical protein ARALYDRAFT_474411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67977.1| hypothetical protein ARALYDRAFT_474411 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWH WTL EILRYAPQHNW AYEEALK+NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  142  IDHDYWHVWTLLEILRYAPQHNWIAYEEALKQNPVLAKMVISGVVYSVGDWIAQCYEGKP  201

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KV FDQTVWSAIWNS
Sbjct  202  LFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVVFDQTVWSAIWNS  261

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCVE
Sbjct  262  IYFTVLGFLRFESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCVE  321

Query  378  LIWVTILSTYSNEKSEARI  322
            LIWVTILSTYSNEKSEARI
Sbjct  322  LIWVTILSTYSNEKSEARI  340



>ref|XP_004487310.1| PREDICTED: protein SYM1-like isoform X1 [Cicer arietinum]
Length=359

 Score =   379 bits (974),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE++LK NPVLAKM ISGVVYS+GDWIAQCY GKP
Sbjct  105  IDHDYWHGWTLYEILRYVPEHNWIAYEQSLKANPVLAKMAISGVVYSIGDWIAQCYGGKP  164

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  WWVVPAKVAFDQTVWSAIWNS
Sbjct  165  IFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWWVVPAKVAFDQTVWSAIWNS  224

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLG LRL+S T I+ ELK+TFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  225  IYFVVLGLLRLDSFTDIYGELKSTFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  284

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            LIWVTILSTYSNE S++R SEE  E  S+  S
Sbjct  285  LIWVTILSTYSNENSQSRKSEEVSETMSSTSS  316



>ref|XP_010657274.1| PREDICTED: mpv17-like protein [Vitis vinifera]
 emb|CBI28907.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   379 bits (974),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+E+LRYAP+HNW AYEEALK NPVLAKM ISG VYS+GDWIAQCYEGKP
Sbjct  142  IDHDYWHGWTLYEVLRYAPEHNWVAYEEALKTNPVLAKMAISGAVYSIGDWIAQCYEGKP  201

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFD  RM RSGL GF+LHGSLSHYYY FCEALFP  DWWVVPAKV  DQTVW+AIWNS
Sbjct  202  LFEFDLTRMLRSGLVGFSLHGSLSHYYYQFCEALFPSKDWWVVPAKVVVDQTVWAAIWNS  261

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+  LGFLR ESP +I+ E+K+TFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  262  IYYVALGFLRRESPANIYGEVKSTFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  321

Query  378  LIWVTILSTYSNEKSEARISEESVEATS  295
            LIWVTILSTYSNEKSEARI+E + EA S
Sbjct  322  LIWVTILSTYSNEKSEARITEATQEANS  349



>ref|XP_010522636.1| PREDICTED: protein SYM1 [Tarenaya hassleriana]
Length=316

 Score =   377 bits (969),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 190/212 (90%), Gaps = 4/212 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM ISG+VY+LGDWIAQCY+GKP
Sbjct  103  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKTNPVLAKMAISGIVYALGDWIAQCYKGKP  162

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQT WSA+WN+
Sbjct  163  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTAWSAVWNT  222

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LR ESP +IFSE+K TFWPMLTAGWKLWP AHLITYGVIP++QRLLWVDC+E
Sbjct  223  IYYVVLGLLRFESPANIFSEIKTTFWPMLTAGWKLWPLAHLITYGVIPIDQRLLWVDCIE  282

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            LIWVTILSTYSNE S+AR S    EA S+PPS
Sbjct  283  LIWVTILSTYSNENSKARTS----EAKSSPPS  310



>ref|XP_010051673.1| PREDICTED: uncharacterized protein LOC104440441 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010051678.1| PREDICTED: uncharacterized protein LOC104440441 isoform X1 [Eucalyptus 
grandis]
 gb|KCW89498.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
 gb|KCW89499.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
 gb|KCW89500.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
Length=350

 Score =   379 bits (972),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YW GWTL+E+LRYAP+HNW AYE+ALK NPVLAKM ISGVVYSLGDWIAQCYEGKP
Sbjct  141  VDHDYWQGWTLYEVLRYAPEHNWIAYEQALKTNPVLAKMAISGVVYSLGDWIAQCYEGKP  200

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFD  RMFRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKV FDQTVW+A+WNS
Sbjct  201  LFEFDPLRMFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVVFDQTVWAAVWNS  260

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ +LG LRLESP +I +ELKATFWPMLTAGWKLWPFAHL+TYGVIP+EQRLLWVDCVE
Sbjct  261  IYYVMLGLLRLESPANILNELKATFWPMLTAGWKLWPFAHLVTYGVIPIEQRLLWVDCVE  320

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNP  289
            LIWVTILS YSN KSEARISE S   + +P
Sbjct  321  LIWVTILSNYSNGKSEARISETSESNSGSP  350



>ref|XP_004248154.1| PREDICTED: protein SYM1 [Solanum lycopersicum]
 ref|XP_010327063.1| PREDICTED: protein SYM1 [Solanum lycopersicum]
Length=335

 Score =   378 bits (971),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH YWHGWTL+EILRYAP+HNW AYEEALK NPVLAKM ISG+VYS+GDW AQCYEGKP
Sbjct  118  IDHEYWHGWTLYEILRYAPEHNWIAYEEALKANPVLAKMAISGIVYSVGDWTAQCYEGKP  177

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GF+LHGSLSHYYY FCEALFP +DWWVVPAKVAFDQT+WSAIWNS
Sbjct  178  LLEFDRTRMFRSGLVGFSLHGSLSHYYYQFCEALFPSNDWWVVPAKVAFDQTIWSAIWNS  237

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLES ++IF EL+ATF PMLTAGWKLWPFAHLITYGVIP+EQRLLWVDCVE
Sbjct  238  IYFVVLGFLRLESASNIFGELRATFLPMLTAGWKLWPFAHLITYGVIPLEQRLLWVDCVE  297

Query  378  LIWVTILSTYSNEKSEARI  322
            L+WVTILSTYSNEKSEARI
Sbjct  298  LVWVTILSTYSNEKSEARI  316



>ref|XP_004487311.1| PREDICTED: protein SYM1-like isoform X2 [Cicer arietinum]
Length=321

 Score =   377 bits (968),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE++LK NPVLAKM ISGVVYS+GDWIAQCY GKP
Sbjct  105  IDHDYWHGWTLYEILRYVPEHNWIAYEQSLKANPVLAKMAISGVVYSIGDWIAQCYGGKP  164

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  WWVVPAKVAFDQTVWSAIWNS
Sbjct  165  IFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWWVVPAKVAFDQTVWSAIWNS  224

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLG LRL+S T I+ ELK+TFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  225  IYFVVLGLLRLDSFTDIYGELKSTFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  284

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            LIWVTILSTYSNE S++R SEE  E  S+  S
Sbjct  285  LIWVTILSTYSNENSQSRKSEEVSETMSSTSS  316



>gb|EMS63851.1| Peroxisomal membrane protein 2 [Triticum urartu]
Length=238

 Score =   374 bits (960),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  25   VDQDYWHGWTIFEILRYMPEHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQCYEGKP  84

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR RMFRSGL GFTLHGSLSHYYYHFCE+LFPF DWW VP KVAFDQT WSA+WNS
Sbjct  85   IFEFDRTRMFRSGLVGFTLHGSLSHYYYHFCESLFPFKDWWAVPVKVAFDQTAWSALWNS  144

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF  LGFLR ESP++I+ ELKATF+PMLTAGWKLWPFAHLITYGV+P+EQRLLWVD VE
Sbjct  145  IYFVALGFLRWESPSTIYKELKATFFPMLTAGWKLWPFAHLITYGVVPIEQRLLWVDSVE  204

Query  378  LIWVTILSTYSNEKSEARISEES  310
            LIWVTILSTYSNEKSEARI ++S
Sbjct  205  LIWVTILSTYSNEKSEARILDDS  227



>gb|KJB62727.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=313

 Score =   376 bits (966),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 191/212 (90%), Gaps = 1/212 (0%)
 Frame = -1

Query  900  HGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDR  721
             GWT++EI+RYAPQHNWSAYEEAL+ NPVLAKMVISG+VYS+GDWIAQC+EGKPLFEFDR
Sbjct  100  QGWTIYEIVRYAPQHNWSAYEEALRTNPVLAKMVISGIVYSIGDWIAQCFEGKPLFEFDR  159

Query  720  ARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVL  541
             RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WNSIYF VL
Sbjct  160  MRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWNSIYFVVL  219

Query  540  GFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTI  361
            GFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCVELIWVTI
Sbjct  220  GFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCVELIWVTI  279

Query  360  LSTYSNEKSEARISEES-VEATSNPPSVGPSQ  268
            LSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  280  LSTYSNEKSEARISEAAPAEASSILPPVGPPE  311



>ref|XP_002874865.1| hypothetical protein ARALYDRAFT_490222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51124.1| hypothetical protein ARALYDRAFT_490222 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   377 bits (967),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YW GWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISG+VYSLGDWIAQCYEGKP
Sbjct  101  IDHDYWQGWTLYEILRYAPEHNWVAYEQILKTNPVLAKMAISGIVYSLGDWIAQCYEGKP  160

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRAR+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQT+WSAIWNS
Sbjct  161  LFEFDRARVLRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTIWSAIWNS  220

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLG LR +SP  IFSE+K TFWPMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  221  IYFTVLGLLRFQSPADIFSEIKTTFWPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  280

Query  378  LIWVTILSTYSNEKSEARISEES  310
            LIWVTILSTYSNEK+EA+ S E+
Sbjct  281  LIWVTILSTYSNEKAEAQASGET  303



>gb|ABR17136.1| unknown [Picea sitchensis]
Length=294

 Score =   374 bits (961),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EI+RYAP HNW+AYEEALK NPVLAKMVISG VYSLGDWIAQCYEGK 
Sbjct  74   IDHDYWHGWTLYEIVRYAPVHNWTAYEEALKTNPVLAKMVISGAVYSLGDWIAQCYEGKQ  133

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEF+R RMFRSGL GF+LHGSLSHYYY  CEALFPF  WWVVPAKVAFDQT+W+A+WNS
Sbjct  134  LFEFNRIRMFRSGLVGFSLHGSLSHYYYQLCEALFPFQGWWVVPAKVAFDQTIWAAVWNS  193

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLG LR ESP +IF ELKATFWP+LTAGWKLWPFAHLITYGV+PVEQRLLWVDCVE
Sbjct  194  IYFTVLGLLRFESPANIFGELKATFWPLLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVE  253

Query  378  LIWVTILSTYSNEKSEARISE  316
            LIWVTILSTYSNEKSEAR  E
Sbjct  254  LIWVTILSTYSNEKSEARSLE  274



>emb|CDP14740.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   375 bits (964),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH YWHGWTL+E+L+ AP+HNW AYEEALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  123  IDHEYWHGWTLYEVLKNAPEHNWIAYEEALKSNPVLAKMTISGIVYSVGDWIAQCYEGKP  182

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+FRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKV  DQT+WSA+WNS
Sbjct  183  LFEFDRQRIFRSGLVGFTLHGSLSHYYYQFCEALFPFNDWWVVPAKVVVDQTLWSAVWNS  242

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLGFLR ES  SIF ELK+TFWPMLTAGWKLWPFAH+ITYGVIPVEQRLLWVDC+E
Sbjct  243  IYYVVLGFLRSESSASIFDELKSTFWPMLTAGWKLWPFAHVITYGVIPVEQRLLWVDCME  302

Query  378  LIWVTILSTYSNEKSEARISEESVEATS  295
            LIWVTILS +SNEKSEAR+SE + + +S
Sbjct  303  LIWVTILSGFSNEKSEARLSEAAEDDSS  330



>ref|XP_008455339.1| PREDICTED: mpv17-like protein [Cucumis melo]
Length=352

 Score =   376 bits (965),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 184/212 (87%), Gaps = 0/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH  WHGWTL+E+LRYAP+HNW AYEEALK NPVLAKM+ISG+VY LGDWIAQCYEGKP
Sbjct  133  IDHELWHGWTLYEVLRYAPEHNWIAYEEALKTNPVLAKMMISGIVYFLGDWIAQCYEGKP  192

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GF+LHGSLSHYYY FCE LFPF DWWVVP KVAFDQTVWS +WNS
Sbjct  193  LFEFDRARMFRSGLVGFSLHGSLSHYYYQFCEILFPFKDWWVVPVKVAFDQTVWSGVWNS  252

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LR ES   I+ ELK+TFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  253  IYYVVLGILRSESMNDIYGELKSTFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  312

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            LIWVTILSTYSNEKSE RI E S       PS
Sbjct  313  LIWVTILSTYSNEKSEGRIGEASTGENEASPS  344



>ref|XP_003543349.1| PREDICTED: peroxisomal membrane protein 2 [Glycine max]
Length=322

 Score =   374 bits (961),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEI+RY P+HNW AYE+ALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  106  IDHDYWHGWTLFEIVRYIPEHNWIAYEQALKANPVLAKMAISGIVYSIGDWIAQCYEGKP  165

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGSLSHYYY  CEALFPF +WWVVPAKVAFDQTVWSAIWNS
Sbjct  166  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQLCEALFPFQEWWVVPAKVAFDQTVWSAIWNS  225

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLG LR ES T+I+ ELK+TF P+LTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  226  IYFVVLGLLRFESLTNIYGELKSTFLPLLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  285

Query  378  LIWVTILSTYSNEKSEARISEES  310
            LIWVTILSTYSNEKSEARISE +
Sbjct  286  LIWVTILSTYSNEKSEARISEAA  308



>ref|XP_010095804.1| Protein SYM1 [Morus notabilis]
 gb|EXB62272.1| Protein SYM1 [Morus notabilis]
Length=349

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 188/199 (94%), Gaps = 0/199 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+E+LRYAP+HNW AYE+ALK NPVLAKM+ISGVVY++GDWIAQCYEGKP
Sbjct  134  IDHDYWHGWTLYEVLRYAPEHNWIAYEQALKANPVLAKMMISGVVYAIGDWIAQCYEGKP  193

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEF+R R+FRSGL GF LHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVW+A+WNS
Sbjct  194  LFEFERTRVFRSGLVGFALHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWAAVWNS  253

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LR ESP +I SELKATFWP+LTAGWKLWPFAHLITYGVIP+EQRLLWVDCVE
Sbjct  254  IYYFVLGLLRFESPANILSELKATFWPLLTAGWKLWPFAHLITYGVIPIEQRLLWVDCVE  313

Query  378  LIWVTILSTYSNEKSEARI  322
            LIWVTILSTYSNEKSE+RI
Sbjct  314  LIWVTILSTYSNEKSESRI  332



>gb|KEH39092.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=318

 Score =   374 bits (960),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EIL+Y P+HNW AYE++LK NPVLAKM ISGVVYS+GDWIAQCYEGKP
Sbjct  101  IDHDYWHGWTLYEILKYVPEHNWIAYEQSLKANPVLAKMAISGVVYSIGDWIAQCYEGKP  160

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  WWVVPAKVAFDQTVWSAIWN+
Sbjct  161  IFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWWVVPAKVAFDQTVWSAIWNT  220

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLG LR +S  +I+ ELK+TF PMLTAGWKLWPFAHLITYGV+PVEQRLLWVDC+E
Sbjct  221  IYFVVLGLLRFDSLDNIYGELKSTFLPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCIE  280

Query  378  LIWVTILSTYSNEKSEARISEESVE-ATSNPPS  283
            LIWVTILSTYSNEKSE+R SEE  E A S+ PS
Sbjct  281  LIWVTILSTYSNEKSESRKSEEVSETAGSSTPS  313



>ref|NP_974505.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
 gb|AEE82316.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
Length=361

 Score =   375 bits (964),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YW GWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISG+VYSLGDWIAQCYEGKP
Sbjct  106  IDHDYWQGWTLYEILRYAPEHNWFAYEQILKTNPVLAKMAISGIVYSLGDWIAQCYEGKP  165

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWNS
Sbjct  166  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWNS  225

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLG LR +SP  IFSE+K TF PMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  226  IYFTVLGLLRFQSPADIFSEIKTTFLPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  285

Query  378  LIWVTILSTYSNEKSEARISEES  310
            LIWVTILSTYSNEK+EA+ SEE+
Sbjct  286  LIWVTILSTYSNEKAEAQASEET  308



>ref|XP_009134349.1| PREDICTED: protein SYM1 [Brassica rapa]
Length=317

 Score =   374 bits (960),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 188/210 (90%), Gaps = 1/210 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISGVVYSLGDWIAQCYEGKP
Sbjct  108  IDHDYWHGWTLYEILRYAPEHNWVAYEQILKTNPVLAKMAISGVVYSLGDWIAQCYEGKP  167

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVWSAIWN+
Sbjct  168  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTVWSAIWNT  227

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TVLG LR +SP  +F E+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  228  IYYTVLGLLRFQSPAKVFGEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  287

Query  378  LIWVTILSTYSNEKSEAR-ISEESVEATSN  292
            LIWVTILSTYSNEK+EA+ I E +  +T +
Sbjct  288  LIWVTILSTYSNEKAEAQTIGETNSSSTED  317



>gb|KHN36615.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=409

 Score =   377 bits (968),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEI+RY P+HNW AYE+ALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  106  IDHDYWHGWTLFEIVRYIPEHNWIAYEQALKANPVLAKMAISGIVYSIGDWIAQCYEGKP  165

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGSLSHYYY  CEALFPF +WWVVPAKVAFDQTVWSAIWNS
Sbjct  166  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQLCEALFPFQEWWVVPAKVAFDQTVWSAIWNS  225

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLG LR ES T+I+ ELK+TF P+LTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  226  IYFVVLGLLRFESLTNIYGELKSTFLPLLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  285

Query  378  LIWVTILSTYSNEKSEARISEES  310
            LIWVTILSTYSNEKSEARISE +
Sbjct  286  LIWVTILSTYSNEKSEARISEAA  308



>ref|NP_192250.2| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
 gb|AAU94426.1| At4g03410 [Arabidopsis thaliana]
 gb|AEE82315.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
Length=317

 Score =   374 bits (959),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YW GWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISG+VYSLGDWIAQCYEGKP
Sbjct  106  IDHDYWQGWTLYEILRYAPEHNWFAYEQILKTNPVLAKMAISGIVYSLGDWIAQCYEGKP  165

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWNS
Sbjct  166  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWNS  225

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLG LR +SP  IFSE+K TF PMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  226  IYFTVLGLLRFQSPADIFSEIKTTFLPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  285

Query  378  LIWVTILSTYSNEKSEARISEES  310
            LIWVTILSTYSNEK+EA+ SEE+
Sbjct  286  LIWVTILSTYSNEKAEAQASEET  308



>ref|XP_006396570.1| hypothetical protein EUTSA_v10028802mg [Eutrema salsugineum]
 gb|ESQ38023.1| hypothetical protein EUTSA_v10028802mg [Eutrema salsugineum]
Length=323

 Score =   374 bits (959),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISG+VYSLGDWIAQCYEGKP
Sbjct  112  IDHDYWHGWTLYEILRYAPEHNWVAYEQILKTNPVLAKMAISGIVYSLGDWIAQCYEGKP  171

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWN+
Sbjct  172  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWNT  231

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLG LR +SP  +FSE+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  232  IYFTVLGLLRFQSPAEVFSEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  291

Query  378  LIWVTILSTYSNEKSEARISEESVEAT  298
            LIWVTILSTYSNEK+EA+   E+  +T
Sbjct  292  LIWVTILSTYSNEKAEAQALGETSSST  318



>gb|KEH39090.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=344

 Score =   374 bits (961),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EIL+Y P+HNW AYE++LK NPVLAKM ISGVVYS+GDWIAQCYEGKP
Sbjct  101  IDHDYWHGWTLYEILKYVPEHNWIAYEQSLKANPVLAKMAISGVVYSIGDWIAQCYEGKP  160

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  WWVVPAKVAFDQTVWSAIWN+
Sbjct  161  IFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWWVVPAKVAFDQTVWSAIWNT  220

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLG LR +S  +I+ ELK+TF PMLTAGWKLWPFAHLITYGV+PVEQRLLWVDC+E
Sbjct  221  IYFVVLGLLRFDSLDNIYGELKSTFLPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCIE  280

Query  378  LIWVTILSTYSNEKSEARISEESVE-ATSNPPS  283
            LIWVTILSTYSNEKSE+R SEE  E A S+ PS
Sbjct  281  LIWVTILSTYSNEKSESRKSEEVSETAGSSTPS  313



>emb|CDY48204.1| BnaCnng15950D [Brassica napus]
Length=331

 Score =   373 bits (958),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISGVVYSLGDWIAQCYEGKP
Sbjct  110  IDHDYWHGWTLYEILRYAPEHNWVAYEQILKTNPVLAKMAISGVVYSLGDWIAQCYEGKP  169

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVWSAIWN+
Sbjct  170  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTVWSAIWNT  229

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TVLG LR +SP  IF E+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  230  IYYTVLGLLRFQSPDKIFGEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  289

Query  378  LIWVTILSTYSNEKSEARISEESVEATS  295
            LIWVTILSTYSNEK+EA+   E+  +++
Sbjct  290  LIWVTILSTYSNEKAEAQTMGETNSSST  317



>ref|XP_004487676.1| PREDICTED: uncharacterized protein LOC101505712 [Cicer arietinum]
Length=366

 Score =   374 bits (961),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT++EI+RYAPQHNWSAYEEALK NPV AKMVISGVVYS+GDWIAQC+EGKP
Sbjct  154  IDSDYWHGWTIYEIVRYAPQHNWSAYEEALKTNPVFAKMVISGVVYSVGDWIAQCFEGKP  213

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSG+ GF LHGSLSHYYY FCE LFP+ +WWVVP KVAFDQT WSA+WNS
Sbjct  214  LFEFDRARMFRSGIVGFALHGSLSHYYYQFCEELFPYKEWWVVPVKVAFDQTAWSAVWNS  273

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TV+G LRL+SP +IF+EL ATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD +E
Sbjct  274  IYYTVVGLLRLDSPINIFNELTATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDMIE  333

Query  378  LIWVTILSTYSNEKSEARISEESVEATS  295
            LIWVTILSTYSNEKSEARIS    +  S
Sbjct  334  LIWVTILSTYSNEKSEARISSVPADVNS  361



>ref|XP_009623041.1| PREDICTED: protein SYM1 [Nicotiana tomentosiformis]
Length=340

 Score =   374 bits (959),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWT +EILRYAP+HNW AYEEALK NPVLAKM ISG+VY+LGDWIAQCYEGKP
Sbjct  123  IDHDYWHGWTFYEILRYAPEHNWIAYEEALKTNPVLAKMAISGIVYALGDWIAQCYEGKP  182

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GF+LHGSLSHYYY FCEALFP +DWW+VP KVAFDQT+W+A+WNS
Sbjct  183  LLEFDRTRMFRSGLVGFSLHGSLSHYYYQFCEALFPSNDWWMVPVKVAFDQTIWAAVWNS  242

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLGFLRLES  +IF ELK TFWPMLTAGWKLWPFAHLITYGVIP++QRLLWVDC+E
Sbjct  243  IYYVVLGFLRLESAANIFGELKTTFWPMLTAGWKLWPFAHLITYGVIPLDQRLLWVDCIE  302

Query  378  LIWVTILSTYSNEKSEARI  322
            L+WVTILSTYSNEKSEARI
Sbjct  303  LVWVTILSTYSNEKSEARI  321



>gb|KEH38794.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=367

 Score =   374 bits (961),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT++EI+RYAP HNW AYEEALK NPV AKMVISGVVYS+GDWIAQC+EGKP
Sbjct  155  IDSDYWHGWTIYEIVRYAPLHNWLAYEEALKTNPVFAKMVISGVVYSVGDWIAQCFEGKP  214

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GF LHGSLSHYYY FCE LFP+  WWVVP KVAFDQT WSA+WNS
Sbjct  215  LFEFDRARMFRSGLVGFALHGSLSHYYYQFCEELFPYKGWWVVPVKVAFDQTAWSAVWNS  274

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TV+G LR +SP +IF+ELKATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD +E
Sbjct  275  IYYTVVGILRFDSPINIFNELKATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDMIE  334

Query  378  LIWVTILSTYSNEKSEARISEESVEATS  295
            LIWVTILSTYSNEKSEAR S ES+EA S
Sbjct  335  LIWVTILSTYSNEKSEARSSSESIEAKS  362



>gb|AAP40491.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01540.1| hypothetical protein [Arabidopsis thaliana]
Length=317

 Score =   372 bits (955),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YW GWTL+EILRYAP+HNW AYE+ LK NPVL KM ISG+VYSLGDWIAQCYEGKP
Sbjct  106  IDHDYWQGWTLYEILRYAPEHNWFAYEQILKTNPVLTKMAISGIVYSLGDWIAQCYEGKP  165

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWNS
Sbjct  166  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWNS  225

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLG LR +SP  IFSE+K TF PMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  226  IYFTVLGLLRFQSPADIFSEIKTTFLPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  285

Query  378  LIWVTILSTYSNEKSEARISEES  310
            LIWVTILSTYSNEK+EA+ SEE+
Sbjct  286  LIWVTILSTYSNEKAEAQASEET  308



>gb|EYU26133.1| hypothetical protein MIMGU_mgv1a009627mg [Erythranthe guttata]
Length=336

 Score =   372 bits (956),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 171/217 (79%), Positives = 191/217 (88%), Gaps = 1/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+E+LRYAP+H+W+AYEE LK +PVL+KM ISG+VYS+GDWIAQCYEGKP
Sbjct  119  IDHDYWHGWTLYEVLRYAPEHSWNAYEETLKTHPVLSKMAISGIVYSMGDWIAQCYEGKP  178

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+ DR RMFRSGL GFTLHGSLSHYYY FCE LFP+  WWVVP KVAFDQTVWSA+WNS
Sbjct  179  LFDIDRTRMFRSGLVGFTLHGSLSHYYYQFCEVLFPYKGWWVVPVKVAFDQTVWSAVWNS  238

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VL  LRLESP  IF+EL+ATFWPMLTAGWKLWPFAH+ITYGV+PVEQRLLWVDC+E
Sbjct  239  IYFVVLALLRLESPVVIFNELRATFWPMLTAGWKLWPFAHVITYGVVPVEQRLLWVDCIE  298

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSE RIS E+ E  S  PS   S+
Sbjct  299  LIWVTILSTYSNEKSEVRIS-EAPEGESGSPSNNLSK  334



>ref|XP_003539526.1| PREDICTED: peroxisomal membrane protein 2-like [Glycine max]
Length=322

 Score =   372 bits (954),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EI+RY P+HNW AYE+ALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  106  IDHDYWHGWTLYEIVRYIPEHNWIAYEQALKANPVLAKMAISGIVYSIGDWIAQCYEGKP  165

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGSLSHYYY  CEALFPF +WWVVPAKVAFDQTVWSAIWNS
Sbjct  166  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQLCEALFPFQEWWVVPAKVAFDQTVWSAIWNS  225

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLG LR ES T+I+ ELK+TF P+LTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  226  IYFVVLGLLRFESLTNIYGELKSTFLPLLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  285

Query  378  LIWVTILSTYSNEKSEARISEES  310
            LIWVTILSTYSNEKSEARISE +
Sbjct  286  LIWVTILSTYSNEKSEARISEAA  308



>gb|KHN04274.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=332

 Score =   372 bits (954),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EI+RY P+HNW AYE+ALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  106  IDHDYWHGWTLYEIVRYIPEHNWIAYEQALKANPVLAKMAISGIVYSIGDWIAQCYEGKP  165

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGSLSHYYY  CEALFPF +WWVVPAKVAFDQTVWSAIWNS
Sbjct  166  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQLCEALFPFQEWWVVPAKVAFDQTVWSAIWNS  225

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLG LR ES T+I+ ELK+TF P+LTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE
Sbjct  226  IYFVVLGLLRFESLTNIYGELKSTFLPLLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  285

Query  378  LIWVTILSTYSNEKSEARISEES  310
            LIWVTILSTYSNEKSEARISE +
Sbjct  286  LIWVTILSTYSNEKSEARISEAA  308



>emb|CDX90887.1| BnaA03g25670D [Brassica napus]
Length=328

 Score =   371 bits (953),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISGVVYSLGDWIAQCYEGKP
Sbjct  107  IDHDYWHGWTLYEILRYAPEHNWVAYEQILKTNPVLAKMAISGVVYSLGDWIAQCYEGKP  166

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVWSAIWN+
Sbjct  167  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTVWSAIWNT  226

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TVLG LR +SP  +F E+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  227  IYYTVLGLLRFQSPAKVFGEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  286

Query  378  LIWVTILSTYSNEKSEARISEESVEATS  295
            LIWVTILSTYSNEK+EA+   E+  +++
Sbjct  287  LIWVTILSTYSNEKAEAQTIGETNSSST  314



>ref|XP_003543260.1| PREDICTED: uncharacterized protein LOC100786706 [Glycine max]
Length=376

 Score =   372 bits (956),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNWSAYEEALK NPVLAKM+ISG+VYSLGDWIAQC EGKP
Sbjct  158  IDSDYWHGWTLYEILRYAPQHNWSAYEEALKTNPVLAKMMISGIVYSLGDWIAQCVEGKP  217

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GFTLHGSLSH+YY FCE LFP+ +WWVVPAKVAFDQT WSA+WNS
Sbjct  218  LFEFDRARMFRSGLVGFTLHGSLSHFYYQFCEELFPYKEWWVVPAKVAFDQTAWSALWNS  277

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TV+  LRL+ P SI +ELKATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD +E
Sbjct  278  IYYTVVALLRLDPPMSILNELKATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDTIE  337

Query  378  LIWVTILSTYSNEKSEARISEESV  307
            LIWVTILST+SNEKSEAR S+  V
Sbjct  338  LIWVTILSTFSNEKSEARNSQSMV  361



>gb|KHN36788.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=372

 Score =   372 bits (956),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNWSAYEEALK NPVLAKM+ISG+VYSLGDWIAQC EGKP
Sbjct  154  IDSDYWHGWTLYEILRYAPQHNWSAYEEALKTNPVLAKMMISGIVYSLGDWIAQCVEGKP  213

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GFTLHGSLSH+YY FCE LFP+ +WWVVPAKVAFDQT WSA+WNS
Sbjct  214  LFEFDRARMFRSGLVGFTLHGSLSHFYYQFCEELFPYKEWWVVPAKVAFDQTAWSALWNS  273

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TV+  LRL+ P SI +ELKATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD +E
Sbjct  274  IYYTVVALLRLDPPMSILNELKATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDTIE  333

Query  378  LIWVTILSTYSNEKSEARISEESV  307
            LIWVTILST+SNEKSEAR S+  V
Sbjct  334  LIWVTILSTFSNEKSEARNSQSMV  357



>ref|XP_010422462.1| PREDICTED: LOW QUALITY PROTEIN: mpv17-like protein [Camelina 
sativa]
Length=363

 Score =   372 bits (955),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 190/218 (87%), Gaps = 6/218 (3%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YW GWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISG+VYSLGDWIAQCYEGKP
Sbjct  113  IDHDYWQGWTLYEILRYAPEHNWVAYEQILKTNPVLAKMAISGIVYSLGDWIAQCYEGKP  172

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR+R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAK+AFDQTVWSAIWNS
Sbjct  173  LFEFDRSRVVRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKIAFDQTVWSAIWNS  232

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLG LR +SP  IFSE+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  233  IYFTVLGLLRFQSPADIFSEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  292

Query  378  LIWVTILSTYSNEKSEARISEESVEATS------NPPS  283
            LIWVTILSTYSNEK+EA   E++   +S       PPS
Sbjct  293  LIWVTILSTYSNEKAEAPALEKTNSNSSEVCQLLRPPS  330



>ref|XP_003539587.1| PREDICTED: uncharacterized protein LOC100805057 [Glycine max]
Length=375

 Score =   372 bits (956),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 192/217 (88%), Gaps = 0/217 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNWSAYEEALK NPVLAKM+ISG+VYS+GDWIAQC+EGKP
Sbjct  158  IDSDYWHGWTLYEILRYAPQHNWSAYEEALKTNPVLAKMMISGIVYSIGDWIAQCFEGKP  217

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GFTLHGSLSH+YY FCE LFP+ +WWVVPAKVAFDQT WSA+WNS
Sbjct  218  LFEFDRARMFRSGLVGFTLHGSLSHFYYQFCEELFPYKEWWVVPAKVAFDQTAWSALWNS  277

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TV+  LR + P SI +ELKATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD +E
Sbjct  278  IYYTVVALLRRDPPMSILNELKATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDTIE  337

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILST+SNEKSEAR S+  V +     SV P +
Sbjct  338  LIWVTILSTFSNEKSEARNSQSMVPSEVKSTSVYPPE  374



>gb|KFK30935.1| hypothetical protein AALP_AA6G045100 [Arabis alpina]
Length=316

 Score =   370 bits (950),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YW GWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISG+VY+LGDWIAQCYEGKP
Sbjct  105  IDHDYWQGWTLYEILRYAPEHNWDAYEQILKTNPVLAKMAISGIVYALGDWIAQCYEGKP  164

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRAR+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWN+
Sbjct  165  LFEFDRARVVRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWNT  224

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LR +SP ++F E+K  FWPMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  225  IYYMVLGLLRFQSPANVFGEIKTKFWPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  284

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN  292
            LIWVTILSTYSNEK+EA   EE+  +T++
Sbjct  285  LIWVTILSTYSNEKAEAGTLEETNSSTNS  313



>ref|XP_006288235.1| hypothetical protein CARUB_v10001476mg [Capsella rubella]
 gb|EOA21133.1| hypothetical protein CARUB_v10001476mg [Capsella rubella]
Length=319

 Score =   370 bits (950),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YW GWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISG+VYSLGDWIAQCYEGKP
Sbjct  110  IDHDYWQGWTLYEILRYAPEHNWVAYEQILKTNPVLAKMAISGIVYSLGDWIAQCYEGKP  169

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR R+ RSGL GFTLHGS SHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWNS
Sbjct  170  LFEFDRTRVLRSGLVGFTLHGSFSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWNS  229

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLG LR +SP  IFSE+K TFWPMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  230  IYFTVLGLLRFQSPADIFSEIKTTFWPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  289

Query  378  LIWVTILSTYSNEKSEARISE  316
            LIWVTILSTYSNEK EA+ SE
Sbjct  290  LIWVTILSTYSNEKVEAQASE  310



>ref|XP_010455892.1| PREDICTED: protein SYM1-like [Camelina sativa]
Length=322

 Score =   370 bits (949),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YW GWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISG+VYSLGDWIAQCYEGKP
Sbjct  113  IDHDYWQGWTLYEILRYAPEHNWVAYEQILKTNPVLAKMAISGIVYSLGDWIAQCYEGKP  172

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR+R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAK+AFDQTVWSAIWNS
Sbjct  173  LFEFDRSRVVRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKIAFDQTVWSAIWNS  232

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLG LR +SP  IFSE+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+E
Sbjct  233  IYFTVLGLLRFQSPADIFSEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCIE  292

Query  378  LIWVTILSTYSNEKSEA  328
            LIWVTILSTYSNEK+EA
Sbjct  293  LIWVTILSTYSNEKAEA  309



>ref|XP_007149878.1| hypothetical protein PHAVU_005G106400g [Phaseolus vulgaris]
 gb|ESW21872.1| hypothetical protein PHAVU_005G106400g [Phaseolus vulgaris]
Length=316

 Score =   369 bits (948),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  100  IDHDYWHGWTLYEILRYIPEHNWIAYEQALKANPVLAKMAISGIVYSIGDWIAQCYEGKP  159

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRAR+ RSGL GFTLHGSLSHYYY  CEALFPF++WWVVPAKVAFDQTVWSAIWNS
Sbjct  160  LFEFDRARLLRSGLVGFTLHGSLSHYYYQLCEALFPFEEWWVVPAKVAFDQTVWSAIWNS  219

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLG LR ES T+I+ ELK+TF+P+LTAGWKLWPFAHLITYG+IPVEQRLLWVDCVE
Sbjct  220  IYFVVLGLLRFESLTNIYGELKSTFFPLLTAGWKLWPFAHLITYGLIPVEQRLLWVDCVE  279

Query  378  LIWVTILSTYSNEKSEARI  322
            L+WVTILSTYSNEKSE RI
Sbjct  280  LVWVTILSTYSNEKSETRI  298



>ref|XP_008353524.1| PREDICTED: PXMP2/4 family protein 1-like [Malus domestica]
Length=352

 Score =   370 bits (951),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPV AKMVISGVVY+LGDWIAQC+EGKP
Sbjct  135  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVFAKMVISGVVYTLGDWIAQCFEGKP  194

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVWSAIWNS
Sbjct  195  LLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWSAIWNS  254

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLR ESPT IF EL+ATF PMLTAGWKLWPFAH+ITYG+IPVEQRLLWVDCVE
Sbjct  255  IYFVVLGFLRFESPTKIFDELRATFVPMLTAGWKLWPFAHVITYGLIPVEQRLLWVDCVE  314

Query  378  LIWVTILSTYSNEKSEARI  322
            LIWVTILSTYSNEK+++ +
Sbjct  315  LIWVTILSTYSNEKADSSL  333



>ref|XP_007149619.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 ref|XP_007149620.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 gb|ESW21613.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 gb|ESW21614.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
Length=378

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 193/216 (89%), Gaps = 5/216 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNWSAYEEALK NPVLAKM+ISG+VYS+GDWIAQC+EGKP
Sbjct  160  IDSDYWHGWTLYEILRYAPQHNWSAYEEALKTNPVLAKMMISGIVYSVGDWIAQCFEGKP  219

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSG+ GFTLHGSLSHYYY+FCE LFP+ +WWVVPAKVAFDQT WSAIWNS
Sbjct  220  LFEFDRARMFRSGIVGFTLHGSLSHYYYYFCEDLFPYKEWWVVPAKVAFDQTAWSAIWNS  279

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+TV+  LRL+ P SI +ELKATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD VE
Sbjct  280  IYYTVVALLRLDPPISILNELKATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDTVE  339

Query  378  LIWVTILSTYSNEKSEARISE-----ESVEATSNPP  286
            L+WVTILST+SNEKSEA+ SE     E +  TS  P
Sbjct  340  LVWVTILSTFSNEKSEAKSSESMMPTEVISTTSVQP  375



>ref|XP_004137017.1| PREDICTED: uncharacterized protein LOC101214701 [Cucumis sativus]
 gb|KGN43598.1| hypothetical protein Csa_7G047330 [Cucumis sativus]
Length=353

 Score =   370 bits (949),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 184/212 (87%), Gaps = 0/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH  WHGWTL+E+LRYAP+HNW AYEEALK NPVLAKM+ISG+VY LGDWIAQCYEGKP
Sbjct  134  IDHELWHGWTLYEVLRYAPEHNWIAYEEALKTNPVLAKMMISGIVYFLGDWIAQCYEGKP  193

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GF+LHGSLSHYYY FCE LFPF DWWVV  KVAFDQTVWS +WNS
Sbjct  194  LFEFDRARMFRSGLVGFSLHGSLSHYYYQFCEILFPFKDWWVVLVKVAFDQTVWSGVWNS  253

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LR ES T I+ ELK+TFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVD VE
Sbjct  254  IYYVVLGILRSESMTDIYGELKSTFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDSVE  313

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            LIWVTILSTYSNEKSE RIS+ S       PS
Sbjct  314  LIWVTILSTYSNEKSEERISDASTGENEASPS  345



>ref|XP_004304121.1| PREDICTED: protein SYM1 [Fragaria vesca subsp. vesca]
Length=341

 Score =   368 bits (945),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EI++Y P+HNW AYE+AL  NPVLAKMVISGVVY+LGDWIAQCYEGKP
Sbjct  124  IDHDYWHGWTLYEIVKYVPEHNWIAYEQALNANPVLAKMVISGVVYTLGDWIAQCYEGKP  183

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GF+LHGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWNS
Sbjct  184  LLEFDRTRMFRSGLVGFSLHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWNS  243

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF  LG LR ESP  IF ELKATF PMLTAGWKLWPFAHL+TYG+IP+EQRLLWVDCVE
Sbjct  244  IYFVALGLLRFESPNKIFDELKATFRPMLTAGWKLWPFAHLVTYGLIPLEQRLLWVDCVE  303

Query  378  LIWVTILSTYSNEKSEARISE  316
            LIWVTILSTYSNEKSEA I E
Sbjct  304  LIWVTILSTYSNEKSEATILE  324



>ref|XP_004155526.1| PREDICTED: uncharacterized protein LOC101223761 [Cucumis sativus]
Length=375

 Score =   368 bits (945),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 189/224 (84%), Gaps = 4/224 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH  WHGWTL+E+LRYAP+HNW AYEEALK NPVLAKM+ISG+VY LGDWIAQCYEGKP
Sbjct  134  IDHELWHGWTLYEVLRYAPEHNWIAYEEALKTNPVLAKMMISGIVYFLGDWIAQCYEGKP  193

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDRARMFRSGL GF+LHGSLSHYYY FCE LFPF DWWVV  KVAFDQTVWS +WNS
Sbjct  194  LFEFDRARMFRSGLVGFSLHGSLSHYYYQFCEILFPFKDWWVVLVKVAFDQTVWSGVWNS  253

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LR ES T I+ ELK+TFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVD VE
Sbjct  254  IYYVVLGILRSESMTDIYGELKSTFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDSVE  313

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ*TDRKPR  247
            LIWVTILST+ NEKSE RIS    +A++      PS  +D+  R
Sbjct  314  LIWVTILSTFQNEKSEERIS----DASTGENEASPSSQSDKVSR  353



>ref|XP_009357078.1| PREDICTED: uncharacterized protein LOC103947838 [Pyrus x bretschneideri]
Length=352

 Score =   366 bits (939),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPV+AKMVISGVVY+LGDWIAQC+EGKP
Sbjct  135  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVIAKMVISGVVYTLGDWIAQCFEGKP  194

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L +FDR RMFRSGL GFT HGSLSH+YY FCEALFP +DWWVVPAK+AFDQTVWSAIWNS
Sbjct  195  LLDFDRKRMFRSGLVGFTFHGSLSHFYYQFCEALFPLEDWWVVPAKIAFDQTVWSAIWNS  254

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLR ESPT IF EL+ATF PMLTAGWKLWPFAH++TYG+IPVEQRLLWVDCVE
Sbjct  255  IYFVVLGFLRFESPTKIFDELRATFVPMLTAGWKLWPFAHVVTYGLIPVEQRLLWVDCVE  314

Query  378  LIWVTILSTYSNEKSEARI  322
            LIWVTILSTYSNE +++ +
Sbjct  315  LIWVTILSTYSNENADSSL  333



>ref|XP_008230247.1| PREDICTED: mpv17-like protein isoform X1 [Prunus mume]
Length=355

 Score =   366 bits (939),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM+ISGVVY+LGDWIAQCYEGKP
Sbjct  137  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMMISGVVYTLGDWIAQCYEGKP  196

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWNS
Sbjct  197  LLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWNS  256

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP  IF ELKATFWPMLTAGWKLWPFAHL+TYG+IPVEQRLLWVDCVE
Sbjct  257  IYFVVLGFLRLESPAKIFDELKATFWPMLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCVE  316

Query  378  LIWVTILSTY  349
            LIWVTILSTY
Sbjct  317  LIWVTILSTY  326



>ref|XP_008230248.1| PREDICTED: mpv17-like protein isoform X2 [Prunus mume]
Length=354

 Score =   365 bits (938),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM+ISGVVY+LGDWIAQCYEGKP
Sbjct  137  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMMISGVVYTLGDWIAQCYEGKP  196

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWNS
Sbjct  197  LLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWNS  256

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP  IF ELKATFWPMLTAGWKLWPFAHL+TYG+IPVEQRLLWVDCVE
Sbjct  257  IYFVVLGFLRLESPAKIFDELKATFWPMLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCVE  316

Query  378  LIWVTILSTY  349
            LIWVTILSTY
Sbjct  317  LIWVTILSTY  326



>ref|XP_007217251.1| hypothetical protein PRUPE_ppa007825mg [Prunus persica]
 gb|EMJ18450.1| hypothetical protein PRUPE_ppa007825mg [Prunus persica]
Length=354

 Score =   365 bits (938),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM+ISGVVY+LGDWIAQCYEGKP
Sbjct  137  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMMISGVVYTLGDWIAQCYEGKP  196

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWNS
Sbjct  197  LLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWNS  256

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESPT IF ELKATF PMLTAGWKLWPFAHL+TYG+IPVEQRLLWVDCVE
Sbjct  257  IYFVVLGFLRLESPTKIFDELKATFRPMLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCVE  316

Query  378  LIWVTILSTY  349
            LIWVTILSTY
Sbjct  317  LIWVTILSTY  326



>ref|XP_010687649.1| PREDICTED: uncharacterized protein LOC104901742 [Beta vulgaris 
subsp. vulgaris]
Length=368

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 184/212 (87%), Gaps = 0/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YWHGWT++EILRYAP HNW+AYEE LK NP+  KMVISGVVYSLGD +AQCYEGKP
Sbjct  155  VDHDYWHGWTVYEILRYAPLHNWNAYEEILKTNPLFVKMVISGVVYSLGDLVAQCYEGKP  214

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L++FDRARM RSG+TGF LHGS+SH+YY FCEA+FP   WW +P K  FDQT+W+ IWN 
Sbjct  215  LYDFDRARMLRSGITGFALHGSMSHFYYDFCEAVFPVKGWWTIPLKAGFDQTIWTGIWNC  274

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF  LG +R ESP +IF ELKATFWP+L AGWKLWPFAH++TYGVIPVEQRLLWVDCVE
Sbjct  275  IYFIALGLMRFESPATIFKELKATFWPLLRAGWKLWPFAHIVTYGVIPVEQRLLWVDCVE  334

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            LIWVTILSTYSNEKSEARISE S EATS+ PS
Sbjct  335  LIWVTILSTYSNEKSEARISEASAEATSSDPS  366



>ref|XP_008379554.1| PREDICTED: uncharacterized protein LOC103442533 [Malus domestica]
Length=352

 Score =   364 bits (934),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 163/199 (82%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPV AKMVISGVVY+LGDWIAQC+EGKP
Sbjct  135  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVFAKMVISGVVYTLGDWIAQCFEGKP  194

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L +FDR RMFRSGL GFT HGSLSH+YY FCEALFP +DWWVVPAK+AFDQTVWSAIWNS
Sbjct  195  LLDFDRKRMFRSGLVGFTFHGSLSHFYYQFCEALFPLEDWWVVPAKIAFDQTVWSAIWNS  254

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLR ESPT IF EL+ATF PMLTAGWKLWPFAH++TYG+IPVEQRLLWVDCVE
Sbjct  255  IYFVVLGFLRFESPTKIFDELRATFVPMLTAGWKLWPFAHVVTYGLIPVEQRLLWVDCVE  314

Query  378  LIWVTILSTYSNEKSEARI  322
            LIWVTILST+SNE +++ +
Sbjct  315  LIWVTILSTFSNENADSSL  333



>gb|EMT31197.1| Peroxisomal membrane protein 2 [Aegilops tauschii]
Length=237

 Score =   358 bits (919),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 184/212 (87%), Gaps = 0/212 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D  YWHGWT+ EILRY PQHNWSAYEEALK NP+L KM+ISG+VYSLGDWIAQCYEGKP
Sbjct  25   VDQEYWHGWTILEILRYMPQHNWSAYEEALKANPLLVKMMISGIVYSLGDWIAQCYEGKP  84

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRARMFRSGL GFTL GSLSHYYY+ CE++FP  DWW VP K AFDQT WS +WN+
Sbjct  85   IFEFDRARMFRSGLIGFTLQGSLSHYYYNLCESVFPCKDWWAVPVKAAFDQTAWSGLWNT  144

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF  LGFLR ESP++IFSELK+TF+PMLTAGWKLWPFAHLITYGV+PVE RLLWVDCVE
Sbjct  145  IYFVALGFLRWESPSTIFSELKSTFFPMLTAGWKLWPFAHLITYGVVPVEHRLLWVDCVE  204

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            +IWVTILSTYSNEKSEARI ++S    +   S
Sbjct  205  IIWVTILSTYSNEKSEARILDDSSTTDTRDNS  236



>gb|KJB79964.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=348

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+E+LRY PQHNW AYE+ALK NPV+AKM ISG+VYS+GDWIAQCYEGKP
Sbjct  129  IDHDYWHGWTLYEVLRYVPQHNWIAYEQALKANPVIAKMAISGIVYSIGDWIAQCYEGKP  188

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDR RMFRSGL GFTLHGSLSHYYY FCEALFP DDWWVVPAKV FDQTVW+AIWNS
Sbjct  189  LFDFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPSDDWWVVPAKVIFDQTVWAAIWNS  248

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLGFLR ES  +I+ ELKATFWPMLTAGWKLWPFAH+ITYGVIP+EQRLLWVDCVE
Sbjct  249  IYYVVLGFLRFESSANIYKELKATFWPMLTAGWKLWPFAHVITYGVIPIEQRLLWVDCVE  308

Query  378  LIWVTILSTY  349
            LIWVTILSTY
Sbjct  309  LIWVTILSTY  318



>gb|KJB62721.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=351

 Score =   358 bits (920),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID NYW GWT++EI+RYAPQHNWSAYEEAL+ NPVLAKMVISG+VYS+GDWIAQC+EGKP
Sbjct  163  IDQNYWQGWTIYEIVRYAPQHNWSAYEEALRTNPVLAKMVISGIVYSIGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WNS
Sbjct  223  LFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCVE
Sbjct  283  IYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCVE  342

Query  378  LIWVTILST  352
            LIWVTILST
Sbjct  343  LIWVTILST  351



>gb|EMS63743.1| Protein SYM1 [Triticum urartu]
Length=250

 Score =   354 bits (909),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 187/225 (83%), Gaps = 13/225 (6%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWT+FEILRY PQHNWSAYEEALK NP+L KM+ISG+VYSLGDWIAQCYEGKP
Sbjct  25   VDQDYWHGWTIFEILRYMPQHNWSAYEEALKANPLLVKMMISGIVYSLGDWIAQCYEGKP  84

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCE-------------ALFPFDDWWVVPAKV  598
            +FEFDRARMFRSGL GFTL GSLSHYYY+FCE             ++FP+ DWW VP K 
Sbjct  85   IFEFDRARMFRSGLIGFTLQGSLSHYYYNFCEVTDTMNASTFLHQSVFPYKDWWAVPVKA  144

Query  597  AFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVI  418
            AFDQTVWS +WN+IYF  LGFLR ESP++IF ELK+TF+PMLTAGWKLWPFAH+ITYGV+
Sbjct  145  AFDQTVWSGLWNTIYFVALGFLRWESPSTIFRELKSTFFPMLTAGWKLWPFAHIITYGVV  204

Query  417  PVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            P+E RLLWVDCVELIWVTILSTYSNEKSEAR  ++S    +   S
Sbjct  205  PIEHRLLWVDCVELIWVTILSTYSNEKSEARTLDDSSTTDTRDNS  249



>gb|KEH39091.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=339

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 186/213 (87%), Gaps = 6/213 (3%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EIL+Y P+HNW AYE++LK NPVLAKM ISGVVYS+GDWIAQ     P
Sbjct  101  IDHDYWHGWTLYEILKYVPEHNWIAYEQSLKANPVLAKMAISGVVYSIGDWIAQ-----P  155

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  WWVVPAKVAFDQTVWSAIWN+
Sbjct  156  IFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWWVVPAKVAFDQTVWSAIWNT  215

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF VLG LR +S  +I+ ELK+TF PMLTAGWKLWPFAHLITYGV+PVEQRLLWVDC+E
Sbjct  216  IYFVVLGLLRFDSLDNIYGELKSTFLPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCIE  275

Query  378  LIWVTILSTYSNEKSEARISEESVE-ATSNPPS  283
            LIWVTILSTYSNEKSE+R SEE  E A S+ PS
Sbjct  276  LIWVTILSTYSNEKSESRKSEEVSETAGSSTPS  308



>ref|XP_002966359.1| hypothetical protein SELMODRAFT_66864, partial [Selaginella moellendorffii]
 gb|EFJ32386.1| hypothetical protein SELMODRAFT_66864, partial [Selaginella moellendorffii]
Length=236

 Score =   344 bits (882),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YW GWT +EI++YAP HNWSAYEEALK +PVLAKM+ISG+VYS+GDW+AQCYEGKP
Sbjct  31   VDQDYWQGWTFYEIIKYAPVHNWSAYEEALKSHPVLAKMMISGIVYSIGDWMAQCYEGKP  90

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            + +F R RM RSGL GF LHGSLSHYYYH CEALFPF +WWVVP KV FDQT+WSA WNS
Sbjct  91   VLDFSRTRMLRSGLVGFCLHGSLSHYYYHVCEALFPFKEWWVVPLKVGFDQTIWSAFWNS  150

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            +YF  LG LRLE+P +I SEL++TF+P+LTAGWKLWPFAHL+TYG+IPVEQRLLWVDCVE
Sbjct  151  VYFITLGLLRLENPVTIVSELRSTFFPLLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCVE  210

Query  378  LIWVTILSTYSNEKSEARISEES  310
            L+WVTILS YSNEK+EAR SE++
Sbjct  211  LVWVTILSMYSNEKAEARSSEDA  233



>ref|XP_002978201.1| hypothetical protein SELMODRAFT_56885, partial [Selaginella moellendorffii]
 gb|EFJ20858.1| hypothetical protein SELMODRAFT_56885, partial [Selaginella moellendorffii]
Length=236

 Score =   343 bits (879),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YW GWT +EI++YAP HNWSAYEEAL+ +PVLAKM+ISG+VYS+GDW+AQCYEGKP
Sbjct  31   VDQDYWQGWTFYEIIKYAPVHNWSAYEEALRSHPVLAKMMISGIVYSIGDWMAQCYEGKP  90

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            + +F R RM RSGL GF LHGSLSHYYYH CEALFPF +WWVVP KV FDQT+WSA WNS
Sbjct  91   VLDFSRTRMLRSGLVGFCLHGSLSHYYYHVCEALFPFKEWWVVPLKVGFDQTIWSAFWNS  150

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            +YF  LG LRLE+P +I SEL++TF+P+LTAGWKLWPFAHL+TYG+IPVEQRLLWVDCVE
Sbjct  151  VYFITLGLLRLENPVTIVSELRSTFFPLLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCVE  210

Query  378  LIWVTILSTYSNEKSEARISEES  310
            L+WVTILS YSNEK+EAR SE++
Sbjct  211  LVWVTILSMYSNEKAEARSSEDA  233



>ref|XP_001774069.1| predicted protein [Physcomitrella patens]
 gb|EDQ61121.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 171/207 (83%), Gaps = 0/207 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+ W GWT+FEIL+YAP HNW AYE  L+ NP+LAKM+ISGVVYS+GDWI QC EGKP
Sbjct  43   VDHDVWQGWTMFEILKYAPLHNWKAYELLLQSNPILAKMMISGVVYSIGDWIGQCVEGKP  102

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            + EFDR+R+ RSGL GF LHG LSH+YYH CE LFPF  WWVVP KVAFDQT+WSA+WNS
Sbjct  103  VLEFDRSRLLRSGLVGFCLHGMLSHHYYHVCEFLFPFQGWWVVPLKVAFDQTIWSAVWNS  162

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF  LG LR ESP  I  +L+ TF+P+LTAGWKLWPFAHLITYG++PVEQRLLWVDCVE
Sbjct  163  IYFVTLGLLRFESPVRILKDLRETFFPLLTAGWKLWPFAHLITYGLVPVEQRLLWVDCVE  222

Query  378  LIWVTILSTYSNEKSEARISEESVEAT  298
            +IWVTILS +SNEKS+ R+     EA 
Sbjct  223  IIWVTILSMFSNEKSQKRLESGEGEAV  249



>ref|XP_001765838.1| predicted protein [Physcomitrella patens]
 gb|EDQ69429.1| predicted protein, partial [Physcomitrella patens]
Length=225

 Score =   325 bits (832),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 167/196 (85%), Gaps = 0/196 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+ WHGWT+FE+L+YAP HNW AYEE L  NPVLAKM+ISGVVYS+GDWI QC EGKP
Sbjct  30   VDHDVWHGWTVFEVLKYAPLHNWHAYEEFLSANPVLAKMMISGVVYSIGDWIGQCVEGKP  89

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            + EF R R+ RSGL GF LHGSLSHYYYH CE LFPF  WWVVP KVAFDQT+WSAIWNS
Sbjct  90   VLEFSRVRLLRSGLVGFCLHGSLSHYYYHVCEFLFPFQGWWVVPVKVAFDQTIWSAIWNS  149

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF  LG LR ESP  I  +L+ TF+P+LTAGWKLWPFAHLITYG++PVEQRLLWVDCVE
Sbjct  150  IYFITLGLLRFESPVRILKDLRETFFPLLTAGWKLWPFAHLITYGLVPVEQRLLWVDCVE  209

Query  378  LIWVTILSTYSNEKSE  331
            ++WVTILS ++NEK++
Sbjct  210  ILWVTILSVFANEKAQ  225



>dbj|BAD34004.1| peroxisomal membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD36403.1| peroxisomal membrane protein-like [Oryza sativa Japonica Group]
Length=364

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 162/209 (78%), Gaps = 39/209 (19%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YWHGWT+FEILRY P+HNWSAYEEALK NPVL           LGDWIAQCYEGKP
Sbjct  188  VDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPVL-----------LGDWIAQCYEGKP  236

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWNS
Sbjct  237  IFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWNS  296

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYF                           AGWKLWPFAHL+TYG++PVEQRLLWVDCVE
Sbjct  297  IYF--------------------------VAGWKLWPFAHLVTYGLVPVEQRLLWVDCVE  330

Query  378  LIWVTILSTYSNEKSEARISEESVEATSN  292
            LIWVTILSTYSNEKSEAR SE++  +TSN
Sbjct  331  LIWVTILSTYSNEKSEARNSEDA--STSN  357



>ref|XP_008386298.1| PREDICTED: uncharacterized protein LOC103448811 [Malus domestica]
Length=246

 Score =   293 bits (750),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 158/215 (73%), Gaps = 38/215 (18%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +YWHGWTL+EIL YAPQHNWSAYEEALK NPVLAKMVISGVVYS+GDWIAQ      
Sbjct  67   VDQDYWHGWTLYEILWYAPQHNWSAYEEALKTNPVLAKMVISGVVYSVGDWIAQ------  120

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
                                             L PF DWWVVP KVAFDQTVW+AIWNS
Sbjct  121  --------------------------------ELIPFQDWWVVPVKVAFDQTVWAAIWNS  148

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IYFTVLGFLR ES  SIFSELKATF PMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCVE
Sbjct  149  IYFTVLGFLRFESLISIFSELKATFLPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCVE  208

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  274
            LIWVTILSTYSNEKSEARISE   EA S+    GP
Sbjct  209  LIWVTILSTYSNEKSEARISEAPAEANSSSSDTGP  243



>ref|NP_564616.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
 gb|AAM61632.1| unknown [Arabidopsis thaliana]
 gb|AEE32861.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
Length=306

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEILRYAPQHNW AYEEALK+NPVLAKMVISGVVYS+GDWIAQCYEGKP
Sbjct  148  IDHDYWHGWTLFEILRYAPQHNWIAYEEALKQNPVLAKMVISGVVYSVGDWIAQCYEGKP  207

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQTVWSAIWNS
Sbjct  208  LFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVAFDQTVWSAIWNS  267

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLI  433
            IYFTVLGFLR ESP SIF ELKATF PMLT G     F HL+
Sbjct  268  IYFTVLGFLRFESPISIFKELKATFLPMLTVG----SFGHLL  305



>gb|KDO74155.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=327

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 158/217 (73%), Gaps = 38/217 (18%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEI+RYAP HNW+AYEEALK NPVLAKMVISGVVYSLGDWIAQ      
Sbjct  148  IDQDYWHGWTIFEIVRYAPLHNWTAYEEALKTNPVLAKMVISGVVYSLGDWIAQ------  201

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
                                             LFPF DWWVVPAKVAFDQT W+A WNS
Sbjct  202  --------------------------------ELFPFQDWWVVPAKVAFDQTAWAAAWNS  229

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  379
            IY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVE
Sbjct  230  IYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVE  289

Query  378  LIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  268
            LIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  290  LIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  326



>gb|ABF97329.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=306

 Score =   291 bits (744),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  145  VDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKP  204

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWNS
Sbjct  205  IFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWNS  264

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLT  469
            IYF VLGFLRLESP +I SELK+TFWPMLT
Sbjct  265  IYFVVLGFLRLESPATISSELKSTFWPMLT  294



>gb|KDO74164.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=314

 Score =   288 bits (737),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 142/162 (88%), Gaps = 4/162 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEI+RYAP HNW+AYEEALK NPVLAKMVISGVVYSLGDWIAQC++GKP
Sbjct  148  IDQDYWHGWTIFEIVRYAPLHNWTAYEEALKTNPVLAKMVISGVVYSLGDWIAQCFQGKP  207

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WNS
Sbjct  208  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWNS  267

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLI  433
            IY+ VLG LRLESP SIFSELKATFWPMLT G     F HL+
Sbjct  268  IYYMVLGLLRLESPFSIFSELKATFWPMLTGG----SFGHLL  305



>ref|XP_008230249.1| PREDICTED: uncharacterized protein LOC103329543 isoform X3 [Prunus 
mume]
Length=294

 Score =   286 bits (733),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM+ISGVVY+LGDWIAQCYEGKP
Sbjct  137  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMMISGVVYTLGDWIAQCYEGKP  196

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWNS
Sbjct  197  LLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWNS  256

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTA  466
            IYF VLGFLRLESP  IF ELKATFWPMLTA
Sbjct  257  IYFVVLGFLRLESPAKIFDELKATFWPMLTA  287



>ref|XP_008230251.1| PREDICTED: uncharacterized protein LOC103329543 isoform X5 [Prunus 
mume]
Length=289

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM+ISGVVY+LGDWIAQCYEGKP
Sbjct  137  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMMISGVVYTLGDWIAQCYEGKP  196

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWNS
Sbjct  197  LLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWNS  256

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTA  466
            IYF VLGFLRLESP  IF ELKATFWPMLT+
Sbjct  257  IYFVVLGFLRLESPAKIFDELKATFWPMLTS  287



>ref|XP_008230250.1| PREDICTED: uncharacterized protein LOC103329543 isoform X4 [Prunus 
mume]
Length=290

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM+ISGVVY+LGDWIAQCYEGKP
Sbjct  137  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMMISGVVYTLGDWIAQCYEGKP  196

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWNS
Sbjct  197  LLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWNS  256

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLT  469
            IYF VLGFLRLESP  IF ELKATFWPMLT
Sbjct  257  IYFVVLGFLRLESPAKIFDELKATFWPMLT  286



>ref|XP_006451945.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65185.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=317

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 141/162 (87%), Gaps = 4/162 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEI+RYAP HNW+AYE ALK NPVLAKMVISGVVYSLGDWIAQC+EGKP
Sbjct  151  IDQDYWHGWTIFEIVRYAPLHNWTAYEAALKTNPVLAKMVISGVVYSLGDWIAQCFEGKP  210

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WNS
Sbjct  211  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWNS  270

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLI  433
            IY+ VLG LRLESP SIFSELKATFWPMLT G     F HL+
Sbjct  271  IYYMVLGLLRLESPFSIFSELKATFWPMLTGG----SFGHLL  308



>ref|XP_008230252.1| PREDICTED: uncharacterized protein LOC103329543 isoform X6 [Prunus 
mume]
 ref|XP_008230253.1| PREDICTED: uncharacterized protein LOC103329543 isoform X7 [Prunus 
mume]
Length=286

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM+ISGVVY+LGDWIAQCYEGKP
Sbjct  137  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMMISGVVYTLGDWIAQCYEGKP  196

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            L EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWNS
Sbjct  197  LLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWNS  256

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLT  469
            IYF VLGFLRLESP  IF ELKATFWPMLT
Sbjct  257  IYFVVLGFLRLESPAKIFDELKATFWPMLT  286



>gb|KDO74165.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=316

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEI+RYAP HNW+AYEEALK NPVLAKMVISGVVYSLGDWIAQC++GKP
Sbjct  148  IDQDYWHGWTIFEIVRYAPLHNWTAYEEALKTNPVLAKMVISGVVYSLGDWIAQCFQGKP  207

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WNS
Sbjct  208  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWNS  267

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLT  469
            IY+ VLG LRLESP SIFSELKATFWPMLT
Sbjct  268  IYYMVLGLLRLESPFSIFSELKATFWPMLT  297



>gb|KJB79963.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
 gb|KJB79965.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=287

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 141/162 (87%), Gaps = 4/162 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+E+LRY PQHNW AYE+ALK NPV+AKM ISG+VYS+GDWIAQCYEGKP
Sbjct  129  IDHDYWHGWTLYEVLRYVPQHNWIAYEQALKANPVIAKMAISGIVYSIGDWIAQCYEGKP  188

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDR RMFRSGL GFTLHGSLSHYYY FCEALFP DDWWVVPAKV FDQTVW+AIWNS
Sbjct  189  LFDFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPSDDWWVVPAKVIFDQTVWAAIWNS  248

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLI  433
            IY+ VLGFLR ES  +I+ ELKATFWPMLT G     F HL+
Sbjct  249  IYYVVLGFLRFESSANIYKELKATFWPMLTVG----SFGHLL  286



>gb|KDO40772.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=293

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 142/163 (87%), Gaps = 4/163 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM ISG+VY +GDWIAQCYEGKP
Sbjct  130  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMAISGIVYFIGDWIAQCYEGKP  189

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FD  RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVW+A+WNS
Sbjct  190  LFDFDLQRMFRSGLVGFTLHGSLSHYYYKFCEALFPFQDWWVVPAKVAFDQTVWAAVWNS  249

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLIT  430
            IYF VLGFLR ES  +IFSELK+TFWPMLT G     F HL+T
Sbjct  250  IYFVVLGFLRFESAANIFSELKSTFWPMLTDG----SFGHLLT  288



>gb|KJB62720.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=316

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID NYW GWT++EI+RYAPQHNWSAYEEAL+ NPVLAKMVISG+VYS+GDWIAQC+EGKP
Sbjct  163  IDQNYWQGWTIYEIVRYAPQHNWSAYEEALRTNPVLAKMVISGIVYSIGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WNS
Sbjct  223  LFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLT  469
            IYF VLGFLRLESP SIF+E KATF PMLT
Sbjct  283  IYFVVLGFLRLESPISIFNEWKATFLPMLT  312



>ref|XP_006447326.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
 gb|ESR60566.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
Length=287

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM ISG+VY +GDWIAQCYEGKP
Sbjct  130  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMAISGIVYFIGDWIAQCYEGKP  189

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FD  RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVW+A+WNS
Sbjct  190  LFDFDLQRMFRSGLVGFTLHGSLSHYYYKFCEALFPFQDWWVVPAKVAFDQTVWAAVWNS  249

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWP  448
            IYF VLGFLR ES  +IFSELK+TFWPMLT     +P
Sbjct  250  IYFVVLGFLRFESAANIFSELKSTFWPMLTVRSSFFP  286



>gb|KJB62723.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=317

 Score =   281 bits (719),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID NYW GWT++EI+RYAPQHNWSAYEEAL+ NPVLAKMVISG+VYS+GDWIAQC+EGKP
Sbjct  163  IDQNYWQGWTIYEIVRYAPQHNWSAYEEALRTNPVLAKMVISGIVYSIGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WNS
Sbjct  223  LFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLT  469
            IYF VLGFLRLESP SIF+E KATF PMLT
Sbjct  283  IYFVVLGFLRLESPISIFNEWKATFLPMLT  312



>ref|XP_011039752.1| PREDICTED: uncharacterized protein LOC105136210 isoform X2 [Populus 
euphratica]
Length=291

 Score =   279 bits (714),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 141/162 (87%), Gaps = 4/162 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  133  IDHDYWHGWTLYEILRYLPEHNWIAYEQALKANPVLAKMAISGIVYSIGDWIAQCYEGKP  192

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDR R FRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVW+A+WNS
Sbjct  193  IFEFDRTRTFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWAAVWNS  252

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLI  433
            IY+  +G LR ESP +IFSELKATFW MLT G     F HL+
Sbjct  253  IYYVAIGLLRFESPDNIFSELKATFWLMLTDG----SFGHLL  290



>gb|KJB62724.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=339

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID NYW GWT++EI+RYAPQHNWSAYEEAL+ NPVLAKMVISG+VYS+GDWIAQC+EGKP
Sbjct  163  IDQNYWQGWTIYEIVRYAPQHNWSAYEEALRTNPVLAKMVISGIVYSIGDWIAQCFEGKP  222

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WNS
Sbjct  223  LFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWNS  282

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLT  469
            IYF VLGFLRLESP SIF+E KATF PMLT
Sbjct  283  IYFVVLGFLRLESPISIFNEWKATFLPMLT  312



>gb|KDO40773.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=287

 Score =   279 bits (713),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EILRY P+HNW AYE+ALK NPVLAKM ISG+VY +GDWIAQCYEGKP
Sbjct  130  IDHDYWHGWTLYEILRYVPEHNWIAYEQALKANPVLAKMAISGIVYFIGDWIAQCYEGKP  189

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FD  RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVW+A+WNS
Sbjct  190  LFDFDLQRMFRSGLVGFTLHGSLSHYYYKFCEALFPFQDWWVVPAKVAFDQTVWAAVWNS  249

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWP  448
            IYF VLGFLR ES  +IFSELK+TFWPMLT     +P
Sbjct  250  IYFVVLGFLRFESAANIFSELKSTFWPMLTVRSFFFP  286



>gb|KJB79962.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=303

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+E+LRY PQHNW AYE+ALK NPV+AKM ISG+VYS+GDWIAQCYEGKP
Sbjct  129  IDHDYWHGWTLYEVLRYVPQHNWIAYEQALKANPVIAKMAISGIVYSIGDWIAQCYEGKP  188

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LF+FDR RMFRSGL GFTLHGSLSHYYY FCEALFP DDWWVVPAKV FDQTVW+AIWNS
Sbjct  189  LFDFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPSDDWWVVPAKVIFDQTVWAAIWNS  248

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLT  469
            IY+ VLGFLR ES  +I+ ELKATFWPMLT
Sbjct  249  IYYVVLGFLRFESSANIYKELKATFWPMLT  278



>ref|XP_010051684.1| PREDICTED: uncharacterized protein LOC104440441 isoform X2 [Eucalyptus 
grandis]
Length=292

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YW GWTL+E+LRYAP+HNW AYE+ALK NPVLAKM ISGVVYSLGDWIAQCYEGKP
Sbjct  141  VDHDYWQGWTLYEVLRYAPEHNWIAYEQALKTNPVLAKMAISGVVYSLGDWIAQCYEGKP  200

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            LFEFD  RMFRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKV FDQTVW+A+WNS
Sbjct  201  LFEFDPLRMFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVVFDQTVWAAVWNS  260

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLT  469
            IY+ +LG LRLESP +I +ELKATFWPMLT
Sbjct  261  IYYVMLGLLRLESPANILNELKATFWPMLT  290



>gb|ABF97328.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=301

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  145  VDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKP  204

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWNS
Sbjct  205  IFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWNS  264

Query  558  IYFTVLGFLRLESPTSIFSELK  493
            IYF VLGFLRLESP +I S L+
Sbjct  265  IYFVVLGFLRLESPATISSRLE  286



>gb|EEE59409.1| hypothetical protein OsJ_11557 [Oryza sativa Japonica Group]
Length=195

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 130/150 (87%), Gaps = 11/150 (7%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YWHGWT+FEILRY P+HNWSAYEEALK NPVL           LGDWIAQCYEGKP
Sbjct  45   VDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPVL-----------LGDWIAQCYEGKP  93

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNS  559
            +FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWNS
Sbjct  94   IFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWNS  153

Query  558  IYFTVLGFLRLESPTSIFSELKATFWPMLT  469
            IYF VLGFLRLESP +I SELK+TFWPMLT
Sbjct  154  IYFVVLGFLRLESPATISSELKSTFWPMLT  183



>gb|EAZ27617.1| hypothetical protein OsJ_11561 [Oryza sativa Japonica Group]
Length=332

 Score =   214 bits (544),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 116/161 (72%), Gaps = 20/161 (12%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YWHGWT+FEILRY P+HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQCYEGKP
Sbjct  142  VDHDYWHGWTIFEILRYMPEHNWSAYEEALKTNPVLAKMMISGVVYSLGDWIAQCYEGKP  201

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFD----------  589
            +FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVV  K              
Sbjct  202  IFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVSRKRLCSIRRPGLRYGT  261

Query  588  -QTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLT  469
              T WS  W S  +       +E+P          FWPMLT
Sbjct  262  VSTSWS--WGSFVWNHRPLFPIEAPN-------PRFWPMLT  293



>gb|AAT76331.1| putative peroxisomal membrane protein, 5'-partial [Oryza sativa 
Japonica Group]
Length=122

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 108/117 (92%), Gaps = 2/117 (2%)
 Frame = -1

Query  642  ALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAG  463
            ALFPF DWWVVPAKV FDQT WSAIWNSIYF VLGFLRLESP +I SELK+TFWPMLTAG
Sbjct  1    ALFPFKDWWVVPAKVVFDQTAWSAIWNSIYFVVLGFLRLESPATISSELKSTFWPMLTAG  60

Query  462  WKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEATSN  292
            WKLWPFAHL+TYG++PVEQRLLWVDCVELIWVTILSTYSNEKSEAR SE++  +TSN
Sbjct  61   WKLWPFAHLVTYGLVPVEQRLLWVDCVELIWVTILSTYSNEKSEARNSEDA--STSN  115



>gb|ABR25909.1| mpv17/pmp22 family protein [Oryza sativa Indica Group]
Length=118

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = -1

Query  630  FDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLW  451
            F DWWVVPAKV FDQT WSAIWNSIYF VLGFLRLESP +I SELK+TFWPMLTAGWKLW
Sbjct  1    FKDWWVVPAKVVFDQTAWSAIWNSIYFVVLGFLRLESPATISSELKSTFWPMLTAGWKLW  60

Query  450  PFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEE-SVEATSNPPSV  280
            PFAHL+TYG++PVEQRLLWVDCVELIWVTILSTYSNEKSEAR SE+ S    SN  S+
Sbjct  61   PFAHLVTYGLVPVEQRLLWVDCVELIWVTILSTYSNEKSEARNSEDASTSNASNDNSI  118



>gb|ACJ84916.1| unknown [Medicago truncatula]
Length=205

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTL+EIL+Y P+HNW AYE++LK NPVLAKM ISGVVYS+GDWIAQCYEGKP
Sbjct  101  IDHDYWHGWTLYEILKYVPEHNWIAYEQSLKANPVLAKMAISGVVYSIGDWIAQCYEGKP  160

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPA  604
            +FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  W   P 
Sbjct  161  IFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWVGCPC  205



>gb|EWM29375.1| peroxisomal membrane 22 kda (mpv17 pmp22) family protein [Nannochloropsis 
gaditana]
Length=430

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 134/216 (62%), Gaps = 8/216 (4%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D + W GWT  EI    P  NW  Y   L  +PV  K V SG VY+LGD +AQ YEGK 
Sbjct  146  VDLDVWRGWTPAEIFTRIPLDNWDGYMNVLSLHPVFVKAVTSGSVYTLGDGVAQLYEGKT  205

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPF---DDWWVVPAKVAFDQTVWSAI  568
            L E DR R+ RSG+ GF  HG LSH++Y   E  F +   + WW    K+  DQ VWS I
Sbjct  206  LGEIDRGRVARSGIAGFVGHGPLSHWWYGVSEDFFGWLGWEGWWTTFPKITVDQLVWSPI  265

Query  567  WNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVD  388
            WN  Y  +LG ++ E+   I + +K+T + ++T+G KLWP AH++TYGVIPVE RLLWVD
Sbjct  266  WNGCYIFLLGAMKREALGEIVNTVKSTSFSLITSGLKLWPLAHVVTYGVIPVENRLLWVD  325

Query  387  CVELIWVTILS----TYSNEKSEARISEESVEATSN  292
             VE++WVTILS        EK+EA I + +VE  S+
Sbjct  326  LVEILWVTILSREAANADAEKAEA-IGDVAVEEASS  360



>emb|CBJ48801.1| conserved unknown protein [Ectocarpus siliculosus]
Length=283

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 128/212 (60%), Gaps = 6/212 (3%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D     GWT+ E +   P  NW  Y E L+++PV  K   SG+VY+LGD +AQ  EG  
Sbjct  74   VDSEVSRGWTIGEYILRVPLDNWDGYSEMLRQSPVQVKACTSGIVYALGDLVAQSMEGTE  133

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPF----DDWWVVPAKVAFDQTVWSA  571
            L   +R R+ RS + G  LHG LSH +Y+ CE LF      D WWV   K+  DQ +W  
Sbjct  134  LASIERQRVVRSAIAGLLLHGPLSHVWYNVCEGLFDIVGWNDYWWVPAPKIITDQLLWGP  193

Query  570  IWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWV  391
             WN++Y   LG L  +S   I+  + +T  P++ AG +LWP AH++TYG++P E RLLWV
Sbjct  194  AWNAVYIAFLGVLNKDSSAVIWEAITSTALPLVIAGIRLWPLAHVVTYGLVPKENRLLWV  253

Query  390  DCVELIWVTILSTYSNEKSEARISEESVEATS  295
            D VE+IWVTILS+ + E  +AR   E  E+TS
Sbjct  254  DAVEIIWVTILSSQAAE--QARSPAEQEESTS  283



>ref|XP_010924061.1| PREDICTED: uncharacterized protein LOC105046999 isoform X2 [Elaeis 
guineensis]
Length=328

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWTL+EILRYAPQHNW+AYEEALK NPVLAKMVISGVVYSLGDWIAQCYEGKP
Sbjct  171  IDRDYWHGWTLYEILRYAPQHNWTAYEEALKTNPVLAKMVISGVVYSLGDWIAQCYEGKP  230

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPF  628
            LF+FDRARMFRSG+ GFTLHGSLSHYYY FC  L+PF
Sbjct  231  LFDFDRARMFRSGVVGFTLHGSLSHYYYQFCWKLWPF  267


 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -1

Query  462  WKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEATSNPPS  283
            WKLWPFAHLITYGVIPVEQRLLWVDCVEL+WVTILSTYSNEKSEAR SE   E+ + PP+
Sbjct  262  WKLWPFAHLITYGVIPVEQRLLWVDCVELVWVTILSTYSNEKSEARNSEAMSESNATPPA  321

Query  282  V  280
            V
Sbjct  322  V  322



>gb|KDO74166.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=244

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID +YWHGWT+FEI+RYAP HNW+AYEEALK NPVLAKMVISGVVYSLGDWIAQC++GKP
Sbjct  148  IDQDYWHGWTIFEIVRYAPLHNWTAYEEALKTNPVLAKMVISGVVYSLGDWIAQCFQGKP  207

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALF  634
            LFEFDR RMFRSGL GFTLHGSLSHYYY FCE + 
Sbjct  208  LFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEVII  242



>ref|XP_002183832.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44501.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=228

 Score =   181 bits (460),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 128/208 (62%), Gaps = 5/208 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D     GWT  E+    P   W+ Y + L+ +PV  K   S  VY++GD+IAQ  +G  
Sbjct  21   MDATISRGWTSEELAARIPMDVWAGYSQVLENSPVATKAATSATVYTIGDFIAQRTQGAA  80

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFP----FDDWWVVPAKVAFDQTVWSA  571
            + + DR R+ RS L G   HG LSH++Y+ C+  F     +  WW    KV  DQT W  
Sbjct  81   MGDLDRGRIVRSMLAGLIGHGPLSHFWYNVCDHFFDNVLHWTAWWSFFPKVVVDQTTWGP  140

Query  570  IWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWV  391
            IWN+ Y  +LG ++LE   +I+S++K T  P++ +G KLWP AH +TYG++PVE RLLWV
Sbjct  141  IWNNTYILLLGLMKLEKLETIWSDMKRTTVPLILSGLKLWPLAHCVTYGLVPVENRLLWV  200

Query  390  DCVELIWVTILSTYSNEK-SEARISEES  310
            D VE++WVTIL+T + E  ++A++  +S
Sbjct  201  DAVEILWVTILATTAAEAHADAKVDTKS  228



>gb|EEE59413.1| hypothetical protein OsJ_11563 [Oryza sativa Japonica Group]
Length=155

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -1

Query  684  LHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIF  505
            LH   +H       ALFPF DWWVVPAKV FDQT WSAIWNSIYF VLGFLRLESP +I 
Sbjct  30   LHTLQAHVANRLTAALFPFKDWWVVPAKVVFDQTAWSAIWNSIYFVVLGFLRLESPATIS  89

Query  504  SELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWV  367
            SELK+TFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVELIWV
Sbjct  90   SELKSTFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVELIWV  135



>ref|XP_002294377.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED88211.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=211

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 116/192 (60%), Gaps = 4/192 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            ID     GW+  EI    P  NW +Y   L   P+  K V S  VY++GD IAQ  EG+ 
Sbjct  20   IDVGITRGWSPEEIATRIPLDNWRSYTNVLNMAPIQTKAVTSATVYTIGDMIAQRTEGRG  79

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALF----PFDDWWVVPAKVAFDQTVWSA  571
            + E DR R+ RS + G   HG +SH +YH  E  F        WW    KV  DQT +  
Sbjct  80   MGEVDRWRVGRSLMAGLIGHGPMSHVWYHVSEDFFDNTLSLHAWWDFIPKVIVDQTFFGP  139

Query  570  IWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWV  391
            IWN+ Y  +LG ++L+SP+ IFS++K T  P++ +G KLWPF H ITYG+IPVE RLLWV
Sbjct  140  IWNNSYILLLGLMQLQSPSQIFSDMKRTTIPLIVSGLKLWPFVHCITYGLIPVENRLLWV  199

Query  390  DCVELIWVTILS  355
            D VE++WVTIL+
Sbjct  200  DAVEIVWVTILA  211



>gb|AAD11583.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAD14469.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77826.1| hypothetical protein [Arabidopsis thaliana]
Length=236

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YW GWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISG+VYSLGDWIAQCYEGKP
Sbjct  106  IDHDYWQGWTLYEILRYAPEHNWFAYEQILKTNPVLAKMAISGIVYSLGDWIAQCYEGKP  165

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEA  640
            LFEFDR R+ RSGL GFTLHGSLSHYYY FCEA
Sbjct  166  LFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEA  198



>gb|KCW89501.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
Length=265

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +DH+YW GWTL+E+LRYAP+HNW AYE+ALK NPVLAKM ISGVVYSLGDWIAQCYEGKP
Sbjct  141  VDHDYWQGWTLYEVLRYAPEHNWIAYEQALKTNPVLAKMAISGVVYSLGDWIAQCYEGKP  200

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEAL  637
            LFEFD  RMFRSGL GFTLHGSLSHYYY FCE +
Sbjct  201  LFEFDPLRMFRSGLVGFTLHGSLSHYYYQFCEVI  234



>gb|EJK64618.1| hypothetical protein THAOC_14631 [Thalassiosira oceanica]
Length=347

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 127/214 (59%), Gaps = 9/214 (4%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D     GWT  E+    P  NW  Y E L   PV  K + S  VY++GD IAQ  +G  
Sbjct  131  VDLGLTRGWTPLEVAERVPLDNWRGYNEILTAAPVQTKALTSASVYTIGDIIAQTRQGSG  190

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPF-----DDWWVVPAKVAFDQTVWS  574
            + + DR R+ RS + G   HG +SH +Y + EA F         WW    KV  DQ V+ 
Sbjct  191  MGDLDRPRIVRSMIAGLVGHGPMSHLWYRWSEAFFDKVVHLPHAWWDFVPKVCADQLVFG  250

Query  573  AIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLW  394
             +WN+ +  ++GF++L SP  I+ E++ T  P+L +G KLWPF H++TYGVIPVE RLLW
Sbjct  251  PLWNNTFILLIGFMQLNSPGMIWDEMRRTTVPLLLSGLKLWPFVHIVTYGVIPVENRLLW  310

Query  393  VDCVELIWVTILSTYSNEKSEA----RISEESVE  304
            VD VE++WVTIL++ +NE  E     R+++E V+
Sbjct  311  VDAVEIVWVTILASVANEGGEGEEGQRLNQEDVD  344



>ref|XP_002509068.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70326.1| predicted protein [Micromonas sp. RCC299]
Length=384

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 123/198 (62%), Gaps = 2/198 (1%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +   GWT +EILR  P+ N  AY++++ +NP+  K + SGV Y+LGD+  Q  +GK 
Sbjct  75   VDSDISTGWTAWEILRNIPRDNLEAYQQSVFDNPLPTKALTSGVAYTLGDFTCQLSQGKK  134

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDD-WWVVPAKVAFDQTVWSAIWN  562
            +   D  R  RSG+ GF +HG L HY+  + E    FD   W +P KV  DQT WS   N
Sbjct  135  ITTVDLKRSLRSGIAGFLIHGPLCHYWLMWTEENLSFDGALWAIPVKVFADQTAWSLFLN  194

Query  561  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYG-VIPVEQRLLWVDC  385
            S Y T +  L+   P  I  E++AT+W  +TAGW+ WPF H++T+  +IP + +LL+VDC
Sbjct  195  SAYTTCIMSLQGMGPERIKGEIQATWWNAITAGWRFWPFVHMLTFSPIIPQDFKLLFVDC  254

Query  384  VELIWVTILSTYSNEKSE  331
            VE++WVTILS   N  SE
Sbjct  255  VEVVWVTILSAAVNRDSE  272



>ref|XP_002176482.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC42532.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=170

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 110/170 (65%), Gaps = 4/170 (2%)
 Frame = -1

Query  843  YEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGSLSH  664
            Y + L+ +PV  K   S  VY++GD+IAQ  +G  + + DR R+ RS L G   HG LSH
Sbjct  1    YSQVLENSPVATKAATSATVYTIGDFIAQRTQGAAMGDLDRGRIVRSMLAGLIGHGPLSH  60

Query  663  YYYHFCEALFP----FDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSEL  496
            ++Y+ C+  F     +  WW    KV  DQT W  IWN+ Y  +LG ++LE   +I+S++
Sbjct  61   FWYNVCDHFFDNVLHWTAWWSFFPKVVVDQTTWGPIWNNTYILLLGLMKLEKLETIWSDM  120

Query  495  KATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYS  346
            K T  P++ +G KLWP AH +TYG++PVE RLLWVD VE++WVTIL+T +
Sbjct  121  KRTTVPLILSGLKLWPLAHCVTYGLVPVENRLLWVDAVEILWVTILATTA  170



>ref|XP_003061699.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54329.1| predicted protein [Micromonas pusilla CCMP1545]
Length=427

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 122/198 (62%), Gaps = 2/198 (1%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +   GWT +E+LR  PQ N +AY+ A+  +P+  K + SGV Y+LGD+  Q  +GK 
Sbjct  123  VDSDISTGWTWYEVLRNIPQDNLAAYQSAVFAHPLPVKAMTSGVAYTLGDFTCQLSQGKT  182

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDD-WWVVPAKVAFDQTVWSAIWN  562
            +   D  R  RSG+ GF +HG L HY+  + EA   FD  W+  P K+  DQT WS   N
Sbjct  183  IETVDLKRSARSGVAGFLIHGPLCHYWLMWTEANLSFDGAWYGTPVKIIADQTAWSLFLN  242

Query  561  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITY-GVIPVEQRLLWVDC  385
            S Y T +  L+   P  I +E++AT++  ++AGWK WPF H  T+  +IP + +LL+VDC
Sbjct  243  SAYTTCIMSLQGFGPRRIKNEIQATWYNAISAGWKFWPFVHAFTFSSIIPQDFKLLFVDC  302

Query  384  VELIWVTILSTYSNEKSE  331
            VE+IWVTILS   N  +E
Sbjct  303  VEVIWVTILSAAVNRDAE  320



>ref|XP_009035372.1| hypothetical protein AURANDRAFT_4597, partial [Aureococcus anophagefferens]
 gb|EGB09882.1| hypothetical protein AURANDRAFT_4597, partial [Aureococcus anophagefferens]
Length=195

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 119/195 (61%), Gaps = 2/195 (1%)
 Frame = -1

Query  891  TLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARM  712
            T  ++L   P  +  +YE  +  NP+  K   SGV Y+LGD+++Q Y+G+ L   D AR 
Sbjct  1    TSLDLLARLPMDSIHSYEALVPTNPIFYKACTSGVAYTLGDFVSQIYQGRNLKSVDLARS  60

Query  711  FRSGLTGFTLHGSLSHYYYHFCEALFPFDD-WWVVPAKVAFDQTVWSAIWNSIYFTVLGF  535
             RSG  GF  HG L H++  + EA   FD  W+    KV  DQTVWS   N++Y  ++G 
Sbjct  61   ARSGAAGFVGHGPLCHFWMVWMEAHLDFDGAWYGTGFKVFADQTVWSLYLNAMYSFLIGS  120

Query  534  LRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYG-VIPVEQRLLWVDCVELIWVTIL  358
              L +P  ++ ++KAT WP L + W+ WPF H I++  ++P++ +LLWVD +E++WVTIL
Sbjct  121  FALRNPRDVWEDVKATSWPALRSSWRFWPFVHTISFSHLVPLDLKLLWVDAMEIVWVTIL  180

Query  357  STYSNEKSEARISEE  313
            S  +N+   A++ E+
Sbjct  181  SKVANDDKVAKLDED  195



>emb|CBJ27831.1| conserved unknown protein [Ectocarpus siliculosus]
Length=315

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 114/203 (56%), Gaps = 2/203 (1%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            +D +   GWT +E+L   P  N+  YE  + E+P++ K   S V Y LGD+ AQ + GK 
Sbjct  74   VDGDIARGWTWYEVLLRVPGDNFYRYEATVSESPIVTKAFTSCVAYGLGDFTAQLFTGKT  133

Query  738  LFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDD-WWVVPAKVAFDQTVWSAIWN  562
            L + D  R  RS   G  +HG L H++    +    FD  WW    KV  DQTVWS   N
Sbjct  134  LEDMDLMRTARSATAGLLIHGPLCHFWIELMQTYLDFDGAWWNFIPKVIADQTVWSVFLN  193

Query  561  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITY-GVIPVEQRLLWVDC  385
            + Y T++  L+      ++ E+K+  WP LT+ W+ WP  H  ++   IP + +LL++DC
Sbjct  194  AAYSTMIMSLQGLPKEEVWGEVKSKAWPALTSSWRFWPLIHCCSFSNAIPKDLKLLFIDC  253

Query  384  VELIWVTILSTYSNEKSEARISE  316
            +E+IWVTILST +N   +A  +E
Sbjct  254  MEIIWVTILSTVANGDRQADPAE  276



>gb|EWM27713.1| peroxisomal membrane 22 kda (mpv17 pmp22) family protein [Nannochloropsis 
gaditana]
Length=570

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/216 (37%), Positives = 126/216 (58%), Gaps = 7/216 (3%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEG--  745
            +D   W GWT+ EI+   P  NW  YE  L  +P+  K VI+ V+Y +GDW++Q   G  
Sbjct  158  VDMESWRGWTIQEIMLRIPYDNWQEYEGGLSTHPIFVKTVINVVIYVIGDWMSQVGWGRT  217

Query  744  KPLFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIW  565
            K L +FD AR  R+GL G  + G L HYYY + + + P +       K+  DQ+V+    
Sbjct  218  KNLLDFDLARTARNGLIG-AMFGPLVHYYYDWSDYILPMEVPVNRVLKLLMDQSVYFVAK  276

Query  564  NSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDC  385
             S Y  ++G LR ++P  +  ++K    P++  GW+ WP AH++TYGVIP   R+LWV+ 
Sbjct  277  CSAYIALVGLLRGDTPAVVAQDVKERIQPVVFRGWRFWPLAHVVTYGVIPPRHRVLWVNM  336

Query  384  VELIWVTILSTYSNEKSEARISEESVEATSNPPSVG  277
            ++L+W +IL++ ++++ E    E++  A+S  P  G
Sbjct  337  LDLLWSSILASLASKEGE----EDASTASSPVPETG  368



>ref|XP_002177278.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51741.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=226

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 112/196 (57%), Gaps = 3/196 (2%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQC-YEGK  742
            IDH    GWT  EI    P  NW+ YE +L+E P+  K +I+ V+Y LGDW++Q  ++ K
Sbjct  32   IDHGMTRGWTQSEIAMRIPLDNWANYESSLEEKPIFTKTLINVVIYLLGDWLSQTLFQKK  91

Query  741  PLFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDW-WVVPAKVAFDQTVWSAIW  565
             + +FD +R  R+G  G    G L H YY F + + P +   W    K+  DQT++  + 
Sbjct  92   NVLDFDASRTLRNGFIGLCF-GPLVHEYYQFSDHILPVEGGIWNRVEKILMDQTIYLTVK  150

Query  564  NSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDC  385
             S+Y + +G L+ +  +++   +K     ++   WK WP  H ITY VIP + R+LWV+ 
Sbjct  151  CSVYISAVGLLQGDDWSTVKQTVKHRIGGIVFTAWKFWPLVHCITYSVIPAQHRILWVNS  210

Query  384  VELIWVTILSTYSNEK  337
            V+LIW  IL++ S ++
Sbjct  211  VDLIWNAILASMSQKE  226



>gb|ACU17682.1| unknown [Glycine max]
Length=196

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKP  739
            IDH+YWHGWTLFEI+RY P+HNW AYE+ALK NPVLAKM ISG+VYS+GDWIAQCYEGKP
Sbjct  106  IDHDYWHGWTLFEIVRYIPEHNWIAYEQALKANPVLAKMAISGIVYSIGDWIAQCYEGKP  165

Query  738  LFEFDRARMFRSGL  697
            LFEFDR R+ RSGL
Sbjct  166  LFEFDRTRVLRSGL  179



>ref|XP_002287745.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED95188.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=217

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 105/194 (54%), Gaps = 6/194 (3%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQC-YEGK  742
            ID     GWT  EI    P   W++YE +L E PV  K +I+ V+Y LGDW++Q  ++ K
Sbjct  25   IDKGMTRGWTPGEIGMRIPLDTWASYENSLSEKPVATKTIINIVIYLLGDWLSQTLFQKK  84

Query  741  PLFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAF----DQTVWS  574
             + +FD AR  ++G  G    G   H YY F + + P D   +     AF    DQT++ 
Sbjct  85   NVLDFDAARTLKNGFVGMCF-GPAVHEYYEFSDWILPVDGVTLGITNRAFKILMDQTIYL  143

Query  573  AIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLW  394
            +I  SIY   +G L  ++  +    +K    P++   WK WP  H +TYG+IP   R+LW
Sbjct  144  SIKCSIYIMAIGVLNGDTVGNASQNVKNRIKPIMFTAWKFWPLVHCVTYGLIPARHRILW  203

Query  393  VDCVELIWVTILST  352
            V+ V+L+W  IL++
Sbjct  204  VNSVDLVWNAILAS  217



>gb|EJK58198.1| hypothetical protein THAOC_21696, partial [Thalassiosira oceanica]
Length=416

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 105/202 (52%), Gaps = 6/202 (3%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQC-YEGK  742
            ID     GWT  EI    P   W++YE +L   PV  K +I+ V+Y LGDW++Q  + G 
Sbjct  154  IDRGMTRGWTAAEIGMRIPLDTWASYENSLSAKPVATKTIINVVIYLLGDWLSQTIFTGA  213

Query  741  PLFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAF----DQTVWS  574
             + +FD  R  R+GL G    G   H YY F + + P D   +     AF    DQ+++ 
Sbjct  214  DVLDFDAGRTLRNGLIGACF-GPAVHEYYEFSDWILPVDGSTLGVTNRAFKILMDQSLYL  272

Query  573  AIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLW  394
            ++  SIY   +G L  E        ++    P++   WK WP  H +TYG+IP   R+LW
Sbjct  273  SVKCSIYILAVGVLSGEGLEDSAENVRTRIKPIMFTAWKFWPLVHCVTYGLIPARHRILW  332

Query  393  VDCVELIWVTILSTYSNEKSEA  328
            V+ V+L+W  IL+ ++++  + 
Sbjct  333  VNSVDLVWNAILAGFASDDEDG  354



>emb|CBJ31093.1| conserved unknown protein [Ectocarpus siliculosus]
Length=402

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 110/196 (56%), Gaps = 5/196 (3%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGK-  742
            +D   W GWTL E L   P  NW +YE  L E+P++ K  I+  +Y +GDW++Q   G+ 
Sbjct  171  VDATMWRGWTLQETLIRLPWDNWDSYEMGLLEHPIITKTAINVGIYLIGDWLSQVKWGRE  230

Query  741  ---PLFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSA  571
                L+EFD  R  R+GL G    G + H+YY+F + + P       P K+  DQ+++  
Sbjct  231  EDVALWEFDLQRTLRNGLIGACF-GPVVHFYYNFSDWVLPPSVPINRPFKIMLDQSIYFC  289

Query  570  IWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWV  391
               ++Y  ++  LR +S       +K     ++T GW+ WPF H+ TY +IP   R+LWV
Sbjct  290  SKCAVYILLVSLLRGDSFEEARGTVKKKLKGVVTTGWRFWPFVHIFTYFLIPPRHRVLWV  349

Query  390  DCVELIWVTILSTYSN  343
            +CV+L+W +IL+  ++
Sbjct  350  NCVDLLWSSILAGMTS  365



>ref|XP_005783132.1| hypothetical protein EMIHUDRAFT_46294, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD30703.1| hypothetical protein EMIHUDRAFT_46294, partial [Emiliania huxleyi 
CCMP1516]
Length=173

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 95/172 (55%), Gaps = 3/172 (2%)
 Frame = -1

Query  846  AYEEALKENPVLAKMVISGVVYSLGDWIAQCY--EGKPLFEFDRARMFRSGLTGFTLHGS  673
            AYE A    P++ K   SGV Y  GD +AQ     G     FD  R  RS L GF  HG 
Sbjct  1    AYESAALRTPIITKAATSGVAYFFGDALAQLRVGSGSAKQRFDLRRAARSTLAGFVSHGP  60

Query  672  LSHYYYHFCEALFPFDDWWV-VPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSEL  496
              HY+  F +A          + AK+  DQTV+S   N +Y  ++  L+   P +++  +
Sbjct  61   QLHYWCLFLDAQVRLGSAAATLVAKIVLDQTVFSLYLNGVYCALVEALKGAPPAAVWRRV  120

Query  495  KATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNE  340
            +A   P L + W+ WP+ H +TY V+P+  R+LWVDCVE++WV+IL+T +++
Sbjct  121  RAAALPSLVSSWRFWPWVHALTYSVVPLHLRVLWVDCVEVVWVSILATCTSK  172



>gb|AFK40557.1| unknown [Medicago truncatula]
Length=66

 Score =   113 bits (283),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -1

Query  477  MLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEAT  298
            MLTAGWKLWPFAHLITYGVIPVEQRLLWVD +ELIWVTILSTYSNEKSEAR S ES+EA 
Sbjct  1    MLTAGWKLWPFAHLITYGVIPVEQRLLWVDMIELIWVTILSTYSNEKSEARSSSESIEAK  60

Query  297  S  295
            S
Sbjct  61   S  61



>gb|AFK33326.1| unknown [Medicago truncatula]
Length=71

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 1/66 (2%)
 Frame = -1

Query  477  MLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVE-A  301
            MLTAGWKLWPFAHLITYGV+PVEQRLLWVDC+ELIWVTILSTYSNEKSE+R SEE  E A
Sbjct  1    MLTAGWKLWPFAHLITYGVVPVEQRLLWVDCIELIWVTILSTYSNEKSESRKSEEVSETA  60

Query  300  TSNPPS  283
             S+ PS
Sbjct  61   GSSTPS  66



>ref|XP_002530181.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32195.1| conserved hypothetical protein [Ricinus communis]
Length=306

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -1

Query  468  AGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEATSNP  289
            AGWKLWPFAHLITYGV+PVEQRLLWVDCVELIWVTILSTYSNEKSEARI+E   EATS+ 
Sbjct  169  AGWKLWPFAHLITYGVVPVEQRLLWVDCVELIWVTILSTYSNEKSEARIAETPAEATSSS  228

Query  288  PSVGPSQ  268
             S  P++
Sbjct  229  LSKSPAE  235



>ref|XP_002183376.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC45076.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=185

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 93/180 (52%), Gaps = 0/180 (0%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W+ Y   L   P+L K + S   +SLGD +AQC+  +    +D  R FR G  GF LHG+
Sbjct  5    WARYNSMLDAQPLLTKALTSMTGFSLGDILAQCFIEEGDKGYDPMRTFRMGSFGFLLHGT  64

Query  672  LSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELK  493
              HY+Y F ++  P      V +KVA DQT+W+ I+  ++F  L  +  +S     +++K
Sbjct  65   TGHYFYGFLDSKLPGTAPMTVASKVAIDQTIWNPIFGCMFFGYLNLMEGKSLDDYTTKIK  124

Query  492  ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEE  313
                  +   W +W  AH I +  +P  QRLL+++ +++ +   LS   N+  E    +E
Sbjct  125  TDLKTAVMGSWAVWVPAHTINFAFVPPAQRLLYINTIQIGYNVFLSFLGNKSVEEEPKKE  184



>emb|CBN79011.1| peroxisomal membrane protein-related [Ectocarpus siliculosus]
Length=203

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 101/192 (53%), Gaps = 5/192 (3%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W+AY +AL   P+L K + S   +++GD +AQ +   P  ++D  R  R G  G  +HG 
Sbjct  5    WAAYNKALAAQPLLVKAMTSFTGFTVGDILAQKFI-SPEDDYDFMRTLRLGTFGALVHGP  63

Query  672  LSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELK  493
              HY+Y   +A  P      V +KVA DQT+W+ I+  ++FT LG    +S   I  ++K
Sbjct  64   TGHYFYGMLDAKLPGTKPMTVASKVAIDQTIWNPIFGVMFFTYLGLAEGKSVDDIQKKIK  123

Query  492  ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEE  313
                  +   W +W  AH I +  +P  QRLL+++ +++ +   LS   N+K++    ++
Sbjct  124  NDLATAVMGSWTVWIPAHTINFKFVPTSQRLLYINTIQIGYNIFLSFLGNKKAD----DD  179

Query  312  SVEATSNPPSVG  277
            SV++   P   G
Sbjct  180  SVKSALVPADAG  191



>emb|CBN79193.1| conserved unknown protein [Ectocarpus siliculosus]
Length=295

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 94/171 (55%), Gaps = 2/171 (1%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W AY  AL + P+L K   S V +S+GD++AQ  +G     F  AR+ R    GF  HG+
Sbjct  127  WDAYNSALADKPILVKACTSFVGFSIGDFLAQ--KGTSKESFSYARLARMAAFGFLFHGT  184

Query  672  LSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELK  493
            +SH++Y+  ++  P      V  KV  DQ  W+ I+  I+FT +G     SP+ I +++K
Sbjct  185  ISHFFYNALDSALPGTAAMTVIQKVIIDQVFWAPIFTLIFFTWIGVTSGASPSEIVAKVK  244

Query  492  ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNE  340
            +     +   W +WP AH I +  +P EQRLL+++ +++ +   LS   ++
Sbjct  245  SDLVQGVVGSWTVWPLAHTINFKFVPTEQRLLYINSIQIFYNVFLSIIGSK  295



>gb|AFK44918.1| unknown [Lotus japonicus]
Length=70

 Score =   105 bits (263),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  477  MLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVE  304
            MLTAGWKLWPF HL+TYGVIPVEQRLLWVD VELIWVTILSTYSNEKSE RISE   E
Sbjct  1    MLTAGWKLWPFVHLVTYGVIPVEQRLLWVDSVELIWVTILSTYSNEKSETRISEAGSE  58



>gb|EWM28728.1| Mpv17/PMP22 [Nannochloropsis gaditana]
Length=254

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 90/173 (52%), Gaps = 0/173 (0%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W  Y E L  NP+  K V S V +++GD +AQ + G+     D  R+ R    G  +HG 
Sbjct  82   WDKYNEVLDTNPLPTKAVTSLVGFTIGDLLAQSFLGEKGAPLDVKRLLRLASFGLAVHGP  141

Query  672  LSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELK  493
            + H++Y   +  FP  D   V  KV  DQ +W+ ++  I+F  +  L+      I  ++ 
Sbjct  142  VGHFFYGALDEKFPKKDAQTVAIKVLIDQVLWAPVFTVIFFAWIEVLQGAGLQKIKQKIN  201

Query  492  ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKS  334
                  +TA WK+WP  H+I +  IP +QRLL+++ +++ +   LS  ++ K+
Sbjct  202  QDLVRGVTASWKVWPLVHVINFRFIPPQQRLLYINTIQIGYNVFLSMLASRKA  254



>ref|XP_005707818.1| peroxisomal membrane MPV17/PMP22-like protein isoform 2 [Galdieria 
sulphuraria]
 ref|XP_005707819.1| peroxisomal membrane MPV17/PMP22-like protein isoform 1 [Galdieria 
sulphuraria]
 gb|EME31298.1| peroxisomal membrane MPV17/PMP22-like protein isoform 2 [Galdieria 
sulphuraria]
 gb|EME31299.1| peroxisomal membrane MPV17/PMP22-like protein isoform 1 [Galdieria 
sulphuraria]
Length=186

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 93/181 (51%), Gaps = 4/181 (2%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W+ Y  AL  NP+  K + S   ++LGD IAQ  +      +D  R  R    G  +HG 
Sbjct  5    WARYNAALTANPLKVKTLTSFFGFTLGDLIAQSPDMLSGNPWDYMRTARFSAFGLCIHGP  64

Query  672  LSHYYYHFCEALFPFD---DWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFS  502
            + HY+Y F +     +       V  K A DQ +W+ I+ SI+F+ +  +    P  +  
Sbjct  65   IGHYWYQFLDRTVMTNAPKSGLAVATKTAIDQLLWAPIFTSIFFSFMKTVE-GHPDQVTE  123

Query  501  ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARI  322
            E+K   WP +   W +WP AHLI +  +P  QR+L+++ V++ + T LST +  K++  +
Sbjct  124  EVKTKLWPTMKVNWGVWPLAHLINFRFVPSSQRILYINSVQIGYNTFLSTMAASKTKEEV  183

Query  321  S  319
            S
Sbjct  184  S  184



>gb|EWM28134.1| mpv17-like protein [Nannochloropsis gaditana]
Length=289

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 89/172 (52%), Gaps = 1/172 (1%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W  Y + LK+ P+L K + S V +S+GD +AQ +  K     D  R+ +    G  +HG 
Sbjct  105  WKGYNQLLKDQPLLTKALTSFVGFSVGDLLAQKFIDKSEV-VDLKRLLKLAFFGLLVHGP  163

Query  672  LSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELK  493
              HY+Y F +   P      V +KVA DQ +W+ I+ +++F  LG    ++   I + ++
Sbjct  164  TGHYFYGFLDGKMPGTSAVTVASKVAIDQLLWNPIFGTMFFGWLGLTEGQNLEGIKNRIE  223

Query  492  ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEK  337
               W  +   W +WP AH I +  IP  QRLL+++ V++ +   LS  +N  
Sbjct  224  KDLWASVKGSWTVWPIAHAINFRFIPNSQRLLYINSVQIGYNMFLSFLANRN  275



>ref|XP_005707552.1| peroxisomal membrane MPV17/PMP22-like protein [Galdieria sulphuraria]
 gb|EME31032.1| peroxisomal membrane MPV17/PMP22-like protein [Galdieria sulphuraria]
Length=289

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 96/181 (53%), Gaps = 4/181 (2%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCY-EGKPLFEFDRARMFRSGLTGFTLHG  676
            W  Y + L+  P+L K + S + + LGD +AQ +     +   DR  + R  L GF +HG
Sbjct  111  WMRYNQLLESRPLLTKSLTSLIGFILGDILAQKFLSSDGILHLDR--LLRMALFGFLIHG  168

Query  675  SLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSEL  496
               H +Y   +   P  + W V  KVA DQ +W+ I+  I+F  L  L  +S     ++L
Sbjct  169  PTGHIFYTQLDKAIPGTEAWKVACKVAIDQVLWAPIFALIFFGFLAVLERQSFKQFEAKL  228

Query  495  KATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSE-ARIS  319
            +  +   + A WK+WP AH I +  IP  QRLL+++ V++ +   LS   N++++  R+S
Sbjct  229  RQDWKTAIFASWKVWPLAHAINFRFIPSHQRLLYINAVQIFYNVFLSIIGNKRTQIPRVS  288

Query  318  E  316
            +
Sbjct  289  K  289



>ref|XP_005706778.1| peroxisomal membrane protein-related protein [Galdieria sulphuraria]
 gb|EME30258.1| peroxisomal membrane protein-related protein [Galdieria sulphuraria]
Length=288

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 91/171 (53%), Gaps = 3/171 (2%)
 Frame = -1

Query  846  AYEEALKENPVLAKMVISGVVYSLGDWIAQCYE--GKPLFEFDRARMFRSGLTGFTLHGS  673
            +Y  AL+E P+L K + + ++ +  D +AQ  E  G+ LF ++  R F  G  GF   G 
Sbjct  118  SYISALEERPILTKAITTSLINAFSDLVAQWLEQRGQSLFHWNIRRTFALGFWGFIFMGP  177

Query  672  LSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELK  493
              H +Y   E LFP    W    K+  DQT  +A +N  +F   GFL   +   I  +L+
Sbjct  178  FFHNWYLILERLFP-SGRWAFLKKIILDQTFAAAFFNITFFLGTGFLEGHNWHLIVDKLR  236

Query  492  ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNE  340
              FWP + A W++WP    IT+ VIP+  R+LWV+ V ++WV   S+ ++ 
Sbjct  237  HKFWPTMYANWRVWPLVQCITFTVIPLTFRVLWVNVVTVMWVIYFSSLAHS  287



>emb|CBJ27540.1| conserved unknown protein [Ectocarpus siliculosus]
Length=297

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 90/172 (52%), Gaps = 1/172 (1%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W+AY   L   P+L K + S   ++LGD +AQ +  K   E D  R+ +    G  +HGS
Sbjct  127  WAAYMSLLASQPLLTKSLTSMTGFALGDLLAQKFIDKKE-EIDLPRLLKLASFGALIHGS  185

Query  672  LSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELK  493
              H++Y+F ++  P      V  KV  DQ +W+ I+  ++F  +G +    P+ I  ++K
Sbjct  186  SGHFFYNFLDSKIPGTAALTVAKKVFIDQVLWNPIFGCMFFGYMGAVDGMGPSGISEKIK  245

Query  492  ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEK  337
               W  +   W +WP AH I + +IP  QRLL+++ +++ +   LS  +  +
Sbjct  246  NNLWTSVKGSWTVWPVAHAINFRMIPTSQRLLYINTIQIFYNCFLSVIAQRE  297



>ref|XP_005535986.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM79700.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
Length=312

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 91/172 (53%), Gaps = 2/172 (1%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W+ Y + L + P+L KM  S V + LGD +AQ +  K   + D+ R+FR    GF +HGS
Sbjct  116  WALYLQNLAKRPLLTKMFTSLVGFGLGDVLAQHFLDKQ--KLDKKRLFRMMSFGFLIHGS  173

Query  672  LSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELK  493
              HY+Y F + +        V +KVA DQ +W+ I+ +I+      L   S      ++K
Sbjct  174  TGHYWYQFLDQMIKGTGVREVVSKVALDQLLWAPIFTAIFLGYTSLLSGASTEETVKKIK  233

Query  492  ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEK  337
            A  +  + A W +WP AH I +  +P  QRLL+++ +++ +   LS  +  +
Sbjct  234  ADTFTGVRASWSVWPVAHAINFRFVPPSQRLLYINSIQIAYNMFLSILATSR  285



>ref|XP_005538717.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82681.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
Length=187

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 97/187 (52%), Gaps = 10/187 (5%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQC---YEGKPLFEFDRARMFRSGLTGFTL  682
            WS Y + L E P+  K + S + +++GD +AQ     +GKP   +D AR  R    G  L
Sbjct  5    WSKYTQLLAEKPLQVKTMTSFIGFTIGDLVAQIPALMDGKP---WDAARTARMASFGLVL  61

Query  681  HGSLSHYYYHFCE-ALFP--FDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTS  511
            HG + HY+Y F +  + P        V +K+A DQ +W+ ++ S++F+ +       P  
Sbjct  62   HGPIGHYWYEFLDRTIMPQASKSTAAVVSKMAIDQLLWAPVFTSLFFSYMQAAE-GKPER  120

Query  510  IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSE  331
                ++   WP L   W +WP AHLI +  IP  QR+L+++ V++ +   LST +  K+ 
Sbjct  121  APEVVREKLWPTLKVNWTVWPLAHLINFRFIPSSQRILYINTVQVGYNAFLSTMAAAKTS  180

Query  330  ARISEES  310
              + + S
Sbjct  181  VPVEKTS  187



>ref|XP_009040828.1| hypothetical protein AURANDRAFT_15607, partial [Aureococcus anophagefferens]
 gb|EGB04441.1| hypothetical protein AURANDRAFT_15607 [Aureococcus anophagefferens]
Length=168

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 89/166 (54%), Gaps = 1/166 (1%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W+AYE AL+++P+L K + S + + LGD +AQC+  K   ++D  R  R    G  +HG+
Sbjct  2    WAAYEAALEKDPLLIKGLTSMIGFFLGDVLAQCFIEKSD-KYDIWRTIRFSSFGLLVHGT  60

Query  672  LSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELK  493
             SH++Y   +   P      V +KV  DQ +W+ I+  ++F  +G           +++K
Sbjct  61   TSHWFYGKLDGKIPGTGAGAVASKVGIDQVLWNPIFGIMFFGYMGIFEGSGVGGTITKIK  120

Query  492  ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILS  355
                  +T  W +WP AH I +  IP  QR+L+++ +++ +   LS
Sbjct  121  NDLLTQVTGSWTVWPIAHAINFKFIPNSQRVLYINTIQIFYNCFLS  166



>ref|XP_005776476.1| putative peroxisomal membrane protein [Emiliania huxleyi CCMP1516]
 gb|EOD24047.1| putative peroxisomal membrane protein [Emiliania huxleyi CCMP1516]
Length=273

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 92/175 (53%), Gaps = 2/175 (1%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W  Y E L E P+L K   S + +++GD +AQ +  K   +FD  R+FR    GF +HG+
Sbjct  100  WKKYNELLDEKPLLMKAFTSFLGFAIGDILAQIFIQKQ--DFDWYRLFRLASFGFLVHGT  157

Query  672  LSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELK  493
             SH++Y   ++  P      V  KV  DQ +W+ I   ++F+ +  L  +    +  + +
Sbjct  158  SSHWFYGMLDSAIPGKGAQPVFTKVFIDQVLWNPILGIMFFSYVACLEWKGLQYVIDKTR  217

Query  492  ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEA  328
                  +T  WK+WP AH I +  IP  QR+L+++ +++ +   LS  SN  +EA
Sbjct  218  NELLRQVTGSWKVWPLAHAINFRFIPSSQRVLYINSIQIGYNCFLSLISNRDAEA  272



>gb|ACJ84917.1| unknown [Medicago truncatula]
Length=64

 Score = 97.8 bits (242),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 1/59 (2%)
 Frame = -1

Query  456  LWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVE-ATSNPPS  283
            LWPFAHLITYGV+PVEQRLLWVDC+ELIWVTILSTYSNEKSE+R SEE  E A S+ PS
Sbjct  1    LWPFAHLITYGVVPVEQRLLWVDCIELIWVTILSTYSNEKSESRKSEEVSETAGSSTPS  59



>gb|ADM21186.1| peroxisomal membrane-like protein [Arabidopsis thaliana]
Length=245

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -1

Query  918  IDHNYWHGWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQ  757
            IDH+YW GWTL+EILRYAP+HNW AYE+ LK NPVLAKM ISG+VYSLGDWIAQ
Sbjct  157  IDHDYWQGWTLYEILRYAPEHNWFAYEQILKTNPVLAKMAISGIVYSLGDWIAQ  210



>ref|NP_001090480.1| uncharacterized protein LOC779393 [Xenopus laevis]
 gb|AAI23161.1| MGC154358 protein [Xenopus laevis]
Length=200

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 98/190 (52%), Gaps = 4/190 (2%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFE--FDRARMFRSGLTGFTLH  679
            W+ Y  AL+ NP+L K V S   ++LGD +AQ +   P  E  +D  R  R G  GF +H
Sbjct  6    WTKYNAALETNPLLIKAVTSLTGFTLGDILAQKFV-MPDKEKGYDLMRTVRLGSFGFLVH  64

Query  678  GSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSE  499
            G   HY+Y + +   P      V  KVA DQ +W+  +  ++F+ LG    +S   I ++
Sbjct  65   GPTGHYFYSWLDKQIPGTAMKTVATKVAIDQLLWNPCFGVMFFSYLGLAEGKSFADIQTK  124

Query  498  LKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEK-SEARI  322
            +K      +   W +W  AH + +  +P  QRLL+++ +++ +   LS   N+K  E  +
Sbjct  125  IKNDLTTAVVGSWTVWIPAHFVNFRFVPSSQRLLYINSIQIGYNIFLSFLGNKKVDEPEV  184

Query  321  SEESVEATSN  292
             +E+  A ++
Sbjct  185  VKEAEAAVTS  194



>ref|XP_002287363.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED94806.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=173

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 91/171 (53%), Gaps = 6/171 (4%)
 Frame = -1

Query  816  VLAKMVISGVVYSLGDWIAQCY---EGKPLFEFDRARMFRSGLTGFTLHGSLSHYYYHFC  646
            +L K + S   +++GD +AQ +   +GKP   +D  R  R G  GF +HG+  HY+Y F 
Sbjct  1    LLTKALTSFTGFTIGDILAQNFVNDDGKP---YDVMRTVRLGSFGFFIHGTTGHYFYGFL  57

Query  645  EALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTA  466
            ++ FP      V  KV  DQT+W+ I+  ++F  L  +  +S     +++KA     +  
Sbjct  58   DSKFPGTKPLTVATKVLIDQTIWNPIFGLMFFGYLNVMEGKSFEDYKNKIKADLKTAVMG  117

Query  465  GWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEE  313
             W +W  AH I +  IP +QRLL+++ +++ +   LS   N+K E    ++
Sbjct  118  SWAVWVPAHTINFAFIPPQQRLLYINSIQIGYNVFLSFLGNKKVEGDAEKK  168



>ref|XP_004359177.1| pmp22 family protein [Dictyostelium fasciculatum]
 gb|EGG21327.1| pmp22 family protein [Dictyostelium fasciculatum]
Length=194

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 90/193 (47%), Gaps = 8/193 (4%)
 Frame = -1

Query  879  ILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYE--------GKPLFEFD  724
            +L +  Q  W  Y  AL   P++ K + +G +   GD +AQ  E         K  FE+D
Sbjct  2    VLSFLNQVIWKPYIRALDRFPLIVKSLTTGTLMGTGDVMAQSIEYYRYGEKTKKKSFEWD  61

Query  723  RARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTV  544
              R       G    G + H++Y   + +F  +   VV  K+A DQ +++    S++  +
Sbjct  62   IGRTMTMSGVGLCFSGPVLHFWYRKLDRVFKGEGKIVVAKKLACDQLLFAPCVISVFMGI  121

Query  543  LGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVT  364
            +  L  +SP SI   +K    P L   W LWP A  +T+ VIP   R+L+V  V + W  
Sbjct  122  MDTLNHKSPNSILPRIKRDLPPALLVNWSLWPLAQTVTFSVIPPHLRVLFVSIVSVFWNI  181

Query  363  ILSTYSNEKSEAR  325
             LS   N+K + +
Sbjct  182  FLSQLGNKKDDQQ  194



>ref|XP_004345890.1| PXMP2/4 family protein 3, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR21346.1| PXMP2/4 family protein 3, putative [Acanthamoeba castellanii 
str. Neff]
Length=191

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 93/174 (53%), Gaps = 4/174 (2%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQ-CYEGKPLFEFDRARMFRSGLTGFTLHG  676
            W AY   L++ P+L K + S V+  LG+  AQ   E K L   D  R++R    G  L  
Sbjct  20   WEAYIFQLRKRPILTKALTSAVLSGLGNVAAQVAVERKGLRGLDVGRLWRFTALGLLLS-  78

Query  675  SLSHYYYHFCEALFPF-DDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSE  499
             +SHY + + E LF F      V  K+A DQ V+  I+N +++ ++  L  + P+++   
Sbjct  79   PVSHYKFLWLENLFRFARGKTAVYGKLAIDQLVFGPIFNVLFYVLMAILEGQ-PSAMGGL  137

Query  498  LKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEK  337
            +K+ FWP     WK+WP A  I++  +P E R+L+V+ V   WV ILS  +  K
Sbjct  138  IKSNFWPTTVNSWKVWPIASFISFNYVPAELRVLFVNVVAFFWVIILSGIAARK  191



>gb|EWM26132.1| mpv17-like protein [Nannochloropsis gaditana]
 gb|EWM26133.1| mpv17-like protein [Nannochloropsis gaditana]
Length=190

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 93/176 (53%), Gaps = 3/176 (2%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFE--FDRARMFRSGLTGFTLH  679
            WS Y  AL++NP+L K + S   +++GD +AQ +   P  E  +D  R  R G  GF +H
Sbjct  6    WSQYNVALEKNPLLIKALTSLTGFTIGDVLAQKFV-TPDEEKGYDLMRTVRLGSFGFLVH  64

Query  678  GSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSE  499
            G   H++Y + +   P      V  KVA DQ +W+  +  ++F+ LG    +S T I ++
Sbjct  65   GPTGHFFYGWLDKQIPGTAMKTVATKVAIDQLLWNPCFGVMFFSYLGLAEGKSFTDIQAK  124

Query  498  LKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSE  331
            +K      +   W +W  AH I +  +P  QRLL+++ +++ +   LS   N+K +
Sbjct  125  IKNDLATAVVGSWTVWIPAHFINFRFVPSNQRLLYINSIQIGYNIFLSFLGNKKVD  180



>gb|EJK66898.1| hypothetical protein THAOC_12131, partial [Thalassiosira oceanica]
Length=173

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 89/175 (51%), Gaps = 6/175 (3%)
 Frame = -1

Query  831  LKENPVLAKMVISGVVYSLGDWIAQCY---EGKPLFEFDRARMFRSGLTGFTLHGSLSHY  661
            L+  P+L K + S   +S+GD +AQ +   +GKP   +D  R  R G  GF +HG+  HY
Sbjct  1    LEAQPLLTKALTSLTGFSIGDILAQKFVNDDGKP---YDPMRTLRLGSFGFFVHGTTGHY  57

Query  660  YYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFW  481
            +Y F ++  P      V  KV  DQT+W+ I+  ++F  L     +S      ++KA   
Sbjct  58   FYGFLDSKLPGTKPQTVATKVLIDQTMWNPIFGLMFFGYLNVCEGKSFEEYTKKVKADLK  117

Query  480  PMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISE  316
              +   W +W  AH I +  +P  QRLL+++ +++ +   LS   N+K +    E
Sbjct  118  TAVMGSWAVWVPAHTINFAFVPPSQRLLYINSIQIGYNIFLSFLGNKKVDGEDKE  172



>ref|XP_007233539.1| PREDICTED: peroxisomal membrane protein 2-like [Astyanax mexicanus]
Length=194

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 92/178 (52%), Gaps = 7/178 (4%)
 Frame = -1

Query  864  PQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYE-------GKPLFEFDRARMFR  706
            P      Y   LK  P++ K V SG++ +LG+ ++Q  E       G+P  E D     R
Sbjct  14   PARLLQQYLILLKRYPIITKSVTSGILSALGNLLSQALESKKNRKEGRPAKEVDIHGPVR  73

Query  705  SGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRL  526
              + G  + G +SHY+YH  EALFP  + + +  ++  ++ V++  +  ++FTV+  L  
Sbjct  74   FAVYGLVITGPISHYFYHLLEALFPAAEPYCMLKRLLLERLVFAPAFLMLFFTVMNALEG  133

Query  525  ESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILST  352
            +S   +  ++K+ +WP L   WK+W     +    +PV+ R+L+ + + L W   L++
Sbjct  134  KSTAELQDKVKSRYWPALKMNWKVWTPFQFVNINFVPVQFRVLFANMIALFWYAYLAS  191



>gb|KIY95410.1| Protein sym1 [Monoraphidium neglectum]
Length=293

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 97/187 (52%), Gaps = 5/187 (3%)
 Frame = -1

Query  846  AYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGSLS  667
            AY  AL+E P+L K   S V + +GD IAQ +   P    D  R+ R G  G  + G L 
Sbjct  103  AYARALEERPLLTKACTSFVGFMIGDVIAQ-HVAHPGASLDALRVLRLGAYGLCIDGPLG  161

Query  666  HYYYHFCEALFPFDD---WWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSEL  496
              +Y + EA    D+      V  K A DQ V++++  +++F+V+  +    P ++ + +
Sbjct  162  ALWYDWLEANISPDNPKAMSTVLVKTALDQVVYASVGTALFFSVITLME-GRPGAVPAVV  220

Query  495  KATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISE  316
             A F P L A + +WP AHLI +  +P   R+ + + V + W+T+LS  ++ K  + ++ 
Sbjct  221  AAKFLPTLAANYAIWPLAHLINFRFVPAPYRIAYNNVVAIGWLTLLSAITHSKGSSVLTH  280

Query  315  ESVEATS  295
                ATS
Sbjct  281  LVGHATS  287



>ref|XP_009039064.1| hypothetical protein AURANDRAFT_29835, partial [Aureococcus anophagefferens]
 gb|EGB06108.1| hypothetical protein AURANDRAFT_29835, partial [Aureococcus anophagefferens]
Length=171

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 91/171 (53%), Gaps = 3/171 (2%)
 Frame = -1

Query  846  AYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGSLS  667
            +Y+EAL   P+L K   S V +++ D + Q +  K   +FD  R+ +    GF LHG+  
Sbjct  4    SYQEALDSKPILTKASTSLVGFAVSDAMTQAFIEKG--DFDLKRLVKMASFGFLLHGTTG  61

Query  666  HYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKAT  487
            HY+Y+F +++        V AKVA DQT+W+  +  ++FT +  L   +P  I ++ K  
Sbjct  62   HYFYNFLDSVMAGATPAFVAAKVAIDQTLWAPCFMVMFFTYM-MLFDGTPELIATKCKND  120

Query  486  FWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKS  334
             +  +   W  W  AH I +  +P + RLL+++ +++ +   +S   N+ +
Sbjct  121  IFTAVKGSWMTWIPAHTINFAFVPSDMRLLYINAIQIFFNMFMSVIGNKSA  171



>ref|XP_004350783.1| pmp22 family protein [Dictyostelium fasciculatum]
 gb|EGG14075.1| pmp22 family protein [Dictyostelium fasciculatum]
Length=198

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 95/183 (52%), Gaps = 4/183 (2%)
 Frame = -1

Query  888  LFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLF----EFDR  721
            LF  L    Q  +S Y +AL   P+L K V +G +Y + D I+Q  E +       +FD 
Sbjct  11   LFPRLSKFGQRAYSGYVDALHTKPILTKAVTTGTLYFISDTISQHLENRKKASDEWKFDY  70

Query  720  ARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVL  541
             R F+  + GF + G   H++YH  +  FP   +  V  K A DQ + + I+++++F  +
Sbjct  71   VRAFKFSVFGFVITGPTFHFWYHILDTSFPKKVFSHVIIKAALDQIICAPIFDAVFFMGM  130

Query  540  GFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTI  361
            G L  +S   I+++LK  +         +WP  +++++  I  +QR+L+++ V + W   
Sbjct  131  GVLDGKSKEDIYTKLKNDWLRTYLVDCAVWPICNIVSFRYISNKQRVLFMNIVNIGWAAF  190

Query  360  LST  352
            L++
Sbjct  191  LAS  193



>ref|XP_005782690.1| putative peroxisomal membrane protein [Emiliania huxleyi CCMP1516]
 gb|EOD30261.1| putative peroxisomal membrane protein [Emiliania huxleyi CCMP1516]
Length=346

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 105/218 (48%), Gaps = 10/218 (5%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W  Y E L E P+L K   S + +++GD +AQ +  K   +FD  R+FR    GF +HG+
Sbjct  100  WKKYNELLDEKPLLMKAFTSFLGFAIGDILAQIFIQKQ--DFDWYRLFRLASFGFLVHGT  157

Query  672  LSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELK  493
             SH++Y   ++  P      V  KV  DQ +W+ I+  ++F+ +  L  +    +  + +
Sbjct  158  SSHWFYGMLDSAIPGKGAQPVFTKVFIDQVLWNPIFGIMFFSYVACLEWKGLQYVIDKTR  217

Query  492  ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEE  313
                  +T  WK+WP AH I +  IP  QR+L+++ +++   T  S+ S+  +  R    
Sbjct  218  NELMTQVTGSWKVWPLAHAINFRFIPSSQRVLYINSIQM--ATTASSPSSRTATPRRRRL  275

Query  312  SVEATSNPPSVGPSQ*TDRKPRSGEKIGGRSVCVLLFL  199
               ++    +  P   T    RS  K    S C+ L L
Sbjct  276  GGASSRGRRAAAP---TGTASRSSAKP---SACLRLRL  307



>ref|XP_005788772.1| hypothetical protein EMIHUDRAFT_122535 [Emiliania huxleyi CCMP1516]
 gb|EOD36343.1| hypothetical protein EMIHUDRAFT_122535 [Emiliania huxleyi CCMP1516]
Length=417

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 100/207 (48%), Gaps = 25/207 (12%)
 Frame = -1

Query  864  PQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGK-PLFEFDRARMFRSGLTGF  688
            P    + Y +A +  P+L     S + Y++GD +AQ  EG+  +   D  R  R+   GF
Sbjct  163  PAGFLADYAQAAELAPLLTMACTSCLSYAVGDLVAQRVEGRWRVGLLDLRRCARNAALGF  222

Query  687  TLHGSLSHYYYHFCEALFPFDDWWVVPA-----------KVAFDQTVWSAIWNSIYFTVL  541
             LHG L  ++ +  E   P  D    PA           K+A DQT +SA+ N +Y ++ 
Sbjct  223  GLHGPLVFWWINVLEG--PLADLLGEPAGAAERWGGLLLKIALDQTFFSALINLLYASLN  280

Query  540  GFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYG-VIPVEQRLLWVDCVELIWVT  364
            G L  +     F+  +    P + + W+ WP   LI+Y  ++P++ +LLW+D +E++WV 
Sbjct  281  GLLSGDGAVEAFARARRVLVPAMVSSWRFWPAVQLISYSPLVPLDFKLLWIDTMEILWVA  340

Query  363  ILSTYSNEK----------SEARISEE  313
             LS   N             EAR++EE
Sbjct  341  YLSATVNSAPGSEPEAVPWGEARLAEE  367



>gb|EJK54998.1| hypothetical protein THAOC_25323 [Thalassiosira oceanica]
Length=238

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 93/183 (51%), Gaps = 4/183 (2%)
 Frame = -1

Query  879  ILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCY-EGKPLFEFDRARMFRS  703
            I R        +Y EAL +NP+  K + S V + LGD +AQ +  G P+   D  R+   
Sbjct  59   ITRGGAIPGLQSYSEALDKNPITMKALTSLVGWFLGDLLAQLFIAGGPV---DYKRLATL  115

Query  702  GLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLE  523
               GF  HG   HY+Y++ ++  P  D   V  KVA DQ  W  I+ S++FT LG +  +
Sbjct  116  SFFGFIYHGPSGHYFYNWLDSKIPGTDAAPVFTKVAIDQLFWCPIFMSVFFTYLGVVNGD  175

Query  522  SPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSN  343
            S  +I +++K          WK+WP  HLI +  +  + R+ +++ V++ +   LS   +
Sbjct  176  SLATIGNKIKNDLLTACQGSWKVWPIVHLINFRFVSNKWRIPYINAVQIAFNMFLSLLGS  235

Query  342  EKS  334
            + +
Sbjct  236  KSA  238



>ref|XP_005703050.1| peroxisomal membrane MPV17/PMP22-like protein [Galdieria sulphuraria]
 gb|EME26530.1| peroxisomal membrane MPV17/PMP22-like protein [Galdieria sulphuraria]
Length=202

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 94/194 (48%), Gaps = 16/194 (8%)
 Frame = -1

Query  888  LFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQC---YEGKPLFEFDRA  718
            + + LR+     W  Y  AL   P+  K+V S V  +LGD IAQ    YEG+    +D  
Sbjct  1    MLQRLRHHVGRLWYRYNRALATRPLPVKVVTSTVGLALGDVIAQLPLMYEGE---RWDVL  57

Query  717  RMFRSGLTGFTLHGSLSHYYYHFCE----ALFPFDDWWVVPAKVAFDQTVWSAIWNSIYF  550
            R  R    G  +HG LSH +Y F +    A  P   +  V AK   DQ +W+ ++ S++F
Sbjct  58   RTLRFSSFGLVVHGPLSHVWYQFLDKHILATAP-KSFRAVVAKTMMDQLLWAPVFTSVFF  116

Query  549  TVLGFLRLESPT--SIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  376
                +L+        I  E++   WP L   W +WP AH+  +  +P  QR+L+V+ + L
Sbjct  117  ---AYLKAAQGNWGDIIPEIRHKLWPTLKVNWLVWPAAHIFNFRFVPDSQRVLYVNIIAL  173

Query  375  IWVTILSTYSNEKS  334
             +   LS+ +  K 
Sbjct  174  GYNAFLSSMAATKK  187



>gb|EMT24041.1| hypothetical protein F775_24733 [Aegilops tauschii]
Length=139

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -1

Query  897  GWTLFEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQC  754
            GWT+FEILRY  +HNWSAYEEALK NPVLAKM+ISGVVYSLGDWIAQ 
Sbjct  24   GWTIFEILRYMSEHNWSAYEEALKANPVLAKMMISGVVYSLGDWIAQM  71



>ref|XP_005645051.1| hypothetical protein COCSUDRAFT_67394 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20507.1| hypothetical protein COCSUDRAFT_67394 [Coccomyxa subellipsoidea 
C-169]
Length=217

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 87/176 (49%), Gaps = 9/176 (5%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W AY  AL E P++ K   S   +  GD +AQ   G+    FD  R  R    G T+ G 
Sbjct  42   WRAYIRALDERPIMVKSATSFFGFLTGDLLAQGLAGR---GFDVFRCLRLLAFGVTMDGP  98

Query  672  LSHYYYHFCEALF----PFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIF  505
            + H +Y+F +       P  +  VV  K+  DQ +W+  ++ I+F     L    P +  
Sbjct  99   VGHVWYNFLDKNIMPKEPTSNKAVV-LKMLADQLLWAPFFSCIFFAFTNTL-AGHPEATI  156

Query  504  SELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEK  337
              ++    PM+ A + +WP AHLI +  IP +QR+L+++C+++ W   LS  S  +
Sbjct  157  PAIQNKLIPMMLANFAVWPIAHLINFKFIPSQQRILYINCIQVAWSAYLSNLSAAR  212



>ref|XP_005710823.1| unnamed protein product [Chondrus crispus]
 emb|CDF40529.1| unnamed protein product [Chondrus crispus]
Length=313

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 90/173 (52%), Gaps = 4/173 (2%)
 Frame = -1

Query  849  SAYEEALKENPVLAKMVISGVVYSLGDWIAQ--CYEGKPLFEFDRARMFRSGLTGFTLHG  676
            +AY  A+K NPV  K + +G++  LGD +AQ     G   F  D  R    G+ G    G
Sbjct  143  AAYVRAIKTNPVRTKALSTGLIAILGDLLAQKISQRGDGQFVLDMRRSASVGIWGLLALG  202

Query  675  SLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSEL  496
               HY+Y   + LF     + V +K+  DQ +++ + N+ +   +G L     + +   +
Sbjct  203  PALHYWYGILDRLFL--GRYAVISKLLSDQLLFAPVCNTAFMLGVGSLEGNPFSEVSKTV  260

Query  495  KATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEK  337
            +  FWP   A W LWP A L+ + ++P   ++++V+CV L+W  IL+  ++++
Sbjct  261  REKFWPSTKANWTLWPAAQLLNFSLVPKTFQIVYVNCVALVWSVILAYIAHDE  313



>ref|XP_002180247.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48438.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=179

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 84/177 (47%), Gaps = 14/177 (8%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQC-----------YEGKPLFEFDRARMFR  706
            W+AY +AL   P+  K + S V + LGD +AQ            + GK  F   R R   
Sbjct  1    WAAYNDALDSKPLFTKAMTSLVGWGLGDVLAQVRFDSRAQSMDQFTGKLSF---RTRFVT  57

Query  705  SGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRL  526
              + GF  HG   HY+Y++ +          V  KV  DQ +W  I+ +++FT LG    
Sbjct  58   LSVFGFIYHGPSGHYFYNWLDGKIKGTRAQDVALKVGIDQILWCPIFMTVFFTYLGLCNG  117

Query  525  ESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILS  355
            +S  +I +++K          WK+WP  H + +  I  + RL++++ V++ +   LS
Sbjct  118  DSFNTIGNKIKNDLLSACQGSWKVWPIVHAVNFKFISSKHRLVFINAVQVAFNMFLS  174



>ref|NP_001039473.1| peroxisomal membrane protein 2 [Bos taurus]
 ref|XP_010850755.1| PREDICTED: peroxisomal membrane protein 2 [Bison bison bison]
 sp|Q2KIY1.3|PXMP2_BOVIN RecName: Full=Peroxisomal membrane protein 2 [Bos taurus]
 gb|AAI12466.1| Peroxisomal membrane protein 2, 22kDa [Bos taurus]
 tpg|DAA20790.1| TPA: peroxisomal membrane protein 2 [Bos taurus]
Length=196

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 87/176 (49%), Gaps = 5/176 (3%)
 Frame = -1

Query  864  PQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFE-----FDRARMFRSG  700
            P+   S Y   L+  PVL K   SG++ +LG+++AQ  E K   E      D +   R  
Sbjct  18   PRRALSQYLRLLRLYPVLTKAATSGILSALGNFLAQLIEKKQKKENCSQKLDVSGPLRYA  77

Query  699  LTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLES  520
            + GF   G L H++Y   E   P +       ++  D+ +++  + S++F V+ FL  + 
Sbjct  78   IYGFFFTGPLGHFFYLLMERWIPSEVPLAGIKRLLLDRLLFAPAFLSLFFLVMNFLEGQD  137

Query  519  PTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILST  352
              +  +++K+ FWP L   W++W     I    IPV+ R+L+ + V L W   L++
Sbjct  138  TAAFAAKMKSGFWPALRMNWRVWTPVQFININYIPVQFRVLFANLVALFWYAYLAS  193



>ref|XP_007181381.1| PREDICTED: peroxisomal membrane protein 2 [Balaenoptera acutorostrata 
scammoni]
Length=196

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 86/176 (49%), Gaps = 5/176 (3%)
 Frame = -1

Query  864  PQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFE-----FDRARMFRSG  700
            PQ   + Y   L+  PVL K   SGV+ +LG+++AQ  E K   E      D     R  
Sbjct  18   PQRALAQYLRLLRLYPVLTKAATSGVLSALGNFLAQLIEKKQEKENCSQKLDVRGPLRYA  77

Query  699  LTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLES  520
            + GF   G L H++Y F E   P +       ++  D+ +++  + S++F ++ FL  + 
Sbjct  78   IYGFFFTGPLGHFFYLFMEHWIPPEAPLAGVTRLLLDRLLFAPAFLSLFFLIMNFLEGKD  137

Query  519  PTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILST  352
             T+  +++K  FWP L   W++W     I    +P++ R+L+     L W T L++
Sbjct  138  ATAFAAKMKRGFWPALQMNWRVWTPVQFINVNYVPLQFRVLFASLAALFWYTYLAS  193



>gb|EFA78150.1| pmp22 family protein [Polysphondylium pallidum PN500]
Length=537

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 89/192 (46%), Gaps = 7/192 (4%)
 Frame = -1

Query  885  FEILRYAPQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEG-------KPLFEF  727
             +I  +  +  W+ Y  AL  +P++ K + +GV+   GD +AQ  E        K  F++
Sbjct  346  MKIFSFLNRKLWNPYLRALDSHPLITKSITTGVLMGTGDVLAQSIEHYTNDDKHKKKFKW  405

Query  726  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFT  547
            D  R       G    G   H++Y   + L   +   VV  K+AFDQ  ++ +  S +  
Sbjct  406  DTKRTLTMTSVGMVFSGPCLHFWYKTLDRLVVGEGAMVVAKKIAFDQIAFAPVVISAFIF  465

Query  546  VLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWV  367
            ++  +  ++P+   + +K      L A W LWP A +I + ++P   R+L+V  V + W 
Sbjct  466  IMNSINGKTPSQSLTTIKTDLPSALKANWSLWPMAQIICFSIVPPSLRVLYVSTVSVFWN  525

Query  366  TILSTYSNEKSE  331
              LS   N+  +
Sbjct  526  IFLSQLGNKHKK  537



>ref|XP_005651770.1| hypothetical protein COCSUDRAFT_55247 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27226.1| hypothetical protein COCSUDRAFT_55247 [Coccomyxa subellipsoidea 
C-169]
Length=292

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 88/178 (49%), Gaps = 11/178 (6%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            W  Y   ++ +PV  K + S   + LGD++AQ  EG+P   F+  R  R G  G T+ G 
Sbjct  36   WRNYSRKVETDPVPTKALTSLFGFMLGDFLAQRMEGRP---FNPLRCLRLGSYGLTVDGP  92

Query  672  LSHYYYHFCEA-LFPFDDWW--VVPAKVAFDQTVWSAIWNSIYFTVLGFLRLES--PTSI  508
            + H +Y   +  ++P D      V  K A DQ +W+ +   +YF    FLR     P  I
Sbjct  93   IGHMWYKLLDKFVYPNDPQCNAAVLLKTAADQLLWAPVMTCVYF---AFLRTVEGHPELI  149

Query  507  FSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKS  334
             S ++A     + A + LWP AH I +  +P + R+L+ + V + W   LST S+  +
Sbjct  150  TSTIQAKLVQTVVANYVLWPAAHYINFKFVPTQHRILYNNVVSIFWNAFLSTLSHAPT  207



>gb|AGO13267.1| AaceriAFR120Cp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=182

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 86/176 (49%), Gaps = 5/176 (3%)
 Frame = -1

Query  843  YEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGSLSH  664
            Y+ +L+ +P     + +G+++ LGD +AQ    +P   +D  R  R  L G  L   +  
Sbjct  8    YKASLQTHPKRTNALTTGLLFGLGDIVAQTQFPEPGASYDPMRTLRPFLYGAMLFSLVGD  67

Query  663  YYYHFCEAL----FPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSEL  496
             +Y F   L     P   W  V A+VA DQ V++ I   +YFT +  +   +   +   L
Sbjct  68   KWYRFLSTLRVGGLPQGHWGNVLARVACDQLVFAPIGVPLYFTAMALMEGGTLEDVRIRL  127

Query  495  KATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEA  328
               +W  L A W +WP   L  + ++PV+ RLL V+ + + W T LS YSN  + +
Sbjct  128  SEKWWSTLLANWLVWPAFQLCNFSLVPVQHRLLTVNVLAIFWNTYLS-YSNSTASS  182



>gb|ESX01924.1| Protein required for ethanol metabolism [Ogataea parapolymorpha 
DL-1]
Length=188

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 90/182 (49%), Gaps = 7/182 (4%)
 Frame = -1

Query  849  SAYEEALKENPVLAKMVISGVVYSLGDWIAQ-CYEGKPLFEFDRARMFRSGLTGFTLHGS  673
            S Y+      P++A M+ +G+++  GD +AQ C+   P  ++D  R  R+ + G  + G 
Sbjct  3    SGYKTFFARRPLMANMISTGILFGTGDALAQICFPQDPKAKYDYLRTMRAVIYGGAVFGP  62

Query  672  LSHYYYHFCEAL-FPF----DDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSI  508
            + +  Y F + + FP        +   A+V+FDQ VW+ I   +Y++ +  +       I
Sbjct  63   IGNRLYKFVDTIKFPLPWQPKRLYDTIARVSFDQLVWAPIGIPLYYSCITLMEGYGIPEI  122

Query  507  FSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEA  328
             ++L+  +   L   WK+WP      +   PV  RLL V+ + ++W   LS   N+ S A
Sbjct  123  KAKLREVYLDTLINNWKVWPLFQAFNFWFTPVRYRLLAVNIISIVWNCYLSI-ENQMSNA  181

Query  327  RI  322
            ++
Sbjct  182  KV  183



>ref|XP_003384042.1| PREDICTED: protein SYM1-like [Amphimedon queenslandica]
Length=213

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 86/168 (51%), Gaps = 5/168 (3%)
 Frame = -1

Query  843  YEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGSLSH  664
            Y   L++ PV+ K + SG+++ LGD I Q    +   + + AR+ R+ + G  + G L+H
Sbjct  37   YNSQLEKAPVITKSITSGILFGLGDVIGQFILPEENGKLNFARVGRAAVFGSLILGPLAH  96

Query  663  YYYHFCEAL----FPFDDWWVVPAKVAFDQ-TVWSAIWNSIYFTVLGFLRLESPTSIFSE  499
             +++F E +           +   K+ FDQ T W+   N+IY   L  L  ++       
Sbjct  97   LHFNFLEYMVVKRLALTGTRMAFLKMFFDQFTYWAISINTIYLFTLPKLEGKTNDQAMDN  156

Query  498  LKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILS  355
            ++A  WP + A W LWP A LI + +IPV  +L +V  V L W + LS
Sbjct  157  VRARIWPTMKANWCLWPIAQLINFKLIPVAHQLNFVLIVSLGWASYLS  204



>ref|XP_006298370.1| hypothetical protein CARUB_v10014441mg [Capsella rubella]
 gb|EOA31268.1| hypothetical protein CARUB_v10014441mg [Capsella rubella]
Length=258

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 79/183 (43%), Gaps = 0/183 (0%)
 Frame = -1

Query  843  YEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGSLSH  664
            Y   +K  PVL K V S ++Y   D  +Q         +D  R  R G  G  + G   H
Sbjct  75   YLGMVKSRPVLTKSVTSSLIYIAADLSSQTIAKNSSESYDLVRTARMGGYGLVVLGPTLH  134

Query  663  YYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATF  484
            Y+++F   LFP  D      K+A  QT++      I+F++   L+ ES + I   LK   
Sbjct  135  YWFNFMSRLFPKKDLITTFKKIAMGQTIYGPTMTFIFFSLNASLQGESGSDILGRLKRDL  194

Query  483  WPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVE  304
             P+L  G   WP    IT+   PV  + L  +    +W+   +  +N K    IS  + +
Sbjct  195  VPVLCNGVMYWPSCDFITFRFFPVHLQPLVTNSFSYVWIIYTTYMANRKKPDEISNRNTQ  254

Query  303  ATS  295
              S
Sbjct  255  ICS  257



>ref|XP_009657846.1| SYM1 protein [Verticillium dahliae VdLs.17]
 gb|EGY15683.1| SYM1 protein [Verticillium dahliae VdLs.17]
Length=172

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 89/171 (52%), Gaps = 5/171 (3%)
 Frame = -1

Query  843  YEEALKENPVLAKMVISGVVYSLGDWIAQ-CYEGKPLFEFDRARMFRSGLTGFTLHGSLS  667
            Y+  L   P+L + + +G++++ GD +AQ   E K   ++D AR  R  L G ++ G ++
Sbjct  5    YQARLAARPLLTQSITTGILFATGDIVAQQAIEKKGTKDYDLARTGRMALYGGSVFGPVA  64

Query  666  HYYYHFCEALFPFDDWWVVP-AKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKA  490
              ++ F      F         +VA DQ V++ +   ++ + +  L   SP +   +L+ 
Sbjct  65   TTWFGFLARNVNFRSTAATTIGRVATDQLVFAPVMIGVFLSSMATLEGTSPKA---KLEK  121

Query  489  TFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEK  337
            ++WP LTA W +WP      + ++P++ RLL+V+ + + W   LS  ++ K
Sbjct  122  SYWPALTANWLIWPAVQAFNFALVPLQHRLLFVNVISIGWNCFLSALNSAK  172



>ref|XP_006078314.1| PREDICTED: peroxisomal membrane protein 2 [Bubalus bubalis]
Length=196

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 86/176 (49%), Gaps = 5/176 (3%)
 Frame = -1

Query  864  PQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFE-----FDRARMFRSG  700
            P+   S Y   L+  PVL K   SG++ +LG+++AQ  E +   E      D +   R  
Sbjct  18   PRRALSQYLRLLRLYPVLTKAATSGILSALGNFLAQLIEKQQKKENCSQKLDVSGPLRYA  77

Query  699  LTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLES  520
            + GF   G L H++Y   E   P +       ++  D+ +++  + S++F V+ FL  + 
Sbjct  78   IYGFFFTGPLGHFFYLLMERWIPSEVPLASIKRLLLDRLLFAPAFLSLFFLVMNFLEGQD  137

Query  519  PTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILST  352
              +  +++K+ FWP L   W++W     I    IPV+ R+L+ +   L W   L++
Sbjct  138  TAAFAAKMKSGFWPALRMNWRVWTPVQFININYIPVQFRVLFANLAALFWYAYLAS  193



>ref|XP_004332855.1| protein sym1, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR10842.1| protein sym1, putative [Acanthamoeba castellanii str. Neff]
Length=190

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/194 (26%), Positives = 89/194 (46%), Gaps = 13/194 (7%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCY------EGKPLFEFDRARMFRSGLTG  691
            W+AY   L+  P+  K + +G +  LGD + Q            ++ +D  R  R G  G
Sbjct  2    WAAYRTLLERRPLATKALTAGAIMGLGDAMQQLVIERTHTPAGGVWRYDALRTARQGAFG  61

Query  690  FTLHGSLSHYYYHFCEALFPFDDWWVVP-AKVAFDQTVWSAIWNSIYFTVLGFLRLESPT  514
                G + H ++   + + P     V P  KV  DQ +   +    +F+++G +  +SP 
Sbjct  62   VFFIGPVMHKWFAILDKVVPASK--VGPLVKVGLDQAIIGPLVCFSFFSLMGLMEGQSPA  119

Query  513  SIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKS  334
             I ++LK  FWP L   WK+WP   L  + ++P+  R+LW +  +  W    S Y + ++
Sbjct  120  QIENKLKNHFWPTLVMNWKVWPAIQLANFYLVPLPLRVLWANLGQFGW----SMYLSHQA  175

Query  333  EARISEESVEATSN  292
               +    V A+ +
Sbjct  176  HKDVDHVPVPASRD  189



>ref|XP_009032753.1| hypothetical protein AURANDRAFT_19073 [Aureococcus anophagefferens]
 gb|EGB13157.1| hypothetical protein AURANDRAFT_19073 [Aureococcus anophagefferens]
Length=175

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 76/164 (46%), Gaps = 5/164 (3%)
 Frame = -1

Query  843  YEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDR-ARMFRSGLTGFTLHGSLS  667
            Y+  L  +P++ K V S  ++ +GD +AQ  EG    +  R ARM   G     L  + S
Sbjct  11   YDAHLTTSPIVTKSVTSCGLFGVGDGLAQGIEGGEAVDGGRLARMMTFG----GLVATPS  66

Query  666  HYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKAT  487
            H++Y+F + L        V  KV  DQ  W+ +    +F         + +    +    
Sbjct  67   HHWYNFLDRLVTGAGGGAVARKVLLDQLTWTPVMTFSFFNFQNVCGGMAVSESVPDASGK  126

Query  486  FWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILS  355
              P L   W +WPF H++T+G +P+  R+LW++C    W   LS
Sbjct  127  LLPTLKVNWVVWPFVHVVTFGAVPLPYRILWINCCSCFWSAYLS  170



>gb|KIY95774.1| Protein SYM1 [Monoraphidium neglectum]
Length=168

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 80/156 (51%), Gaps = 4/156 (3%)
 Frame = -1

Query  777  LGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGSLSHYYYHFCE-ALFPFD--DWWVVP  607
            LGD IAQ     P   FD  R+ R GL G  L G L   +Y + E A+FP    +   V 
Sbjct  2    LGDIIAQQVGHHPGAGFDVLRVARLGLYGLCLDGPLGSAWYDWLEGAVFPNSPTEAKAVA  61

Query  606  AKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITY  427
            AK   DQ V+++I   ++F V+  L    P    S + A FWP L A W +WP AH++ +
Sbjct  62   AKTLLDQVVYASIGTGLFFAVITALE-GHPELAPSVVAAKFWPTLAANWAIWPAAHIVNF  120

Query  426  GVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARIS  319
              +P + R+ + + V + W+ +LS  ++    + I+
Sbjct  121  RFVPSQFRIAYNNVVAIGWLALLSAITHSHGPSLIN  156



>emb|CDX71197.1| BnaC07g04760D [Brassica napus]
Length=247

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 81/178 (46%), Gaps = 0/178 (0%)
 Frame = -1

Query  843  YEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFEFDRARMFRSGLTGFTLHGSLSH  664
            Y   +K  PV+ K V S ++Y   D  +Q    +    +D  R  R G  G  + G   H
Sbjct  69   YLGMVKSRPVITKSVTSSIIYIAADLSSQIISKRSSESYDMLRTARMGGYGLLVLGPTLH  128

Query  663  YYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATF  484
            Y+++F   LFP  D      K+A  QT++  I   ++F++   L+ ES + I + LK   
Sbjct  129  YWFNFMSRLFPKQDLITTFKKMAMGQTIYGPIMTVVFFSLNATLQGESGSDIVARLKRDV  188

Query  483  WPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEES  310
             P +  G   WP    IT+   PV  + L  +    +W   ++  +N +  A IS E+
Sbjct  189  IPAMFNGVMYWPICDFITFRFFPVHLQPLVSNSFSYLWTIYMTYMANREKPAVISAET  246



>ref|XP_006209527.1| PREDICTED: peroxisomal membrane protein 2 [Vicugna pacos]
Length=196

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 87/176 (49%), Gaps = 5/176 (3%)
 Frame = -1

Query  864  PQHNWSAYEEALKENPVLAKMVISGVVYSLGDWIAQCYEGKPLFE-----FDRARMFRSG  700
            P+   + Y   L+  PVL K   SG++ +LG+ +AQ  E K   E      D +   R  
Sbjct  18   PRRALAQYLRLLRLYPVLTKAATSGILSALGNLLAQMIEKKQKKENCSQKLDVSGPLRYA  77

Query  699  LTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLES  520
            + GF   G LSH+++ F E   P +   V   ++  D+ +++  +  ++F V+ FL  + 
Sbjct  78   IFGFFFTGPLSHFFFVFMEHWIPSEVPLVGVKRLLLDRFLFAPAFLLLFFLVMNFLEGKD  137

Query  519  PTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILST  352
              +  +++K  FWP L   W++W     I    +P++ R+L+ + V L W   L++
Sbjct  138  AAAFAAKMKGGFWPALQTNWRVWTPVQFININYVPLQFRVLFANVVALFWYAYLAS  193



>ref|XP_001691305.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP05038.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=187

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 83/183 (45%), Gaps = 17/183 (9%)
 Frame = -1

Query  852  WSAYEEALKENPVLAKMVISGVVYSLGDWIAQCY-------------EGKPLFEFDRARM  712
            W+ Y  +L  +PVL K+    V   LGD +AQ               E  P F +D  R 
Sbjct  5    WAFYNTSLDAHPVLTKIATGVVGTILGDLLAQRLSHHHEEQAARSRGEPAPAFVYDLGRT  64

Query  711  FRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPA---KVAFDQTVWSAIWNSIYFTVL  541
             R    G  +   + H ++ F +     D    +PA   K+  DQ V S +  +++F V+
Sbjct  65   ARLVAYGVVVSTPVGHLWFKFLDTSVMPDAMTSMPAVVTKMVLDQLVMSPLSTALFFMVM  124

Query  540  GFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTI  361
                   P   F  ++    P L A + LWP AH+I + ++P  QR+L+ + V LIW  I
Sbjct  125  RAWE-GHPQDAFRYMRGKMVPTLKANYLLWPLAHIINFALVPPSQRILYCNAVGLIWTVI  183

Query  360  LST  352
            LST
Sbjct  184  LST  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2065028817815