BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF039E03

Length=824
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009781597.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    389   7e-124   Nicotiana sylvestris
ref|XP_009781599.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    389   8e-124   Nicotiana sylvestris
ref|XP_009781598.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    387   2e-123   Nicotiana sylvestris
ref|XP_009617761.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    383   7e-122   Nicotiana tomentosiformis
ref|XP_009617762.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    383   7e-122   
ref|XP_009367708.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    378   4e-120   Pyrus x bretschneideri [bai li]
ref|XP_009367706.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    378   5e-120   Pyrus x bretschneideri [bai li]
ref|XP_006341445.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     377   1e-119   
ref|XP_004235864.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    377   2e-119   Solanum lycopersicum
ref|XP_010318682.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    377   3e-119   Solanum lycopersicum
ref|XP_008235714.1|  PREDICTED: poly [ADP-ribose] polymerase 1          375   7e-119   Prunus mume [ume]
gb|EYU46476.1|  hypothetical protein MIMGU_mgv1a000724mg                375   1e-118   Erythranthe guttata [common monkey flower]
gb|ACN36904.1|  unknown                                                 351   3e-118   Zea mays [maize]
ref|XP_007199702.1|  hypothetical protein PRUPE_ppa000811mg             374   3e-118   
gb|KDP21330.1|  hypothetical protein JCGZ_21801                         373   3e-118   Jatropha curcas
gb|KDO68484.1|  hypothetical protein CISIN_1g035625mg                   372   4e-118   Citrus sinensis [apfelsine]
ref|XP_002521021.1|  poly [ADP-ribose] polymerase, putative             372   1e-117   Ricinus communis
ref|XP_011080022.1|  PREDICTED: poly [ADP-ribose] polymerase 1          372   1e-117   Sesamum indicum [beniseed]
ref|XP_010274828.1|  PREDICTED: poly [ADP-ribose] polymerase 1          369   1e-116   Nelumbo nucifera [Indian lotus]
ref|XP_006443872.1|  hypothetical protein CICLE_v10018683mg             369   2e-116   Citrus clementina [clementine]
ref|XP_011457987.1|  PREDICTED: poly [ADP-ribose] polymerase 1          369   2e-116   Fragaria vesca subsp. vesca
emb|CDY24761.1|  BnaC04g13660D                                          367   3e-116   Brassica napus [oilseed rape]
ref|XP_009144225.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    368   4e-116   Brassica rapa
ref|XP_009144226.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    368   4e-116   Brassica rapa
ref|XP_010918778.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     367   4e-116   
ref|XP_009354923.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     367   7e-116   Pyrus x bretschneideri [bai li]
ref|XP_010652358.1|  PREDICTED: poly [ADP-ribose] polymerase 1          366   2e-115   Vitis vinifera
gb|KEH23887.1|  poly(ADP-ribose) polymerase domain protein              366   2e-115   Medicago truncatula
ref|XP_010522166.1|  PREDICTED: poly [ADP-ribose] polymerase 1          365   3e-115   Tarenaya hassleriana [spider flower]
ref|XP_006293618.1|  hypothetical protein CARUB_v10022570mg             365   5e-115   Capsella rubella
ref|XP_010038006.1|  PREDICTED: poly [ADP-ribose] polymerase 1          365   7e-115   Eucalyptus grandis [rose gum]
ref|XP_004493762.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     365   9e-115   
ref|XP_010679215.1|  PREDICTED: poly [ADP-ribose] polymerase 1          364   1e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003521279.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    364   1e-114   Glycine max [soybeans]
ref|XP_003554282.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     364   1e-114   Glycine max [soybeans]
ref|NP_850165.1|  poly [ADP-ribose] polymerase 2                        364   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007162524.1|  hypothetical protein PHAVU_001G159200g             364   2e-114   Phaseolus vulgaris [French bean]
emb|CDY10794.1|  BnaA05g11420D                                          369   3e-114   Brassica napus [oilseed rape]
gb|KFK31229.1|  hypothetical protein AALP_AA6G085200                    363   3e-114   Arabis alpina [alpine rockcress]
ref|XP_008461881.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    362   3e-114   Cucumis melo [Oriental melon]
gb|AAD20677.1|  putative poly (ADP-ribose) polymerase                   363   4e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933094.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    363   4e-114   Elaeis guineensis
gb|EMS59387.1|  Poly [ADP-ribose] polymerase 1                          348   6e-114   Triticum urartu
ref|XP_002881169.1|  hypothetical protein ARALYDRAFT_902162             362   7e-114   Arabidopsis lyrata subsp. lyrata
ref|XP_008461880.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    362   9e-114   Cucumis melo [Oriental melon]
ref|XP_008461878.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    362   1e-113   Cucumis melo [Oriental melon]
ref|XP_010469693.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     361   1e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010510210.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     361   1e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010414140.1|  PREDICTED: poly [ADP-ribose] polymerase 1          360   2e-113   Camelina sativa [gold-of-pleasure]
ref|XP_009398035.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    360   3e-113   
ref|XP_009398034.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    360   4e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008801332.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     358   5e-113   Phoenix dactylifera
ref|XP_008794292.1|  PREDICTED: poly [ADP-ribose] polymerase 1          359   6e-113   Phoenix dactylifera
ref|XP_004151977.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     359   9e-113   Cucumis sativus [cucumbers]
gb|KJB42240.1|  hypothetical protein B456_007G144300                    359   1e-112   Gossypium raimondii
gb|ADE76583.1|  unknown                                                 343   4e-112   Picea sitchensis
ref|XP_004959167.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     354   6e-112   
emb|CAA10889.1|  poly(ADP-ribose) polymerase                            353   1e-110   Zea mays [maize]
ref|XP_007050347.1|  Poly(ADP-ribose) polymerase 2 isoform 1            353   1e-110   
tpg|DAA39431.1|  TPA: hypothetical protein ZEAMMB73_927988              353   1e-110   
ref|XP_002459755.1|  hypothetical protein SORBIDRAFT_02g009900          352   1e-110   
ref|NP_001288538.1|  poly [ADP-ribose] polymerase 1                     353   1e-110   Zea mays [maize]
ref|XP_007050348.1|  Poly(ADP-ribose) polymerase 2 isoform 2            353   1e-110   
gb|EPS63698.1|  hypothetical protein M569_11084                         353   1e-110   Genlisea aurea
gb|EMT10594.1|  Poly (ADP-ribose) polymerase 1                          342   7e-110   
ref|XP_006657714.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     350   2e-109   Oryza brachyantha
gb|EEC81908.1|  hypothetical protein OsI_25738                          349   5e-109   Oryza sativa Indica Group [Indian rice]
ref|NP_001059453.1|  Os07g0413700                                       349   7e-109   
ref|XP_011028774.1|  PREDICTED: poly [ADP-ribose] polymerase 1          345   2e-107   Populus euphratica
ref|XP_002302058.2|  poly (ADP-ribose) polymerase family protein        345   3e-107   
emb|CDP03723.1|  unnamed protein product                                344   5e-107   Coffea canephora [robusta coffee]
emb|CAN75718.1|  hypothetical protein VITISV_037618                     344   7e-107   Vitis vinifera
ref|XP_006410264.1|  hypothetical protein EUTSA_v10016190mg             343   1e-106   
ref|XP_003557295.1|  PREDICTED: poly [ADP-ribose] polymerase 1          342   2e-106   Brachypodium distachyon [annual false brome]
gb|KHN10726.1|  Poly [ADP-ribose] polymerase 1                          347   7e-106   Glycine soja [wild soybean]
ref|XP_006827511.1|  hypothetical protein AMTR_s00009p00184050          328   4e-102   
ref|XP_010111892.1|  Poly [ADP-ribose] polymerase 1                     328   7e-101   
ref|XP_002969183.1|  hypothetical protein SELMODRAFT_90144              310   2e-94    
ref|XP_002973881.1|  hypothetical protein SELMODRAFT_100128             310   3e-94    
ref|XP_001769461.1|  predicted protein                                  306   8e-93    
pdb|2RD6|A  Chain A, Parp Complexed With A861695                        267   7e-84    Homo sapiens [man]
pdb|1UK0|A  Chain A, Crystal Structure Of Catalytic Domain Of Hum...    267   8e-84    Homo sapiens [man]
pdb|4L6S|A  Chain A, Parp Complexed With Benzo[1,4]oxazin-3-one I...    267   8e-84    Homo sapiens [man]
pdb|4GV7|A  Chain A, Human Artd1 (parp1) - Catalytic Domain In Co...    267   8e-84    Homo sapiens [man]
pdb|4HHY|A  Chain A, Crystal Structure Of Parp Catalytic Domain I...    267   1e-83    Homo sapiens [man]
pdb|4PJT|A  Chain A, Structure Of Parp1 Catalytic Domain Bound To...    267   1e-83    Homo sapiens [man]
gb|KFB53217.1|  AGAP003230-PA-like protein                              266   2e-83    Anopheles sinensis
ref|XP_005809620.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     258   4e-82    
emb|CAA46478.1|  Poly(ADP-ribose) polymerase                            266   6e-82    Rattus norvegicus [brown rat]
ref|XP_004333519.1|  Poly(ADPribose) polymerase catalytic domain ...    272   1e-81    Acanthamoeba castellanii str. Neff
pdb|4DQY|C  Chain C, Structure Of Human Parp-1 Bound To A Dna Dou...    265   2e-81    Homo sapiens [man]
dbj|BAE88881.1|  unnamed protein product                                263   2e-81    Macaca fascicularis [crab eating macaque]
pdb|4OPX|C  Chain C, Structure Of Human Parp-1 Bound To A Dna Dou...    265   2e-81    Homo sapiens [man]
ref|XP_011165140.1|  PREDICTED: poly [ADP-ribose] polymerase-like       275   2e-81    Solenopsis invicta [imported red fire ant]
gb|AAA51599.1|  poly(ADP-ribose) polymerase                             266   9e-81    Homo sapiens [man]
ref|XP_002163577.2|  PREDICTED: poly [ADP-ribose] polymerase 1-like     260   9e-81    Hydra vulgaris
gb|AAF61293.1|AF126717_1  msPARP                                        263   9e-81    Mus musculus [mouse]
gb|AAB35557.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            266   1e-80    Mus sp. [mice]
ref|XP_011063716.1|  PREDICTED: poly [ADP-ribose] polymerase isof...    270   2e-79    Acromyrmex echinatior
ref|XP_011254366.1|  PREDICTED: poly [ADP-ribose] polymerase            269   2e-79    Camponotus floridanus
ref|XP_006744107.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   9e-79    Leptonychotes weddellii
pdb|1EFY|A  Chain A, Crystal Structure Of The Catalytic Fragment ...    254   1e-78    Gallus gallus [bantam]
gb|AAB35558.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            261   1e-78    Bos taurus [bovine]
pdb|1A26|A  Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) P...    254   1e-78    Gallus gallus [bantam]
gb|AAB35560.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            260   2e-78    Xenopus
ref|XP_003396806.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    267   2e-78    
ref|XP_007253978.1|  PREDICTED: poly [ADP-ribose] polymerase 1          267   2e-78    
ref|XP_010158766.1|  PREDICTED: poly [ADP-ribose] polymerase 1          249   2e-78    Eurypyga helias
ref|XP_005906361.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     261   3e-78    Bos mutus
ref|NP_037195.1|  poly [ADP-ribose] polymerase 1                        266   4e-78    Rattus norvegicus [brown rat]
ref|XP_008559441.1|  PREDICTED: poly [ADP-ribose] polymerase-like       265   6e-78    Microplitis demolitor
ref|XP_004605484.1|  PREDICTED: poly [ADP-ribose] polymerase 1          265   9e-78    Sorex araneus [Eurasian shrew]
gb|ERE73581.1|  poly [ADP-ribose] polymerase 1                          264   1e-77    Cricetulus griseus [Chinese hamsters]
ref|XP_009960357.1|  PREDICTED: poly [ADP-ribose] polymerase 1          249   1e-77    Leptosomus discolor
ref|XP_003999138.2|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    265   1e-77    
gb|ABM82562.1|  poly (ADP-ribose) polymerase family, member 1           265   1e-77    synthetic construct
ref|XP_011138702.1|  PREDICTED: poly [ADP-ribose] polymerase            265   1e-77    
ref|XP_007071821.1|  PREDICTED: poly [ADP-ribose] polymerase 1          265   1e-77    
gb|AAB59447.1|  poly(ADP-ribose) synthetase                             265   1e-77    Homo sapiens [man]
ref|XP_011289117.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    265   1e-77    
ref|XP_003275213.1|  PREDICTED: poly [ADP-ribose] polymerase 1          264   1e-77    
gb|AAA60137.1|  poly(ADP-ribose) polymerase                             265   1e-77    Homo sapiens [man]
dbj|BAG35260.1|  unnamed protein product                                265   1e-77    Homo sapiens [man]
gb|AAH37545.1|  Poly (ADP-ribose) polymerase 1                          265   1e-77    Homo sapiens [man]
ref|NP_001609.2|  poly [ADP-ribose] polymerase 1                        265   1e-77    Homo sapiens [man]
dbj|BAG10250.1|  poly [ADP-ribose] polymerase-1                         265   1e-77    synthetic construct
ref|XP_003424731.1|  PREDICTED: poly [ADP-ribose] polymerase            264   2e-77    Nasonia vitripennis
dbj|BAE35080.1|  unnamed protein product                                265   2e-77    Mus musculus [mouse]
dbj|BAE27352.1|  unnamed protein product                                265   2e-77    Mus musculus [mouse]
dbj|BAE41080.1|  unnamed protein product                                265   2e-77    Mus musculus [mouse]
dbj|BAE39743.1|  unnamed protein product                                264   2e-77    Mus musculus [mouse]
ref|NP_031441.2|  poly [ADP-ribose] polymerase 1                        264   2e-77    Mus musculus [mouse]
ref|XP_001177436.2|  PREDICTED: poly [ADP-ribose] polymerase 1-like     264   2e-77    
ref|XP_009976244.1|  PREDICTED: poly [ADP-ribose] polymerase 1          249   2e-77    Tauraco erythrolophus
ref|XP_005289623.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    264   2e-77    
ref|XP_011232467.1|  PREDICTED: poly [ADP-ribose] polymerase 1          264   2e-77    
ref|XP_004354000.1|  Poly(ADPribose) polymerase catalytic domain ...    246   2e-77    Acanthamoeba castellanii str. Neff
ref|XP_005289622.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    264   2e-77    Chrysemys picta bellii
gb|EFB29647.1|  hypothetical protein PANDA_016433                       264   2e-77    Ailuropoda melanoleuca
ref|XP_004375937.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    264   2e-77    Trichechus manatus latirostris
gb|EGW11182.1|  Poly [ADP-ribose] polymerase 1                          263   3e-77    Cricetulus griseus [Chinese hamsters]
sp|P11103.3|PARP1_MOUSE  RecName: Full=Poly [ADP-ribose] polymera...    264   3e-77    Mus musculus [mouse]
ref|XP_010589425.1|  PREDICTED: poly [ADP-ribose] polymerase 1          264   3e-77    
ref|NP_001233650.1|  poly [ADP-ribose] polymerase 1                     264   3e-77    Cricetulus griseus [Chinese hamsters]
ref|XP_004065376.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    264   3e-77    
ref|XP_010972367.1|  PREDICTED: poly [ADP-ribose] polymerase 1          264   3e-77    Camelus bactrianus [camel]
ref|XP_002809428.2|  PREDICTED: poly [ADP-ribose] polymerase 1          263   3e-77    
ref|XP_003487068.1|  PREDICTED: poly [ADP-ribose] polymerase-like       263   3e-77    Bombus impatiens
ref|XP_002760624.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   3e-77    Callithrix jacchus [common marmoset]
ref|XP_006118141.1|  PREDICTED: poly [ADP-ribose] polymerase 1          264   4e-77    
ref|XP_005078195.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   4e-77    Mesocricetus auratus [Syrian golden hamster]
ref|XP_006897812.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   4e-77    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_009025261.1|  hypothetical protein HELRODRAFT_95414              263   4e-77    Helobdella robusta
ref|XP_011499146.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    263   4e-77    Ceratosolen solmsi marchali
ref|XP_009808696.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     250   4e-77    Gavia stellata
ref|XP_010990763.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   5e-77    Camelus dromedarius [camel]
ref|XP_006188179.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   5e-77    Camelus ferus
ref|XP_003357689.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   5e-77    
dbj|BAG64403.1|  unnamed protein product                                263   5e-77    Homo sapiens [man]
ref|XP_004690817.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   5e-77    
ref|XP_004653313.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   6e-77    Jaculus jaculus
ref|XP_005349022.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   7e-77    Microtus ochrogaster [prairie voles]
ref|XP_003930339.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   7e-77    Saimiri boliviensis boliviensis
ref|XP_006198888.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   7e-77    Vicugna pacos
ref|XP_003814976.1|  PREDICTED: poly [ADP-ribose] polymerase 1          263   8e-77    Pan paniscus [bonobo]
ref|XP_007986456.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    263   8e-77    Chlorocebus sabaeus
ref|XP_006974251.1|  PREDICTED: poly [ADP-ribose] polymerase 1          262   9e-77    Peromyscus maniculatus bairdii
ref|XP_001638875.1|  predicted protein                                  262   9e-77    Nematostella vectensis
ref|XP_007935170.1|  PREDICTED: poly [ADP-ribose] polymerase 1          262   9e-77    Orycteropus afer afer
ref|XP_006871190.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     262   1e-76    Chrysochloris asiatica
gb|EHH15492.1|  hypothetical protein EGK_01593                          262   1e-76    Macaca mulatta [rhesus macaque]
ref|XP_010380279.1|  PREDICTED: poly [ADP-ribose] polymerase 1          262   1e-76    Rhinopithecus roxellana
ref|XP_005541069.1|  PREDICTED: poly [ADP-ribose] polymerase 1          262   1e-76    Macaca fascicularis [crab eating macaque]
ref|XP_001090984.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    262   1e-76    
ref|XP_001090628.2|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    262   1e-76    
ref|XP_008579018.1|  PREDICTED: poly [ADP-ribose] polymerase 1          262   1e-76    Galeopterus variegatus [Malayan flying lemur]
ref|XP_006157311.1|  PREDICTED: poly [ADP-ribose] polymerase 1          262   1e-76    Tupaia chinensis
ref|XP_004761981.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    262   1e-76    Mustela putorius furo [black ferret]
ref|XP_008058853.1|  PREDICTED: poly [ADP-ribose] polymerase 1          261   2e-76    
gb|KFB53219.1|  AGAP003230-PA-like protein                              261   2e-76    Anopheles sinensis
gb|ELW49552.1|  Poly [ADP-ribose] polymerase 1                          262   2e-76    Tupaia chinensis
gb|ACN58594.1|  Poly synthetase 1                                       242   2e-76    Salmo salar
ref|XP_009184638.1|  PREDICTED: poly [ADP-ribose] polymerase 1          262   2e-76    
ref|XP_008820594.1|  PREDICTED: poly [ADP-ribose] polymerase 1          261   2e-76    Nannospalax galili
gb|KFD59055.1|  hypothetical protein M513_00218                         260   2e-76    Trichuris suis
ref|XP_007534861.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    261   2e-76    Erinaceus europaeus [common hedgehog]
ref|XP_007464233.1|  PREDICTED: poly [ADP-ribose] polymerase 1          261   2e-76    Lipotes vexillifer [baiji]
ref|XP_007102732.1|  PREDICTED: poly [ADP-ribose] polymerase 1          261   2e-76    
ref|XP_006914334.1|  PREDICTED: poly [ADP-ribose] polymerase 1          261   2e-76    Pteropus alecto
ref|XP_004083528.1|  PREDICTED: poly [ADP-ribose] polymerase 1          261   2e-76    Oryzias latipes [Japanese rice fish]
dbj|BAE38574.1|  unnamed protein product                                261   2e-76    Mus musculus [mouse]
ref|XP_003216114.1|  PREDICTED: poly [ADP-ribose] polymerase 1          261   2e-76    Anolis carolinensis [Carolina anole]
ref|XP_008266574.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    261   2e-76    Oryctolagus cuniculus [domestic rabbit]
emb|CBY18306.1|  unnamed protein product                                261   2e-76    Oikopleura dioica
gb|KHJ46115.1|  Poly(ADP-ribose) polymerase catalytic domain protein    261   3e-76    Trichuris suis
ref|XP_004271024.1|  PREDICTED: poly [ADP-ribose] polymerase 1          261   3e-76    Orcinus orca [Orca]
ref|XP_004393605.1|  PREDICTED: poly [ADP-ribose] polymerase 1          261   3e-76    Odobenus rosmarus divergens
ref|XP_002941174.2|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    261   3e-76    Xenopus tropicalis [western clawed frog]
ref|XP_004761979.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    261   3e-76    
ref|XP_007167258.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    261   3e-76    Balaenoptera acutorostrata scammoni
ref|XP_008311175.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    261   3e-76    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_007670669.1|  PREDICTED: poly [ADP-ribose] polymerase 1          261   3e-76    
ref|XP_003385071.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     259   3e-76    Amphimedon queenslandica
ref|XP_003971725.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     261   4e-76    Takifugu rubripes [tiger puffer]
ref|XP_008311174.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    261   4e-76    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003791037.1|  PREDICTED: poly [ADP-ribose] polymerase 1          260   4e-76    Otolemur garnettii
ref|XP_547506.3|  PREDICTED: poly [ADP-ribose] polymerase 1 isofo...    260   6e-76    
ref|XP_001491507.4|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    260   6e-76    
ref|XP_005404552.1|  PREDICTED: poly [ADP-ribose] polymerase 1          260   6e-76    Chinchilla lanigera
ref|XP_006046141.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    260   6e-76    
ref|XP_004439616.1|  PREDICTED: poly [ADP-ribose] polymerase 1          259   6e-76    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006046140.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    260   7e-76    Bubalus bubalis [domestic water buffalo]
ref|XP_010851175.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    260   7e-76    Bison bison bison
ref|XP_004013685.1|  PREDICTED: poly [ADP-ribose] polymerase 1          260   7e-76    
gb|KFB53220.1|  AGAP003230-PA-like protein                              260   7e-76    Anopheles sinensis
ref|XP_005216853.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    260   8e-76    Bos taurus [bovine]
ref|XP_005959159.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     259   8e-76    Pantholops hodgsonii [Tibetan antelope]
ref|XP_010851174.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    260   8e-76    Bison bison bison
tpg|DAA21368.1|  TPA: poly [ADP-ribose] polymerase 1                    260   8e-76    Bos taurus [bovine]
ref|XP_005690591.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    259   9e-76    
ref|XP_005690590.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    259   9e-76    
ref|XP_006625727.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     259   1e-75    
ref|XP_010293489.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   1e-75    Phaethon lepturus
ref|XP_005014800.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    258   1e-75    
ref|XP_004700007.1|  PREDICTED: poly [ADP-ribose] polymerase 1          259   1e-75    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_006016655.1|  PREDICTED: poly [ADP-ribose] polymerase 1          259   1e-75    
ref|XP_004472547.1|  PREDICTED: poly [ADP-ribose] polymerase 1          259   1e-75    
ref|XP_006268817.1|  PREDICTED: poly [ADP-ribose] polymerase 1          259   1e-75    
ref|XP_010780561.1|  PREDICTED: poly [ADP-ribose] polymerase 1          256   2e-75    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003462410.1|  PREDICTED: poly [ADP-ribose] polymerase 1          259   2e-75    Cavia porcellus [guinea pig]
ref|XP_006375453.1|  Poly [ADP-ribose] polymerase family protein        253   2e-75    
ref|NP_777176.1|  poly [ADP-ribose] polymerase 1                        259   2e-75    Bos taurus [bovine]
ref|XP_009860226.1|  PREDICTED: poly [ADP-ribose] polymerase 1          258   2e-75    
sp|P31669.1|PARP1_XENLA  RecName: Full=Poly [ADP-ribose] polymera...    258   2e-75    Xenopus laevis [clawed frog]
gb|AAI00002.1|  Poly (ADP-ribose) polymerase family, member 1           258   2e-75    Danio rerio [leopard danio]
ref|NP_001038407.1|  poly [ADP-ribose] polymerase 1                     258   2e-75    Danio rerio [leopard danio]
ref|NP_001081571.1|  poly [ADP-ribose] polymerase 1                     258   2e-75    Xenopus laevis [clawed frog]
ref|XP_010611507.1|  PREDICTED: poly [ADP-ribose] polymerase 1          258   2e-75    Fukomys damarensis [Damara mole rat]
ref|XP_005880205.1|  PREDICTED: poly [ADP-ribose] polymerase 1          258   3e-75    Myotis brandtii
ref|XP_011334668.1|  PREDICTED: poly [ADP-ribose] polymerase            258   3e-75    
ref|XP_008159430.1|  PREDICTED: poly [ADP-ribose] polymerase 1          258   3e-75    Eptesicus fuscus
ref|XP_002058751.1|  GJ11149                                            258   3e-75    
ref|XP_010732988.1|  PREDICTED: poly [ADP-ribose] polymerase 1          258   3e-75    
ref|XP_006812383.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     258   4e-75    Saccoglossus kowalevskii
ref|XP_003693603.1|  PREDICTED: poly [ADP-ribose] polymerase-like       258   4e-75    Apis florea [dwarf honeybee]
gb|KFO19690.1|  Poly [ADP-ribose] polymerase 1                          258   4e-75    Fukomys damarensis [Damara mole rat]
ref|XP_007552911.1|  PREDICTED: poly [ADP-ribose] polymerase 1          258   4e-75    Poecilia formosa
gb|KFM63822.1|  Poly [ADP-ribose] polymerase 1                          257   4e-75    Stegodyphus mimosarum
emb|CDQ76498.1|  unnamed protein product                                258   5e-75    Oncorhynchus mykiss
gb|AAA60155.1|  poly(ADP-ribose) polymerase                             257   5e-75    Homo sapiens [man]
ref|XP_005326600.1|  PREDICTED: poly [ADP-ribose] polymerase 1          257   6e-75    Ictidomys tridecemlineatus
ref|XP_006012380.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     254   7e-75    
ref|XP_624477.3|  PREDICTED: poly [ADP-ribose] polymerase               257   8e-75    Apis mellifera [bee]
gb|AAB35559.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            251   8e-75    Gallus gallus [bantam]
ref|XP_003707671.1|  PREDICTED: poly [ADP-ribose] polymerase-like       256   1e-74    Megachile rotundata
ref|XP_003770730.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     257   1e-74    
ref|XP_010863533.1|  PREDICTED: poly [ADP-ribose] polymerase 1          256   1e-74    Esox lucius
ref|XP_001027169.3|  WGR domain containing protein                      250   1e-74    Tetrahymena thermophila SB210
ref|XP_011204662.1|  PREDICTED: poly [ADP-ribose] polymerase            256   2e-74    Bactrocera dorsalis [papaya fruit fly]
gb|AIZ09031.1|  poly [ADP-ribose] polymerase 1                          256   2e-74    Heterocephalus glaber [naked mole rat]
emb|CDX90941.1|  BnaA03g26210D                                          251   2e-74    
ref|XP_006797147.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     256   2e-74    Neolamprologus brichardi [lyretail cichlid]
ref|XP_004889988.1|  PREDICTED: poly [ADP-ribose] polymerase 1          256   2e-74    
ref|XP_005914568.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    256   2e-74    
ref|XP_005454773.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    256   2e-74    
ref|XP_002109067.1|  hypothetical protein TRIADDRAFT_19562              255   2e-74    Trichoplax adhaerens
ref|XP_005734478.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    256   2e-74    
ref|XP_003449904.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    256   2e-74    Oreochromis niloticus
ref|XP_005914567.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    256   2e-74    Haplochromis burtoni
ref|XP_004541848.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     255   3e-74    Maylandia zebra
ref|XP_008396025.1|  PREDICTED: poly [ADP-ribose] polymerase 1          255   3e-74    Poecilia reticulata
ref|XP_009134435.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    250   3e-74    Brassica rapa
gb|AAM50807.1|  LD31274p                                                248   3e-74    Drosophila melanogaster
ref|XP_009134436.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    250   3e-74    Brassica rapa
ref|XP_009568032.1|  PREDICTED: poly [ADP-ribose] polymerase 1          254   4e-74    Cuculus canorus
gb|EHB06347.1|  Poly [ADP-ribose] polymerase 1                          255   4e-74    Heterocephalus glaber [naked mole rat]
ref|XP_004862328.1|  PREDICTED: poly [ADP-ribose] polymerase 1          255   4e-74    
emb|CDY18025.1|  BnaC03g30970D                                          250   6e-74    Brassica napus [oilseed rape]
gb|EFX75651.1|  hypothetical protein DAPPUDRAFT_55885                   254   6e-74    Daphnia pulex
gb|ELT93548.1|  hypothetical protein CAPTEDRAFT_223861                  254   6e-74    
sp|Q11208.1|PARP_SARPE  RecName: Full=Poly [ADP-ribose] polymeras...    254   6e-74    
ref|XP_007481564.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    253   8e-74    
ref|XP_010259524.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    248   9e-74    
ref|XP_010259523.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    248   1e-73    
ref|XP_006612556.1|  PREDICTED: poly [ADP-ribose] polymerase-like       253   1e-73    
ref|XP_001661932.1|  AAEL011815-PA                                      253   1e-73    
ref|XP_004641229.1|  PREDICTED: poly [ADP-ribose] polymerase 1          253   2e-73    
ref|XP_010134097.1|  PREDICTED: poly [ADP-ribose] polymerase 1          253   2e-73    
ref|XP_002073889.1|  GK14355                                            253   2e-73    
ref|XP_007481563.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    253   2e-73    
gb|KJB41911.1|  hypothetical protein B456_007G127600                    243   2e-73    
gb|ETN59550.1|  poly [adp-ribose] polymerase                            253   2e-73    
gb|EQB78542.1|  poly [ADP-ribose] polymerase 1                          254   2e-73    
ref|XP_011063718.1|  PREDICTED: poly [ADP-ribose] polymerase isof...    253   2e-73    
ref|XP_003949754.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    253   3e-73    
ref|XP_010422601.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    247   4e-73    
ref|XP_011188189.1|  PREDICTED: poly [ADP-ribose] polymerase            252   4e-73    
ref|XP_010456041.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    247   4e-73    
ref|XP_010456042.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    247   4e-73    
ref|XP_007050353.1|  Poly(ADP-ribose) polymerase 2, putative isof...    248   4e-73    
ref|XP_010422599.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    247   4e-73    
ref|XP_001996195.1|  GH22365                                            252   5e-73    
ref|XP_005043071.1|  PREDICTED: poly [ADP-ribose] polymerase 1          251   5e-73    
sp|P26446.2|PARP1_CHICK  RecName: Full=Poly [ADP-ribose] polymera...    251   6e-73    
ref|NP_990594.2|  poly [ADP-ribose] polymerase 1                        251   7e-73    
ref|XP_001998459.1|  GI23619                                            251   7e-73    
ref|XP_010704958.1|  PREDICTED: poly [ADP-ribose] polymerase 1          251   1e-72    
ref|XP_007905391.1|  PREDICTED: poly [ADP-ribose] polymerase 1          251   1e-72    
ref|XP_009872148.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   1e-72    
gb|AAB35561.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            245   1e-72    
ref|XP_002019344.1|  GL12354                                            251   1e-72    
ref|XP_002137908.2|  GA25584                                            250   1e-72    
ref|XP_006396446.1|  hypothetical protein EUTSA_v10028509mg             245   2e-72    
ref|XP_010441111.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     245   2e-72    
ref|XP_001947212.1|  PREDICTED: poly [ADP-ribose] polymerase            250   2e-72    
ref|XP_011426298.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     250   2e-72    
ref|XP_312938.4|  AGAP003230-PA                                         250   2e-72    
ref|NP_192148.2|  poly(ADP-ribose) polymerase                           245   2e-72    
gb|AAC19283.1|  T14P8.19                                                245   2e-72    
ref|XP_009684683.1|  PREDICTED: poly [ADP-ribose] polymerase 1          250   2e-72    
ref|XP_002430760.1|  polyA polymerase, putative                         250   2e-72    
ref|XP_001782209.1|  predicted protein                                  245   2e-72    
ref|XP_009504077.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   2e-72    
ref|XP_004519485.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    248   3e-72    
gb|KFW91620.1|  Poly [ADP-ribose] polymerase 1                          248   3e-72    
ref|XP_004332883.1|  Poly(ADPribose) polymerase catalytic domain ...    244   3e-72    
ref|XP_002986480.1|  hypothetical protein SELMODRAFT_124300             245   3e-72    
ref|NP_001089376.1|  uncharacterized protein LOC734426                  241   3e-72    
ref|XP_002964898.1|  hypothetical protein SELMODRAFT_83360              244   4e-72    
ref|XP_004165914.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     244   4e-72    
emb|CAA36917.1|  unnamed protein product                                249   4e-72    
ref|XP_009899525.1|  PREDICTED: poly [ADP-ribose] polymerase 1          249   4e-72    
ref|XP_002090141.1|  GE20224                                            249   5e-72    
ref|XP_010522796.1|  PREDICTED: poly [ADP-ribose] polymerase 2          244   5e-72    
ref|XP_006756108.1|  PREDICTED: poly [ADP-ribose] polymerase 1          249   5e-72    
ref|XP_004136022.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     244   5e-72    
ref|XP_006643364.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     238   5e-72    
ref|XP_010224835.1|  PREDICTED: poly [ADP-ribose] polymerase 1          249   5e-72    
ref|XP_003149248.1|  poly(ADP-ribose) polymerase                        236   6e-72    
ref|XP_010429576.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    244   6e-72    
ref|XP_002874918.1|  poly(ADP-ribose) polymerase                        244   6e-72    
gb|KJB41910.1|  hypothetical protein B456_007G127600                    244   6e-72    
ref|XP_004519484.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    249   6e-72    
ref|XP_004519483.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    248   7e-72    
ref|XP_010429584.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    244   8e-72    
ref|XP_010088282.1|  Poly [ADP-ribose] polymerase 2                     244   8e-72    
ref|XP_009092024.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   8e-72    
ref|XP_011033516.1|  PREDICTED: poly [ADP-ribose] polymerase 2          244   9e-72    
gb|KGN44946.1|  hypothetical protein Csa_7G397590                       244   9e-72    
ref|XP_005427073.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   9e-72    
ref|XP_006677781.1|  hypothetical protein BATDEDRAFT_16284              239   9e-72    
gb|EMC85168.1|  Poly [ADP-ribose] polymerase 1                          247   9e-72    
ref|XP_005488534.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   9e-72    
ref|XP_002409668.1|  poly [ADP-ribose] polymerase, putative             248   1e-71    
ref|XP_009470783.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   1e-71    
gb|KJB41909.1|  hypothetical protein B456_007G127600                    244   1e-71    
ref|XP_009969669.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   1e-71    
ref|XP_008933052.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   1e-71    
ref|XP_010576040.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   1e-71    
ref|XP_008628789.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   1e-71    
ref|XP_005523344.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    248   1e-71    
ref|XP_010162117.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   1e-71    
emb|CDP17120.1|  unnamed protein product                                243   1e-71    
ref|NP_001104452.1|  Poly-(ADP-ribose) polymerase                       248   1e-71    
ref|XP_010391791.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   1e-71    
ref|XP_009646446.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   1e-71    
gb|ETO30134.1|  WGR domain containing protein                           235   1e-71    
ref|XP_005523343.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    248   1e-71    
ref|XP_009476172.1|  PREDICTED: poly [ADP-ribose] polymerase 1          248   2e-71    
ref|XP_005151917.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    247   2e-71    
ref|XP_010007824.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_009910585.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    247   2e-71    
ref|XP_009892579.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_005175604.1|  PREDICTED: poly [ADP-ribose] polymerase isof...    248   2e-71    
ref|XP_009935626.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    247   2e-71    
ref|XP_002194832.2|  PREDICTED: poly [ADP-ribose] polymerase 1          248   2e-71    
ref|XP_008451559.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    243   2e-71    
ref|XP_010300324.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_010195273.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_009993082.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_008235208.1|  PREDICTED: poly [ADP-ribose] polymerase 2          243   2e-71    
ref|XP_009076073.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_009331916.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_006286374.1|  hypothetical protein CARUB_v10000452mg             242   2e-71    
ref|XP_009581523.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_005241893.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_005507407.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_010180660.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_003740601.1|  PREDICTED: poly [ADP-ribose] polymerase-like       247   2e-71    
ref|XP_005441299.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   2e-71    
ref|XP_010076719.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   3e-71    
ref|XP_009283832.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   3e-71    
ref|XP_011079644.1|  PREDICTED: poly [ADP-ribose] polymerase 2          244   3e-71    
ref|XP_008499362.1|  PREDICTED: poly [ADP-ribose] polymerase 1          247   3e-71    
ref|XP_011308727.1|  PREDICTED: poly [ADP-ribose] polymerase            247   3e-71    
ref|XP_008948173.1|  PREDICTED: poly [ADP-ribose] polymerase 1          246   3e-71    
ref|NP_001191521.1|  poly-(ADP-ribose) polymerase I                     246   4e-71    
gb|KHG12641.1|  Poly [ADP-ribose] polymerase 2 -like protein            242   6e-71    
gb|KFK30828.1|  hypothetical protein AALP_AA6G031100                    241   8e-71    
gb|KFK30829.1|  hypothetical protein AALP_AA6G031100                    241   9e-71    
gb|AAI42935.1|  LOC100007906 protein                                    239   1e-70    
ref|XP_007241737.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     241   1e-70    
gb|EKC34863.1|  Poly [ADP-ribose] polymerase 1                          245   1e-70    
ref|XP_008244417.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     240   1e-70    
gb|ENN70929.1|  hypothetical protein YQE_12331                          236   2e-70    
ref|XP_001862547.1|  poly                                               244   2e-70    
ref|XP_008812277.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    239   2e-70    
gb|EAW69785.1|  poly (ADP-ribose) polymerase family, member 1, is...    244   2e-70    
ref|XP_010684358.1|  PREDICTED: poly [ADP-ribose] polymerase 2-A ...    240   2e-70    
ref|XP_010684359.1|  PREDICTED: poly [ADP-ribose] polymerase 2-A ...    240   2e-70    
gb|AAW27016.1|  SJCHGC00945 protein                                     232   3e-70    
gb|ERL88197.1|  hypothetical protein D910_05585                         236   3e-70    
ref|XP_002990236.1|  hypothetical protein SELMODRAFT_131309             235   7e-70    
ref|XP_006479982.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    238   8e-70    
ref|XP_004926518.1|  PREDICTED: poly [ADP-ribose] polymerase            243   9e-70    
ref|XP_010931665.1|  PREDICTED: poly [ADP-ribose] polymerase 2          238   9e-70    
ref|XP_007199613.1|  hypothetical protein PRUPE_ppa002806mg             238   1e-69    
ref|XP_006444375.1|  hypothetical protein CICLE_v10019312mg             238   1e-69    
ref|NP_001153714.1|  poly-(ADP-ribose) polymerase                       242   1e-69    
gb|KDO87191.1|  hypothetical protein CISIN_1g006883mg                   237   1e-69    
gb|AFW80735.1|  hypothetical protein ZEAMMB73_284458                    227   2e-69    
ref|XP_004341800.1|  Poly(ADPribose) polymerase catalytic domain ...    242   2e-69    
ref|XP_009335700.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    235   2e-69    
ref|XP_006479983.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    237   2e-69    
ref|XP_006479981.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    237   2e-69    
ref|XP_007050950.1|  Poly(ADP-ribose) polymerase isoform 1              237   2e-69    
ref|XP_006588586.1|  PREDICTED: poly [ADP-ribose] polymerase 2-A-...    236   3e-69    
ref|XP_011459796.1|  PREDICTED: poly [ADP-ribose] polymerase 2          236   4e-69    
gb|KHN03715.1|  Poly [ADP-ribose] polymerase 2                          235   4e-69    
gb|KDO87190.1|  hypothetical protein CISIN_1g006883mg                   236   4e-69    
ref|XP_010451796.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     235   6e-69    
ref|XP_011484327.1|  PREDICTED: poly [ADP-ribose] polymerase 2          236   6e-69    
ref|XP_008345247.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     226   7e-69    
ref|NP_001133790.1|  poly (ADP-ribose) polymerase family, member 2      234   8e-69    
gb|EYU46735.1|  hypothetical protein MIMGU_mgv1a020376mg                236   9e-69    
gb|ACF79836.1|  unknown                                                 227   1e-68    
ref|XP_009405431.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    234   1e-68    
ref|XP_009405432.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    234   1e-68    
ref|XP_005918190.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     230   2e-68    
ref|XP_010069905.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    233   2e-68    
ref|XP_005171314.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    235   2e-68    
ref|NP_001191199.1|  poly [ADP-ribose] polymerase 2                     235   2e-68    
emb|CAF92030.1|  unnamed protein product                                231   2e-68    
ref|XP_001604917.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    239   2e-68    
ref|XP_008203357.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    239   2e-68    
gb|ELK36014.1|  Poly [ADP-ribose] polymerase 1                          241   2e-68    
ref|XP_009335699.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    234   3e-68    
ref|XP_010069904.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    234   4e-68    
ref|XP_009061157.1|  hypothetical protein LOTGIDRAFT_206927             238   4e-68    
gb|EMP24541.1|  Poly [ADP-ribose] polymerase 1                          234   5e-68    
ref|XP_007145201.1|  hypothetical protein PHAVU_007G218800g             232   5e-68    
emb|CCD60678.1|  poly [ADP-ribose] polymerase, putative                 237   6e-68    
ref|XP_009335717.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    231   7e-68    
emb|CDQ67347.1|  unnamed protein product                                233   1e-67    
gb|KJB42241.1|  hypothetical protein B456_007G144300                    236   1e-67    
ref|XP_008355488.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    233   1e-67    
ref|XP_002591821.1|  hypothetical protein BRAFLDRAFT_125321             229   1e-67    
ref|XP_005796607.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     233   1e-67    
ref|XP_008355487.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    233   1e-67    
ref|XP_004994319.1|  hypothetical protein PTSG_05004                    237   1e-67    
ref|XP_006792497.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     231   1e-67    
ref|XP_006644151.1|  PREDICTED: poly [ADP-ribose] polymerase 2-A-...    232   2e-67    
gb|AGT29604.1|  poly [ADP-ribose] polymerase 2                          230   2e-67    
gb|EHJ70647.1|  poly                                                    236   2e-67    
ref|XP_011359180.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    236   2e-67    
gb|EJD75827.1|  WGR domain-containing protein                           235   3e-67    
ref|XP_003591511.1|  Poly                                               232   3e-67    
ref|XP_002961896.1|  hypothetical protein SELMODRAFT_403303             233   4e-67    
ref|XP_003447515.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    231   4e-67    
ref|XP_004495943.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     231   4e-67    
gb|KFH64843.1|  hypothetical protein MVEG_09572                         231   5e-67    
ref|XP_006479984.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    230   5e-67    
ref|XP_005476770.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    231   5e-67    
ref|XP_007567516.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    231   5e-67    
ref|XP_007567515.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    231   5e-67    
ref|XP_008345216.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     224   7e-67    
ref|XP_006365384.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     230   7e-67    
ref|XP_009335716.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    230   1e-66    
ref|XP_004968713.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     230   1e-66    
emb|CDX91327.1|  BnaC02g27380D                                          222   1e-66    
ref|XP_008297456.1|  PREDICTED: poly [ADP-ribose] polymerase 2          230   1e-66    
ref|XP_005729041.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     230   1e-66    
ref|XP_010652198.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    229   1e-66    
emb|CBI36874.3|  unnamed protein product                                228   2e-66    
ref|XP_004555259.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     229   2e-66    
ref|XP_010652197.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    229   2e-66    
ref|XP_010749109.1|  PREDICTED: poly [ADP-ribose] polymerase 2          229   2e-66    
ref|XP_001424619.1|  hypothetical protein                               228   2e-66    
gb|EKC30870.1|  Poly [ADP-ribose] polymerase 2                          226   2e-66    
gb|ESA07314.1|  hypothetical protein GLOINDRAFT_33051                   230   3e-66    
gb|KEH43217.1|  poly(ADP-ribose) polymerase domain protein              228   4e-66    
ref|XP_002128307.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     227   4e-66    
ref|XP_007077016.1|  PREDICTED: poly [ADP-ribose] polymerase 1          234   5e-66    
ref|XP_001435061.1|  hypothetical protein                               227   6e-66    
gb|EEE54532.1|  hypothetical protein OsJ_01694                          228   6e-66    
dbj|BAD52929.1|  putative poly(ADP-ribose) polymerase                   228   8e-66    
ref|XP_006855550.1|  hypothetical protein AMTR_s00057p00219020          227   1e-65    
sp|Q5Z8Q9.2|PRP2A_ORYSJ  RecName: Full=Poly [ADP-ribose] polymera...    228   1e-65    
ref|XP_010325648.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    227   1e-65    
ref|XP_004366295.1|  poly(ADP-ribosyl)transferase                       231   1e-65    



>ref|XP_009781597.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Nicotiana 
sylvestris]
Length=995

 Score =   389 bits (998),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            SED+R++EKYLQ+THAPTHK+W LEVE+VFSLER+GE DKFAP R+KLKNRMLLWHGSRL
Sbjct  790  SEDYRVIEKYLQSTHAPTHKDWVLEVEEVFSLEREGEFDKFAPHREKLKNRMLLWHGSRL  849

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            TNFVGILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSAQYCFT+RKNPVGFMLLSEVAL
Sbjct  850  TNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKNPVGFMLLSEVAL  909

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G+++ELKKA+YMDKPPKGKHSTKGLGKTVP+ S++VKWRDEVVVPCGKPVPS +K SELL
Sbjct  910  GEVYELKKAKYMDKPPKGKHSTKGLGKTVPESSEFVKWRDEVVVPCGKPVPSNIKNSELL  969

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVYD  QVKLQFLVKVRF YK
Sbjct  970  YNEYIVYDTCQVKLQFLVKVRFNYK  994



>ref|XP_009781599.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X3 [Nicotiana 
sylvestris]
Length=994

 Score =   389 bits (998),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            SED+R++EKYLQ+THAPTHK+W LEVE+VFSLER+GE DKFAP R+KLKNRMLLWHGSRL
Sbjct  789  SEDYRVIEKYLQSTHAPTHKDWVLEVEEVFSLEREGEFDKFAPHREKLKNRMLLWHGSRL  848

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            TNFVGILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSAQYCFT+RKNPVGFMLLSEVAL
Sbjct  849  TNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKNPVGFMLLSEVAL  908

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G+++ELKKA+YMDKPPKGKHSTKGLGKTVP+ S++VKWRDEVVVPCGKPVPS +K SELL
Sbjct  909  GEVYELKKAKYMDKPPKGKHSTKGLGKTVPESSEFVKWRDEVVVPCGKPVPSNIKNSELL  968

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVYD  QVKLQFLVKVRF YK
Sbjct  969  YNEYIVYDTCQVKLQFLVKVRFNYK  993



>ref|XP_009781598.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Nicotiana 
sylvestris]
Length=995

 Score =   387 bits (995),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            SED+R++EKYLQ+THAPTHK+W LEVE+VFSLER+GE DKFAP R+KLKNRMLLWHGSRL
Sbjct  790  SEDYRVIEKYLQSTHAPTHKDWVLEVEEVFSLEREGEFDKFAPHREKLKNRMLLWHGSRL  849

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            TNFVGILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSAQYCFT+RKNPVGFMLLSEVAL
Sbjct  850  TNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKNPVGFMLLSEVAL  909

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G+++ELKKA+YMDKPPKGKHSTKGLGKTVP+ S++VKWRDEVVVPCGKPVPS +K SELL
Sbjct  910  GEVYELKKAKYMDKPPKGKHSTKGLGKTVPESSEFVKWRDEVVVPCGKPVPSNIKNSELL  969

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVYD  QVKLQFLVKVRF YK
Sbjct  970  YNEYIVYDTCQVKLQFLVKVRFNYK  994



>ref|XP_009617761.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Nicotiana 
tomentosiformis]
Length=994

 Score =   383 bits (984),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            SED+R++EKYLQ+THAPTHK+W LEVE+VFSLER+GE DKFAP R+KLKNRMLLWHGSRL
Sbjct  789  SEDYRVIEKYLQSTHAPTHKDWVLEVEEVFSLEREGEFDKFAPHREKLKNRMLLWHGSRL  848

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            TNFVGILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSAQYCFT+RKNPVGFMLLSEVAL
Sbjct  849  TNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKNPVGFMLLSEVAL  908

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G+++ELKKA+Y+DKPPKGKHSTKGLGKTVP+ S++VKWRDEVVVP GKPVPS VK SELL
Sbjct  909  GEVYELKKAKYIDKPPKGKHSTKGLGKTVPESSEFVKWRDEVVVPHGKPVPSNVKNSELL  968

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVYD AQVKLQFLVKVRF YK
Sbjct  969  YNEYIVYDTAQVKLQFLVKVRFNYK  993



>ref|XP_009617762.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=977

 Score =   383 bits (983),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            SED+R++EKYLQ+THAPTHK+W LEVE+VFSLER+GE DKFAP R+KLKNRMLLWHGSRL
Sbjct  772  SEDYRVIEKYLQSTHAPTHKDWVLEVEEVFSLEREGEFDKFAPHREKLKNRMLLWHGSRL  831

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            TNFVGILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSAQYCFT+RKNPVGFMLLSEVAL
Sbjct  832  TNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKNPVGFMLLSEVAL  891

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G+++ELKKA+Y+DKPPKGKHSTKGLGKTVP+ S++VKWRDEVVVP GKPVPS VK SELL
Sbjct  892  GEVYELKKAKYIDKPPKGKHSTKGLGKTVPESSEFVKWRDEVVVPHGKPVPSNVKNSELL  951

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVYD AQVKLQFLVKVRF YK
Sbjct  952  YNEYIVYDTAQVKLQFLVKVRFNYK  976



>ref|XP_009367708.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=966

 Score =   378 bits (970),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+RL+EKYL+ATHAPTH +W+LE+E+VF+LER+GE DKFAP+RKKLKNRMLLWHGSR
Sbjct  760  DSEDYRLIEKYLRATHAPTHTDWSLELEEVFALEREGEFDKFAPYRKKLKNRMLLWHGSR  819

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T++KNPVG MLLSEVA
Sbjct  820  FTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKNPVGLMLLSEVA  879

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA YMDKPPKGKHSTKGLGK +PQES+YVKW+D+V+VPCGKPVPS VKASEL
Sbjct  880  LGEVYELKKAAYMDKPPKGKHSTKGLGKKIPQESEYVKWKDDVIVPCGKPVPSNVKASEL  939

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVYD AQVK+Q+L+KVRF +K
Sbjct  940  MYNEYIVYDTAQVKMQYLLKVRFHHK  965



>ref|XP_009367706.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=966

 Score =   378 bits (970),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+RL+EKYL+ATHAPTH +W+LE+E+VF+LER+GE DKFAP+RKKLKNRMLLWHGSR
Sbjct  760  DSEDYRLIEKYLRATHAPTHTDWSLELEEVFALEREGEFDKFAPYRKKLKNRMLLWHGSR  819

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T++KNPVG MLLSEVA
Sbjct  820  FTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKNPVGLMLLSEVA  879

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA YMDKPPKGKHSTKGLGK +PQES+YVKW+D+V+VPCGKPVPS VKASEL
Sbjct  880  LGEVYELKKAAYMDKPPKGKHSTKGLGKKIPQESEYVKWKDDVIVPCGKPVPSNVKASEL  939

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVYD AQVK+Q+L+KVRF +K
Sbjct  940  MYNEYIVYDTAQVKMQYLLKVRFHHK  965



>ref|XP_006341445.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Solanum tuberosum]
Length=991

 Score =   377 bits (969),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            SED+R++EKYLQ THAPTHK+W LEVE VFSLERKGE DKF P ++KLKNRMLLWHGSRL
Sbjct  786  SEDYRVIEKYLQNTHAPTHKDWVLEVEDVFSLERKGEFDKFKPCKEKLKNRMLLWHGSRL  845

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            TNFVGILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSAQYCFT+ KNPVGFMLLSEVAL
Sbjct  846  TNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDHKNPVGFMLLSEVAL  905

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G+++ELK A+YMDKPPKGKHSTKGLGKTVP+ SD+V WRDEVVVPCGKPV S VK SELL
Sbjct  906  GEVYELKAAKYMDKPPKGKHSTKGLGKTVPERSDFVNWRDEVVVPCGKPVTSNVKNSELL  965

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVYD AQVKLQFLVKVRF +K
Sbjct  966  YNEYIVYDAAQVKLQFLVKVRFNFK  990



>ref|XP_004235864.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Solanum 
lycopersicum]
Length=992

 Score =   377 bits (968),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            SED+R++EKYLQ THAPTHKEW LEVE+VFSLERKGE DKF P R KLKN+MLLWHGSRL
Sbjct  787  SEDYRVIEKYLQNTHAPTHKEWVLEVEEVFSLERKGEYDKFKPCRDKLKNKMLLWHGSRL  846

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            TNFVGILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSAQYCFT+RKNPVGFMLLSEVAL
Sbjct  847  TNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKNPVGFMLLSEVAL  906

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G+++ELK A+YMDKPPKGKHSTKGLGKTVP+ S++V WRDEVVVPCGKPV S VK SELL
Sbjct  907  GEVYELKAAKYMDKPPKGKHSTKGLGKTVPERSEFVNWRDEVVVPCGKPVTSNVKNSELL  966

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVY+ AQVKLQFLVKVRF +K
Sbjct  967  YNEYIVYEAAQVKLQFLVKVRFNFK  991



>ref|XP_010318682.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Solanum 
lycopersicum]
Length=998

 Score =   377 bits (967),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            SED+R++EKYLQ THAPTHKEW LEVE+VFSLERKGE DKF P R KLKN+MLLWHGSRL
Sbjct  793  SEDYRVIEKYLQNTHAPTHKEWVLEVEEVFSLERKGEYDKFKPCRDKLKNKMLLWHGSRL  852

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            TNFVGILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSAQYCFT+RKNPVGFMLLSEVAL
Sbjct  853  TNFVGILSQGLRIAPPEAPATGYMFGKGIYFADMVSKSAQYCFTDRKNPVGFMLLSEVAL  912

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G+++ELK A+YMDKPPKGKHSTKGLGKTVP+ S++V WRDEVVVPCGKPV S VK SELL
Sbjct  913  GEVYELKAAKYMDKPPKGKHSTKGLGKTVPERSEFVNWRDEVVVPCGKPVTSNVKNSELL  972

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVY+ AQVKLQFLVKVRF +K
Sbjct  973  YNEYIVYEAAQVKLQFLVKVRFNFK  997



>ref|XP_008235714.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Prunus mume]
Length=992

 Score =   375 bits (963),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSEDFRL++KYL  THAPTH +W+LE+E+VF+LER+GE DKFAP+RKKL NRMLLWHGSR
Sbjct  786  DSEDFRLIKKYLLTTHAPTHTDWSLELEEVFALEREGEFDKFAPYRKKLNNRMLLWHGSR  845

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T++KNPVG MLLSEVA
Sbjct  846  FTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKNPVGLMLLSEVA  905

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HELKKA YMDKPPKGKHSTKGLGK +PQES+YVKW+D+V+VPCGKPVPS +KASEL
Sbjct  906  LGEVHELKKATYMDKPPKGKHSTKGLGKKIPQESEYVKWKDDVIVPCGKPVPSNIKASEL  965

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVYD AQVK+QFL+KVRF +K
Sbjct  966  MYNEYIVYDKAQVKMQFLLKVRFHHK  991



>gb|EYU46476.1| hypothetical protein MIMGU_mgv1a000724mg [Erythranthe guttata]
Length=1002

 Score =   375 bits (963),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 197/208 (95%), Gaps = 1/208 (0%)
 Frame = -2

Query  823   TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
             +RDSE+F+L+EKYL +THAPTH EWALE+E+VFSLER+GE+DK+AP+R KLKN+MLLWHG
Sbjct  795   SRDSEEFQLIEKYLNSTHAPTHTEWALELEEVFSLERQGEMDKYAPYRAKLKNKMLLWHG  854

Query  643   SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
             SRLTNF+GILSQGLRIAPPEAP+TGYMFGKGVYFAD+VSKSAQYCFT+RKNPVG MLLSE
Sbjct  855   SRLTNFIGILSQGLRIAPPEAPSTGYMFGKGVYFADLVSKSAQYCFTDRKNPVGLMLLSE  914

Query  463   VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
             VALG++HEL KAQYMDKPPKGKHSTKGLGK VP ES+YV+WRD VVVPCGKPV SKVKAS
Sbjct  915   VALGEVHELTKAQYMDKPPKGKHSTKGLGKKVPLESEYVEWRD-VVVPCGKPVASKVKAS  973

Query  283   ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             EL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  974   ELMYNEYIVYNTAQVKMQFLLKVRFHHK  1001



>gb|ACN36904.1| unknown [Zea mays]
Length=253

 Score =   351 bits (901),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
              DSED++L+E+YL  THAPTHK+W+LE+E+VFSL+R GEL+K++ ++  L N+MLLWHG
Sbjct  45   AHDSEDYKLIEQYLLNTHAPTHKDWSLELEEVFSLDRDGELNKYSRYKNNLHNKMLLWHG  104

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +R NPVG MLLSE
Sbjct  105  SRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRNNPVGLMLLSE  164

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++VKWRD+VVVPCGKPVPS +++S
Sbjct  165  VALGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEFVKWRDDVVVPCGKPVPSSIRSS  224

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            EL+YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  225  ELMYNEYIVYNTSQVKMQFLLKVRFHHK  252



>ref|XP_007199702.1| hypothetical protein PRUPE_ppa000811mg [Prunus persica]
 gb|EMJ00901.1| hypothetical protein PRUPE_ppa000811mg [Prunus persica]
Length=997

 Score =   374 bits (960),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSEDF+L++KYL  THAPTH +W+LE+E+VF+LER+GE DKFAP+RKKL NRMLLWHGSR
Sbjct  791  DSEDFQLIKKYLLTTHAPTHTDWSLELEEVFALEREGEFDKFAPYRKKLNNRMLLWHGSR  850

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T++KNPVG MLLSEVA
Sbjct  851  FTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKNPVGLMLLSEVA  910

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HELKKA YMDKPPKGKHSTKGLGK +PQES+YVKW+D+V+VPCGKPVPS +KASEL
Sbjct  911  LGEVHELKKATYMDKPPKGKHSTKGLGKKIPQESEYVKWKDDVIVPCGKPVPSNIKASEL  970

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVYD AQVK+QFL+KVRF +K
Sbjct  971  MYNEYIVYDKAQVKMQFLLKVRFHHK  996



>gb|KDP21330.1| hypothetical protein JCGZ_21801 [Jatropha curcas]
Length=982

 Score =   373 bits (958),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+EKYL  THAPTH +W+LE+E+VFSLER+GE+DKFAP+RKKLKNRMLLWHGSR
Sbjct  776  DSEDYQLIEKYLNITHAPTHTDWSLELEEVFSLEREGEIDKFAPYRKKLKNRMLLWHGSR  835

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYCFT++KNPVG MLLSEVA
Sbjct  836  LTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTDKKNPVGLMLLSEVA  895

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELK A YMDKPP+GKHSTKGLGK VPQES++VKWR++V VPCGKPVPSKVKASEL
Sbjct  896  LGEVYELKNAMYMDKPPQGKHSTKGLGKKVPQESEFVKWRNDVTVPCGKPVPSKVKASEL  955

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY  AQVK+QFL+KVRF +K
Sbjct  956  MYNEYIVYSTAQVKMQFLLKVRFHHK  981



>gb|KDO68484.1| hypothetical protein CISIN_1g035625mg [Citrus sinensis]
Length=954

 Score =   372 bits (956),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+EKYL ATHAPTH +W+LE+E+VFSLER+GE DKF+ +++KLKNRMLLWHGSR
Sbjct  748  DSEDYQLIEKYLHATHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSR  807

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYCFT++KNPVG MLLSEV 
Sbjct  808  LTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTDKKNPVGLMLLSEVG  867

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA+YMDKPP GKHSTKGLGKTVPQESD+VKWRD+V VPCGKPVPS V+ASEL
Sbjct  868  LGEVYELKKAKYMDKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPVPSNVRASEL  927

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  928  MYNEYIVYNTAQVKMQFLLKVRFHHK  953



>ref|XP_002521021.1| poly [ADP-ribose] polymerase, putative [Ricinus communis]
 gb|EEF41438.1| poly [ADP-ribose] polymerase, putative [Ricinus communis]
Length=982

 Score =   372 bits (955),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
            + DSED++L+EKYL  THAPTH +W+LE+E+VFSLER+GE+DKFAP+R+KLKNRMLLWHG
Sbjct  774  SHDSEDYQLIEKYLHTTHAPTHTDWSLELEEVFSLEREGEIDKFAPYRRKLKNRMLLWHG  833

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SRLTN+VGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T++KNPVG MLLSE
Sbjct  834  SRLTNYVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKNPVGLMLLSE  893

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALG+++ELK A YMDKPP+GKHSTKGLGK VPQES++VKWRDEV VPCG+PVPSKVKAS
Sbjct  894  VALGEVYELKNAMYMDKPPEGKHSTKGLGKKVPQESEFVKWRDEVTVPCGRPVPSKVKAS  953

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            EL+YNEYIVY+ AQVK+QFL+KVRF++K
Sbjct  954  ELMYNEYIVYNTAQVKMQFLLKVRFRHK  981



>ref|XP_011080022.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Sesamum indicum]
Length=995

 Score =   372 bits (955),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
            + DSEDF+L+EKYL  THAPTH EWALE+E+VFSLER+GE+DK+ P+R KLKNRMLLWHG
Sbjct  787  SHDSEDFQLIEKYLNTTHAPTHTEWALELEEVFSLEREGEVDKYQPYRAKLKNRMLLWHG  846

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SRLTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYC+T+RKNPVG MLLSE
Sbjct  847  SRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCYTDRKNPVGLMLLSE  906

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALG+++EL K+QYMDKPPKGKHSTKGLGK VP ES++VKW+DEVVVPCGKPV SKVK S
Sbjct  907  VALGEVYELTKSQYMDKPPKGKHSTKGLGKKVPLESEHVKWKDEVVVPCGKPVASKVKTS  966

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            EL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  967  ELMYNEYIVYNTAQVKMQFLLKVRFHHK  994



>ref|XP_010274828.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nelumbo nucifera]
Length=987

 Score =   369 bits (948),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+RLVEKYL  THAPTHK+W+LE+E+VF+LER GE DKFAP+R+KLKNRMLLWHGSR
Sbjct  775  DSEDYRLVEKYLLTTHAPTHKDWSLELEEVFTLERDGEFDKFAPYREKLKNRMLLWHGSR  834

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAPTTGYMFGKG+YFAD+VSKSAQYC+T++KNPVG M+LSEVA
Sbjct  835  LTNFVGILSQGLRIAPPEAPTTGYMFGKGIYFADLVSKSAQYCYTDKKNPVGLMILSEVA  894

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA YM+KPPKGKHSTKGLG   PQES+Y KWRD+V+VPCGKPV S VK+SEL
Sbjct  895  LGEVYELKKALYMEKPPKGKHSTKGLGMKKPQESEYAKWRDDVIVPCGKPVSSNVKSSEL  954

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVK+QFL+KVRFQ+K
Sbjct  955  MYNEYIVYNTAQVKMQFLLKVRFQHK  980



>ref|XP_006443872.1| hypothetical protein CICLE_v10018683mg [Citrus clementina]
 ref|XP_006479562.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Citrus sinensis]
 gb|ESR57112.1| hypothetical protein CICLE_v10018683mg [Citrus clementina]
Length=996

 Score =   369 bits (948),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+EKYL  THAPTH +W+LE+E+VFSLER+GE DKF+ +++KLKNRMLLWHGSR
Sbjct  790  DSEDYQLIEKYLHTTHAPTHTDWSLELEEVFSLEREGEFDKFSSYQRKLKNRMLLWHGSR  849

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYCFT++KNPVG MLLSEV 
Sbjct  850  LTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTDKKNPVGLMLLSEVG  909

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA+YMDKPP GKHSTKGLGKTVPQESD+VKWRD+V VPCGKP PS V+ASEL
Sbjct  910  LGEVYELKKAKYMDKPPDGKHSTKGLGKTVPQESDFVKWRDDVTVPCGKPAPSNVRASEL  969

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  970  MYNEYIVYNTAQVKMQFLLKVRFHHK  995



>ref|XP_011457987.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Fragaria vesca subsp. 
vesca]
Length=984

 Score =   369 bits (946),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+EKYL  THAPTH +W+LE+E+VFSLER+GE DK+AP+RK LKNRMLLWHGSR
Sbjct  778  DSEDYQLIEKYLLTTHAPTHTDWSLELEEVFSLEREGEFDKYAPYRKTLKNRMLLWHGSR  837

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T++KNPVG MLLSEVA
Sbjct  838  FTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKNPVGLMLLSEVA  897

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HELKKA YMDKPPKGKHSTKGLGK  P+ESDYVKWRD+V VPCGKPV S V+ASEL
Sbjct  898  LGEIHELKKATYMDKPPKGKHSTKGLGKKKPEESDYVKWRDDVTVPCGKPVDSHVRASEL  957

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVYD AQVK+QFL+KV+F +K
Sbjct  958  MYNEYIVYDTAQVKMQFLLKVKFHHK  983



>emb|CDY24761.1| BnaC04g13660D [Brassica napus]
Length=918

 Score =   367 bits (941),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
            + DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP R+KL N+MLLWHG
Sbjct  710  SHDSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPHREKLGNKMLLWHG  769

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T+++NPVG MLLSE
Sbjct  770  SRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTSKENPVGLMLLSE  829

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S++ KWRD+V VPCGKPVPSK KAS
Sbjct  830  VALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSEFAKWRDDVTVPCGKPVPSKAKAS  889

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            EL+YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  890  ELMYNEYIVYNTAQVKLQFLLKVRFKHK  917



>ref|XP_009144225.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Brassica 
rapa]
Length=967

 Score =   368 bits (944),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
            + DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP R+KL N+MLLWHG
Sbjct  759  SHDSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPHREKLGNKMLLWHG  818

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYCFT+++NPVG MLLSE
Sbjct  819  SRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTSKENPVGLMLLSE  878

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S++ KWRD+V VPCGKPVPSK KAS
Sbjct  879  VALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSEFAKWRDDVTVPCGKPVPSKAKAS  938

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            EL+YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  939  ELMYNEYIVYNTAQVKLQFLLKVRFKHK  966



>ref|XP_009144226.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Brassica 
rapa]
Length=966

 Score =   368 bits (944),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
            + DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP R+KL N+MLLWHG
Sbjct  758  SHDSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPHREKLGNKMLLWHG  817

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYCFT+++NPVG MLLSE
Sbjct  818  SRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTSKENPVGLMLLSE  877

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S++ KWRD+V VPCGKPVPSK KAS
Sbjct  878  VALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSEFAKWRDDVTVPCGKPVPSKAKAS  937

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            EL+YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  938  ELMYNEYIVYNTAQVKLQFLLKVRFKHK  965



>ref|XP_010918778.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Elaeis guineensis]
Length=947

 Score =   367 bits (942),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++LVEKYL  THAPTHKEW+LE+E+VF+LER+GE DK+ P+R KL+N+MLLWHGSR
Sbjct  741  DSEDYKLVEKYLLNTHAPTHKEWSLELEEVFALEREGEYDKYTPYRDKLQNKMLLWHGSR  800

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGI+SQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ ++KNPVG MLLSEVA
Sbjct  801  LTNFVGIISQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYVDKKNPVGLMLLSEVA  860

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA YM+KPPKGKHSTKGLGKTVP ESD+VKW+D+VVVPCGKPVPS ++ASEL
Sbjct  861  LGEIYELKKATYMEKPPKGKHSTKGLGKTVPLESDFVKWQDQVVVPCGKPVPSSIRASEL  920

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVYD AQVKLQFL+KVRF +K
Sbjct  921  LYNEYIVYDTAQVKLQFLLKVRFHHK  946



>ref|XP_009354923.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Pyrus x bretschneideri]
Length=966

 Score =   367 bits (942),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+EKYL  THAPTH +W+LE+E+VF+LER+GE +KFAP++KKLKN+MLLWHGSR
Sbjct  760  DSEDYQLIEKYLLTTHAPTHTDWSLELEEVFALEREGEFNKFAPYQKKLKNKMLLWHGSR  819

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T++KNPVG MLLSEVA
Sbjct  820  FTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKNPVGLMLLSEVA  879

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA YMDKPPKGKHSTKGLGK +PQES+YVKW+D+V+VPCGKPVPS +KASEL
Sbjct  880  LGEVYELKKAAYMDKPPKGKHSTKGLGKKIPQESEYVKWKDDVIVPCGKPVPSNIKASEL  939

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVYD AQVK+Q+L+KVRF +K
Sbjct  940  MYNEYIVYDTAQVKMQYLLKVRFHHK  965



>ref|XP_010652358.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Vitis vinifera]
 emb|CBI37089.3| unnamed protein product [Vitis vinifera]
Length=996

 Score =   366 bits (940),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSE++RL+EKYL  THAPTH +W LE+E+VFSLER+GE DKFA +R+KL+NRMLLWHGSR
Sbjct  790  DSEEYRLIEKYLLTTHAPTHMDWTLELEEVFSLEREGEFDKFASYREKLQNRMLLWHGSR  849

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYC+T+RKNPVG MLLSEVA
Sbjct  850  LTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCYTDRKNPVGLMLLSEVA  909

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++EL+KA YMDKPP+GKHSTKGLGK  PQ+S+YVKWRDEVVVPCGKPVPS VK++EL
Sbjct  910  LGEVYELRKAMYMDKPPEGKHSTKGLGKKKPQDSEYVKWRDEVVVPCGKPVPSNVKSTEL  969

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  970  MYNEYIVYNTAQVKMQFLLKVRFHHK  995



>gb|KEH23887.1| poly(ADP-ribose) polymerase domain protein [Medicago truncatula]
Length=1006

 Score =   366 bits (940),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817   DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
             DSEDFRLVEK+L  THAPTH +W+LE+E+VFSLER+GE DK+AP+R K+ NRMLLWHGSR
Sbjct  800   DSEDFRLVEKFLHTTHAPTHTDWSLELEEVFSLEREGEFDKYAPYRDKVGNRMLLWHGSR  859

Query  637   LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYCFT++KNPVG MLLSEVA
Sbjct  860   LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTDKKNPVGLMLLSEVA  919

Query  457   LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
             LG+++ELKKA+YMDKPP+GKHSTKGLGK +P ES+Y KWRD+VVVPCGKPV S VKASEL
Sbjct  920   LGNVYELKKAKYMDKPPQGKHSTKGLGKKMPLESEYAKWRDDVVVPCGKPVSSNVKASEL  979

Query  277   LYNEYIVYDIAQVKLQFLVKVRFQYK  200
             +YNEYIVY+ AQVKLQFL+KVRF +K
Sbjct  980   MYNEYIVYNTAQVKLQFLLKVRFHHK  1005



>ref|XP_010522166.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Tarenaya hassleriana]
Length=986

 Score =   365 bits (938),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DKFAP+R+KL N+MLLWHGSR
Sbjct  776  DSEDYRLIEKYLHTTHAPTHTEWSLELEEVFALEREGEFDKFAPYREKLGNKMLLWHGSR  835

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYC+T+++NPVG MLLSEVA
Sbjct  836  LTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCYTSKENPVGLMLLSEVA  895

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++EL KA+YMDKPP+GKHSTKGLGK VP E D+VKWRD+V VPCGKPV SKVKASEL
Sbjct  896  LGEVYELTKAKYMDKPPRGKHSTKGLGKKVPHEQDFVKWRDDVTVPCGKPVASKVKASEL  955

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVKLQFL+KVRF +K
Sbjct  956  MYNEYIVYNTAQVKLQFLLKVRFHHK  981



>ref|XP_006293618.1| hypothetical protein CARUB_v10022570mg [Capsella rubella]
 gb|EOA26516.1| hypothetical protein CARUB_v10022570mg [Capsella rubella]
Length=985

 Score =   365 bits (937),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP+R+KL N+MLLWHGSR
Sbjct  779  DSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPYREKLGNKMLLWHGSR  838

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T ++NPVG MLLSEVA
Sbjct  839  LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTGKENPVGLMLLSEVA  898

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+SD+ KWR +V VPCGKPV SKVKASEL
Sbjct  899  LGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSDFAKWRGDVTVPCGKPVSSKVKASEL  958

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  959  MYNEYIVYNTAQVKLQFLLKVRFKHK  984



>ref|XP_010038006.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Eucalyptus grandis]
 gb|KCW49804.1| hypothetical protein EUGRSUZ_K03285 [Eucalyptus grandis]
Length=1000

 Score =   365 bits (937),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSE+++L++KYL  THAPTH +W LE+E VFSLER+GE DKFAPFR+ L+NRMLLWHGSR
Sbjct  794  DSEEYQLIKKYLHKTHAPTHTDWTLELEDVFSLEREGEFDKFAPFRQNLRNRMLLWHGSR  853

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSAQYCFT++KNPVG MLLSEVA
Sbjct  854  LTNFVGILSQGLRIAPPEAPATGYMFGKGLYFADMVSKSAQYCFTDKKNPVGLMLLSEVA  913

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HELKKA+Y+DKPP GKHSTKGLGKTVP ES+Y+KW+D+V+VPCGKPV S VKASEL
Sbjct  914  LGEVHELKKAKYIDKPPGGKHSTKGLGKTVPLESEYLKWKDDVIVPCGKPVSSNVKASEL  973

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVY+ AQVK+QFL+KVRF ++
Sbjct  974  LYNEYIVYNTAQVKMQFLLKVRFHHR  999



>ref|XP_004493762.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cicer arietinum]
Length=998

 Score =   365 bits (936),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSEDFRLVEKYL  THAPTH +W+LE+E+VFSLER+GE DKFAP+R KL NRMLLWHGSR
Sbjct  792  DSEDFRLVEKYLHTTHAPTHVDWSLELEEVFSLEREGEFDKFAPYRDKLGNRMLLWHGSR  851

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T++KNPVG MLLSEVA
Sbjct  852  LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDKKNPVGLMLLSEVA  911

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA+YMDKPP+GKHSTKGLGK +P ES+YVKWR +VVVPCGKPV S VKASEL
Sbjct  912  LGNVYELKKAKYMDKPPEGKHSTKGLGKKMPLESEYVKWRGDVVVPCGKPVSSNVKASEL  971

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNE+IVY+ AQVKLQFL+KVRF +K
Sbjct  972  MYNEFIVYNTAQVKLQFLLKVRFHHK  997



>ref|XP_010679215.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=983

 Score =   364 bits (935),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/206 (81%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+EKYL  THAPTH +W LE+E+VFSLER+GE DKFA  R+KL NRMLLWHGSR
Sbjct  777  DSEDYQLIEKYLLTTHAPTHTDWRLELEEVFSLEREGEHDKFASQREKLGNRMLLWHGSR  836

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYC+T+RKNPVG MLLSEVA
Sbjct  837  LTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCYTDRKNPVGLMLLSEVA  896

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG +HELKKAQYM+KPP+GKHSTKGLGK VP E+ + KW+DEVVVPCGKPV SKVK+SEL
Sbjct  897  LGQVHELKKAQYMEKPPRGKHSTKGLGKKVPAEAGFAKWKDEVVVPCGKPVDSKVKSSEL  956

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVYD AQVK+QFL+KVRF YK
Sbjct  957  MYNEYIVYDTAQVKMQFLLKVRFHYK  982



>ref|XP_003521279.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Glycine 
max]
Length=997

 Score =   364 bits (935),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSE+F L+EK+LQ THAPTH +W+LE+E+VFSLER+GE DKFAP+R KL NRMLLWHGSR
Sbjct  791  DSEEFCLIEKFLQNTHAPTHTDWSLELEEVFSLEREGESDKFAPYRDKLGNRMLLWHGSR  850

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYCFT++KNPVG MLLSEVA
Sbjct  851  LTNFVGILNQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTDKKNPVGLMLLSEVA  910

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA+YMDKPP+GKHSTKGLGK +PQES+YVKWR  V VPCGKPVPS VK+SEL
Sbjct  911  LGNVYELKKAKYMDKPPEGKHSTKGLGKKMPQESEYVKWRGNVTVPCGKPVPSNVKSSEL  970

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  971  MYNEYIVYNTAQVKMQFLLKVRFHHK  996



>ref|XP_003554282.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Glycine max]
 gb|KHN02523.1| Poly [ADP-ribose] polymerase 1 [Glycine soja]
Length=996

 Score =   364 bits (934),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSE+F L+EK+L  THAPTH +W+LE+E+VFSLER+GE DKFAP+R KL NRMLLWHGSR
Sbjct  790  DSEEFCLIEKFLHNTHAPTHTDWSLELEEVFSLEREGEFDKFAPYRDKLGNRMLLWHGSR  849

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYCFT++KNPVG MLLSEVA
Sbjct  850  LTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTDKKNPVGLMLLSEVA  909

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA+YMDKPP+GKHSTKGLGK +PQES+YVKWR  V VPCGKPVPS VK+SEL
Sbjct  910  LGNVYELKKAKYMDKPPEGKHSTKGLGKKMPQESEYVKWRGNVTVPCGKPVPSNVKSSEL  969

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  970  MYNEYIVYNTAQVKMQFLLKVRFHHK  995



>ref|NP_850165.1| poly [ADP-ribose] polymerase 2 [Arabidopsis thaliana]
 sp|Q9ZP54.2|PARP1_ARATH RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Arabidopsis thaliana]
 emb|CAA10482.1| poly(ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AAM13882.1| putative poly (ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AAN12901.1| putative poly(ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AEC08527.1| poly [ADP-ribose] polymerase 2 [Arabidopsis thaliana]
Length=983

 Score =   364 bits (934),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP R+KL N+MLLWHGSR
Sbjct  777  DSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPHREKLGNKMLLWHGSR  836

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T +KNPVG MLLSEVA
Sbjct  837  LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKNPVGLMLLSEVA  896

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S++ KWR +V VPCGKPV SKVKASEL
Sbjct  897  LGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSEFAKWRGDVTVPCGKPVSSKVKASEL  956

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVYD AQVKLQFL+KVRF++K
Sbjct  957  MYNEYIVYDTAQVKLQFLLKVRFKHK  982



>ref|XP_007162524.1| hypothetical protein PHAVU_001G159200g [Phaseolus vulgaris]
 gb|ESW34518.1| hypothetical protein PHAVU_001G159200g [Phaseolus vulgaris]
Length=1002

 Score =   364 bits (934),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  817   DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
             DSEDF L+EK+L  THAPTH +W+LE+E+VFSLER+GE DKFAP+R KL NRMLLWHGSR
Sbjct  796   DSEDFCLIEKFLHNTHAPTHTDWSLELEEVFSLEREGEFDKFAPYRDKLGNRMLLWHGSR  855

Query  637   LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             LTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYCFT++KNP+G MLLSEVA
Sbjct  856   LTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTDKKNPIGLMLLSEVA  915

Query  457   LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
             LG+++ELKKA+YMDKPP+GKHSTKGLGK +PQES+  KWR  V VPCGKPVPS VKASEL
Sbjct  916   LGNIYELKKAKYMDKPPEGKHSTKGLGKKMPQESECAKWRGNVTVPCGKPVPSNVKASEL  975

Query  277   LYNEYIVYDIAQVKLQFLVKVRFQYK  200
             +YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  976   MYNEYIVYNTAQVKMQFLLKVRFHHK  1001



>emb|CDY10794.1| BnaA05g11420D [Brassica napus]
Length=1322

 Score =   369 bits (946),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  823   TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
             + DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP R+KL N+MLLWHG
Sbjct  1114  SHDSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPHREKLGNKMLLWHG  1173

Query  643   SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
             SRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYCFT+++NPVG MLLSE
Sbjct  1174  SRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTSKENPVGLMLLSE  1233

Query  463   VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
             VALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S++ KWRD+V VPCGKPVPSK KAS
Sbjct  1234  VALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSEFAKWRDDVTVPCGKPVPSKAKAS  1293

Query  283   ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             EL+YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  1294  ELMYNEYIVYNTAQVKLQFLLKVRFKHK  1321



>gb|KFK31229.1| hypothetical protein AALP_AA6G085200 [Arabis alpina]
Length=984

 Score =   363 bits (931),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+ L+E+YL  THAPTH EW+LE+E+VF+LER+GE DK+AP+R+KL N+MLLWHGSR
Sbjct  778  DSEDYLLIEEYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPYREKLGNKMLLWHGSR  837

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYCFT++K+PVG MLLSEVA
Sbjct  838  LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCFTSKKDPVGLMLLSEVA  897

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HEL KA+YMDKPP+GKHSTKGLGK VPQES++ KWRD+V VPCGKPV SKVKASEL
Sbjct  898  LGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQESEFAKWRDDVTVPCGKPVSSKVKASEL  957

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ +QVKLQFL+KVRF++K
Sbjct  958  MYNEYIVYNTSQVKLQFLLKVRFKHK  983



>ref|XP_008461881.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X3 [Cucumis 
melo]
Length=932

 Score =   362 bits (928),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
            + +S+D++L+EKYL  THAPTH +WALE+E+VFSLER+GE DKF PFR+KLKN+MLLWHG
Sbjct  724  SHESDDYKLIEKYLLNTHAPTHTDWALELEEVFSLEREGEFDKFVPFRQKLKNKMLLWHG  783

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T+RKNP+GFM+LSE
Sbjct  784  SRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDRKNPIGFMILSE  843

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALG+++ELKKA+YM+KPP+GKHSTKGLGK VP  S++VKW+++VVVPCGKPV S VKAS
Sbjct  844  VALGEVYELKKAEYMEKPPRGKHSTKGLGKKVPDVSEHVKWKEDVVVPCGKPVASNVKAS  903

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            EL+YNEYIVYD  QVK+QFL+KVRF YK
Sbjct  904  ELMYNEYIVYDTVQVKMQFLLKVRFHYK  931



>gb|AAD20677.1| putative poly (ADP-ribose) polymerase [Arabidopsis thaliana]
Length=1009

 Score =   363 bits (932),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817   DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
             DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP R+KL N+MLLWHGSR
Sbjct  803   DSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPHREKLGNKMLLWHGSR  862

Query  637   LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T +KNPVG MLLSEVA
Sbjct  863   LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKNPVGLMLLSEVA  922

Query  457   LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
             LG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S++ KWR +V VPCGKPV SKVKASEL
Sbjct  923   LGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSEFAKWRGDVTVPCGKPVSSKVKASEL  982

Query  277   LYNEYIVYDIAQVKLQFLVKVRFQYK  200
             +YNEYIVYD AQVKLQFL+KVRF++K
Sbjct  983   MYNEYIVYDTAQVKLQFLLKVRFKHK  1008



>ref|XP_010933094.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1-like [Elaeis guineensis]
Length=985

 Score =   363 bits (931),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSEDF+LVEK L  THAPTHK+W+LE+E+VF+LER+GE DK+AP+R KL+N+MLLWHGSR
Sbjct  779  DSEDFKLVEKXLLNTHAPTHKDWSLELEEVFALEREGEYDKYAPYRDKLRNKMLLWHGSR  838

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ ++KNPVG MLLSEVA
Sbjct  839  LTNFVGILSQGLRIAPPEAPATGYMFGKGLYFADLVSKSAQYCYVDKKNPVGLMLLSEVA  898

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA YM+KPPKGKHSTKGLGKTVP E+++VKWRD+VV+PCGKPVPS ++ASEL
Sbjct  899  LGEIYELKKATYMEKPPKGKHSTKGLGKTVPLETEFVKWRDQVVLPCGKPVPSSIRASEL  958

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVY+ AQVKLQFL+KVRF +K
Sbjct  959  LYNEYIVYNTAQVKLQFLLKVRFHHK  984



>gb|EMS59387.1| Poly [ADP-ribose] polymerase 1 [Triticum urartu]
Length=486

 Score =   348 bits (894),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++LVEKYL  THAPTHK+W+LE+E+V+ L+R GE +K++ ++  L N+MLLWHGSR
Sbjct  280  DSEDYKLVEKYLLNTHAPTHKDWSLELEEVYVLDRDGEGNKYSRYKNNLHNKMLLWHGSR  339

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNF+GILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +RKNP G MLLSEVA
Sbjct  340  LTNFIGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRKNPTGLMLLSEVA  399

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDMHELKKA  MDKPP+GKHSTKGLGKTVP ES++VKWRD+VVVPCGKPVP+ ++ASEL
Sbjct  400  LGDMHELKKATPMDKPPRGKHSTKGLGKTVPLESEFVKWRDDVVVPCGKPVPASIRASEL  459

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVY+ AQVK+QFL+KV+F++K
Sbjct  460  LYNEYIVYNTAQVKMQFLLKVKFRHK  485



>ref|XP_002881169.1| hypothetical protein ARALYDRAFT_902162 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57428.1| hypothetical protein ARALYDRAFT_902162 [Arabidopsis lyrata subsp. 
lyrata]
Length=979

 Score =   362 bits (929),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 163/206 (79%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP R KL N+MLLWHGSR
Sbjct  773  DSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPHRDKLGNKMLLWHGSR  832

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T +KNPVG MLLSEVA
Sbjct  833  LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKNPVGLMLLSEVA  892

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HEL KA+YMDKPPKGKHSTKGLGK VPQ+S++ KWR +V VPCGKPV SKVKASEL
Sbjct  893  LGEIHELTKAKYMDKPPKGKHSTKGLGKKVPQDSEFAKWRGDVTVPCGKPVASKVKASEL  952

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  953  MYNEYIVYNTAQVKLQFLLKVRFKHK  978



>ref|XP_008461880.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Cucumis 
melo]
Length=979

 Score =   362 bits (928),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
            + +S+D++L+EKYL  THAPTH +WALE+E+VFSLER+GE DKF PFR+KLKN+MLLWHG
Sbjct  771  SHESDDYKLIEKYLLNTHAPTHTDWALELEEVFSLEREGEFDKFVPFRQKLKNKMLLWHG  830

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T+RKNP+GFM+LSE
Sbjct  831  SRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDRKNPIGFMILSE  890

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALG+++ELKKA+YM+KPP+GKHSTKGLGK VP  S++VKW+++VVVPCGKPV S VKAS
Sbjct  891  VALGEVYELKKAEYMEKPPRGKHSTKGLGKKVPDVSEHVKWKEDVVVPCGKPVASNVKAS  950

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            EL+YNEYIVYD  QVK+QFL+KVRF YK
Sbjct  951  ELMYNEYIVYDTVQVKMQFLLKVRFHYK  978



>ref|XP_008461878.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Cucumis 
melo]
 ref|XP_008461879.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Cucumis 
melo]
Length=980

 Score =   362 bits (928),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
            + +S+D++L+EKYL  THAPTH +WALE+E+VFSLER+GE DKF PFR+KLKN+MLLWHG
Sbjct  772  SHESDDYKLIEKYLLNTHAPTHTDWALELEEVFSLEREGEFDKFVPFRQKLKNKMLLWHG  831

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T+RKNP+GFM+LSE
Sbjct  832  SRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDRKNPIGFMILSE  891

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALG+++ELKKA+YM+KPP+GKHSTKGLGK VP  S++VKW+++VVVPCGKPV S VKAS
Sbjct  892  VALGEVYELKKAEYMEKPPRGKHSTKGLGKKVPDVSEHVKWKEDVVVPCGKPVASNVKAS  951

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            EL+YNEYIVYD  QVK+QFL+KVRF YK
Sbjct  952  ELMYNEYIVYDTVQVKMQFLLKVRFHYK  979



>ref|XP_010469693.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Camelina sativa]
Length=985

 Score =   361 bits (927),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP+R+KL N+MLLWHGSR
Sbjct  779  DSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPYREKLGNKMLLWHGSR  838

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T +KNPVG MLLSEVA
Sbjct  839  LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKNPVGLMLLSEVA  898

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HEL KA YMDKPP+GKHSTKGLGK VPQ+S++ KWR +V VPCGKPV SKVKASEL
Sbjct  899  LGEIHELTKATYMDKPPRGKHSTKGLGKKVPQDSEFAKWRGDVTVPCGKPVSSKVKASEL  958

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVKLQ+L+KVRF++K
Sbjct  959  MYNEYIVYNTAQVKLQYLLKVRFKHK  984



>ref|XP_010510210.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Camelina sativa]
Length=985

 Score =   361 bits (927),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP+R+KL N+MLLWHGSR
Sbjct  779  DSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPYREKLGNKMLLWHGSR  838

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T +KNPVG MLLSEVA
Sbjct  839  LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKNPVGLMLLSEVA  898

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HEL KA YMDKPP+GKHSTKGLGK VPQ+S++ KWR +V VPCGKPV SKVKASEL
Sbjct  899  LGEIHELTKATYMDKPPRGKHSTKGLGKKVPQDSEFAKWRGDVTVPCGKPVSSKVKASEL  958

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVKLQ+L+KVRF++K
Sbjct  959  MYNEYIVYNTAQVKLQYLLKVRFKHK  984



>ref|XP_010414140.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelina sativa]
Length=985

 Score =   360 bits (925),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP+R+KL N+MLLWHGSR
Sbjct  779  DSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPYREKLGNKMLLWHGSR  838

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T +KNPVG MLLSEVA
Sbjct  839  LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKNPVGLMLLSEVA  898

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HEL KA YMDKPP+GKHSTKGLGK VPQ+S++ KWR +V VPCGKPV SKVKASEL
Sbjct  899  LGEIHELTKATYMDKPPRGKHSTKGLGKKVPQDSEFAKWRGDVSVPCGKPVSSKVKASEL  958

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVKLQ+L+KVRF++K
Sbjct  959  MYNEYIVYNTAQVKLQYLLKVRFKHK  984



>ref|XP_009398035.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=959

 Score =   360 bits (923),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++LVEKYL  THAPTHK+W LE+E+VF+LER+GE DKFAP R  L+N+MLLWHGSR
Sbjct  753  DSEDYQLVEKYLLNTHAPTHKDWTLELEEVFALEREGEFDKFAPRRDTLQNKMLLWHGSR  812

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ ++K+PVG MLLSEVA
Sbjct  813  LTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYVDKKDPVGLMLLSEVA  872

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA YMDKPPKGK STKGLGKTVP ES++VKW+DEVVVPCG+PVPS V+ASEL
Sbjct  873  LGEIYELKKATYMDKPPKGKLSTKGLGKTVPLESEHVKWKDEVVVPCGRPVPSSVRASEL  932

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVYD AQVK+QFL+KVRF +K
Sbjct  933  LYNEYIVYDTAQVKMQFLLKVRFHHK  958



>ref|XP_009398034.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=982

 Score =   360 bits (924),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++LVEKYL  THAPTHK+W LE+E+VF+LER+GE DKFAP R  L+N+MLLWHGSR
Sbjct  776  DSEDYQLVEKYLLNTHAPTHKDWTLELEEVFALEREGEFDKFAPRRDTLQNKMLLWHGSR  835

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ ++K+PVG MLLSEVA
Sbjct  836  LTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYVDKKDPVGLMLLSEVA  895

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA YMDKPPKGK STKGLGKTVP ES++VKW+DEVVVPCG+PVPS V+ASEL
Sbjct  896  LGEIYELKKATYMDKPPKGKLSTKGLGKTVPLESEHVKWKDEVVVPCGRPVPSSVRASEL  955

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVYD AQVK+QFL+KVRF +K
Sbjct  956  LYNEYIVYDTAQVKMQFLLKVRFHHK  981



>ref|XP_008801332.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Phoenix dactylifera]
Length=901

 Score =   358 bits (918),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 190/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSE+++LVEKYL  THAPTHKEW+LE+E+VF+LER+GE DK+ P+  KL+N+MLLWHGSR
Sbjct  695  DSENYKLVEKYLLNTHAPTHKEWSLELEEVFALEREGEYDKYTPYTDKLQNKMLLWHGSR  754

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKGVYFAD+ SKSAQYC+ ++KNPVG MLLSEVA
Sbjct  755  LTNFVGILNQGLRIAPPEAPATGYMFGKGVYFADLASKSAQYCYVDKKNPVGLMLLSEVA  814

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA YM+K PKGKHSTKGLGKTVP ES++VKWRD+VVVPCGKPVPS ++ASEL
Sbjct  815  LGEIYELKKATYMEKAPKGKHSTKGLGKTVPLESEFVKWRDQVVVPCGKPVPSSIRASEL  874

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVYD AQVKLQFL+KVRF +K
Sbjct  875  MYNEYIVYDTAQVKLQFLLKVRFHHK  900



>ref|XP_008794292.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Phoenix dactylifera]
Length=981

 Score =   359 bits (922),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 162/206 (79%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSEDF+LVEKYL  THAPTHK+W+L++E+VF+LER+GE DK+A +R KL N+MLLWHGSR
Sbjct  775  DSEDFKLVEKYLLNTHAPTHKDWSLQLEEVFALEREGEYDKYASYRDKLHNKMLLWHGSR  834

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ ++KNPVG MLLSEVA
Sbjct  835  LTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYVDKKNPVGLMLLSEVA  894

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA Y++KPPKGKHSTKGLGKT P ES++VKWRD+VVVPCGKPVPS ++ASEL
Sbjct  895  LGEIYELKKATYIEKPPKGKHSTKGLGKTAPLESEFVKWRDQVVVPCGKPVPSSIRASEL  954

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVY+ AQVKLQFL+KVRF +K
Sbjct  955  LYNEYIVYNTAQVKLQFLLKVRFHHK  980



>ref|XP_004151977.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cucumis sativus]
 ref|XP_004160262.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cucumis sativus]
 gb|KGN57935.1| hypothetical protein Csa_3G398930 [Cucumis sativus]
Length=980

 Score =   359 bits (921),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
            + +SED++L+EKYL  THAPTH +WALE+E+VFSLER+GE DKF PFR+KLKN+MLLWHG
Sbjct  772  SHESEDYKLIEKYLLNTHAPTHTDWALELEEVFSLEREGEFDKFVPFRQKLKNKMLLWHG  831

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T+R NP+GFM+LSE
Sbjct  832  SRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDRNNPIGFMILSE  891

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALG+++ELKKA+YM+KPP+GKHSTKGLGK VP   ++VKW+++VVVPCGKPV S VKAS
Sbjct  892  VALGEVYELKKAEYMEKPPRGKHSTKGLGKKVPAALEHVKWKEDVVVPCGKPVASNVKAS  951

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            EL+YNEYIVYD AQVK+QFL+KVRF +K
Sbjct  952  ELMYNEYIVYDTAQVKMQFLLKVRFHHK  979



>gb|KJB42240.1| hypothetical protein B456_007G144300 [Gossypium raimondii]
Length=992

 Score =   359 bits (921),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSE+F+L+EKYL  THAPTH +W LE+E+VFSLER+GE DKFAP+R+KL NRMLLWHGSR
Sbjct  786  DSENFQLIEKYLLTTHAPTHTDWKLELEEVFSLEREGEFDKFAPYREKLSNRMLLWHGSR  845

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYCFT+RKNPVG MLLSEVA
Sbjct  846  LTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTDRKNPVGLMLLSEVA  905

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++EL KA+Y++K PKGKHSTKGLGK VP++SD+VKW+D+++VPCGKPVPS VK SEL
Sbjct  906  LGEVYELTKAKYIEKLPKGKHSTKGLGKKVPKKSDFVKWKDDIIVPCGKPVPSSVKESEL  965

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  966  MYNEYIVYNTSQVKMQFLLKVRFHHK  991



>gb|ADE76583.1| unknown [Picea sitchensis]
Length=456

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DS D++L++KYL+ THAPTHKEWALE+E  ++++RKGE D + P++   KNRMLLWHGSR
Sbjct  251  DSSDYQLIKKYLETTHAPTHKEWALELEDAYAIDRKGEYDAYFPYKSNFKNRMLLWHGSR  310

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            +TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T++KNPVG MLLSEVA
Sbjct  311  VTNFVGILSQGLRIAPPEAPATGYMFGKGLYFADLVSKSAQYCYTHKKNPVGLMLLSEVA  370

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HELK A+YMDKPPKGKHSTKG+GKT P +++Y +W D+V VPCG+PVPS VK S+L
Sbjct  371  LGEVHELKSAKYMDKPPKGKHSTKGVGKTKPLDTEYERWGDDVTVPCGRPVPSSVKNSDL  430

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVYD AQVKLQFL+KVRF+YK
Sbjct  431  LYNEYIVYDPAQVKLQFLLKVRFRYK  456



>ref|XP_004959167.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Setaria italica]
Length=845

 Score =   354 bits (908),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++LVE+YL  THAPTHK+W+LE+E+VFSL+R GEL+K++ ++  L N+MLLWHGSR
Sbjct  639  DSEDYKLVERYLLNTHAPTHKDWSLELEEVFSLDRDGELNKYSRYKNNLHNKMLLWHGSR  698

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +R NPVG MLLSEVA
Sbjct  699  LTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRGNPVGLMLLSEVA  758

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++V WRD+VVVPCGKPVPS V++SEL
Sbjct  759  LGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEFVNWRDDVVVPCGKPVPSSVRSSEL  818

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  819  LYNEYIVYNTSQVKMQFLLKVRFHHK  844



>emb|CAA10889.1| poly(ADP-ribose) polymerase [Zea mays]
Length=969

 Score =   353 bits (907),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+E+YL  THAPTHK+W+LE+E+VFSL+R GEL+K++ ++  L N+MLLWHGSR
Sbjct  763  DSEDYKLIEQYLLNTHAPTHKDWSLELEEVFSLDRDGELNKYSRYKNNLHNKMLLWHGSR  822

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +R NPVG MLLSEVA
Sbjct  823  LTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRNNPVGLMLLSEVA  882

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++VKWRD+VVVPCGKPVPS +++SEL
Sbjct  883  LGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEFVKWRDDVVVPCGKPVPSSIRSSEL  942

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  943  MYNEYIVYNTSQVKMQFLLKVRFHHK  968



>ref|XP_007050347.1| Poly(ADP-ribose) polymerase 2 isoform 1 [Theobroma cacao]
 gb|EOX94504.1| Poly(ADP-ribose) polymerase 2 isoform 1 [Theobroma cacao]
Length=976

 Score =   353 bits (907),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSE++RL+EKYL  THAPTH +W LE+E+VFSLER+GE DKFAP+R+KL NRMLLWHGSR
Sbjct  770  DSEEYRLIEKYLLTTHAPTHTDWTLELEEVFSLEREGEFDKFAPYREKLINRMLLWHGSR  829

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T++++PVG MLLSEVA
Sbjct  830  LTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTHKQSPVGLMLLSEVA  889

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++EL KA+Y++K PKGKHSTKGLGK VPQES++VKW+D ++VPCGKPV S+VKASEL
Sbjct  890  LGEVYELTKAKYIEKLPKGKHSTKGLGKKVPQESEFVKWKDNIIVPCGKPVSSRVKASEL  949

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  950  MYNEYIVYNTAQVKMQFLLKVRFHHK  975



>tpg|DAA39431.1| TPA: hypothetical protein ZEAMMB73_927988 [Zea mays]
Length=969

 Score =   353 bits (906),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+E+YL  THAPTHK+W+LE+E+VFSL+R GEL+K++ ++  L N+MLLWHGSR
Sbjct  763  DSEDYKLIEQYLLNTHAPTHKDWSLELEEVFSLDRDGELNKYSRYKNNLHNKMLLWHGSR  822

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +R NPVG MLLSEVA
Sbjct  823  LTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRNNPVGLMLLSEVA  882

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++VKWRD+VVVPCGKPVPS +++SEL
Sbjct  883  LGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEFVKWRDDVVVPCGKPVPSSIRSSEL  942

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  943  MYNEYIVYNTSQVKMQFLLKVRFHHK  968



>ref|XP_002459755.1| hypothetical protein SORBIDRAFT_02g009900 [Sorghum bicolor]
 gb|EER96276.1| hypothetical protein SORBIDRAFT_02g009900 [Sorghum bicolor]
Length=931

 Score =   352 bits (904),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+E+YL  THAPTHK+W+LE+E+VFSL+R GEL+K++ ++  L N+MLLWHGSR
Sbjct  725  DSEDYKLIEQYLLNTHAPTHKDWSLELEEVFSLDRDGELNKYSRYKNNLHNKMLLWHGSR  784

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP +GYMFGKG+YFAD+VSKSAQYC  +R NPVG M+LSEVA
Sbjct  785  LTNFVGILSQGLRIAPPEAPVSGYMFGKGLYFADLVSKSAQYCNVDRNNPVGLMILSEVA  844

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDM+ELKKA YMDKPP+GKHSTKGLGKTVP ES++VKWRD+VVVPCGKPVPS +++SEL
Sbjct  845  LGDMNELKKATYMDKPPRGKHSTKGLGKTVPLESEFVKWRDDVVVPCGKPVPSSIRSSEL  904

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  905  MYNEYIVYNTSQVKMQFLLKVRFHHK  930



>ref|NP_001288538.1| poly [ADP-ribose] polymerase 1 [Zea mays]
 sp|Q9ZSV1.1|PARP1_MAIZE RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Zea mays]
 gb|AAC79704.1| poly(ADP)-ribose polymerase [Zea mays]
 tpg|DAA39432.1| TPA: poly [ADP-ribose] polymerase 1(NAD(+) ADP-ribosyltransferase 
1) [Zea mays]
Length=980

 Score =   353 bits (906),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+E+YL  THAPTHK+W+LE+E+VFSL+R GEL+K++ ++  L N+MLLWHGSR
Sbjct  774  DSEDYKLIEQYLLNTHAPTHKDWSLELEEVFSLDRDGELNKYSRYKNNLHNKMLLWHGSR  833

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +R NPVG MLLSEVA
Sbjct  834  LTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRNNPVGLMLLSEVA  893

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++VKWRD+VVVPCGKPVPS +++SEL
Sbjct  894  LGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEFVKWRDDVVVPCGKPVPSSIRSSEL  953

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  954  MYNEYIVYNTSQVKMQFLLKVRFHHK  979



>ref|XP_007050348.1| Poly(ADP-ribose) polymerase 2 isoform 2 [Theobroma cacao]
 gb|EOX94505.1| Poly(ADP-ribose) polymerase 2 isoform 2 [Theobroma cacao]
Length=991

 Score =   353 bits (907),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/206 (77%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSE++RL+EKYL  THAPTH +W LE+E+VFSLER+GE DKFAP+R+KL NRMLLWHGSR
Sbjct  785  DSEEYRLIEKYLLTTHAPTHTDWTLELEEVFSLEREGEFDKFAPYREKLINRMLLWHGSR  844

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T++++PVG MLLSEVA
Sbjct  845  LTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTHKQSPVGLMLLSEVA  904

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++EL KA+Y++K PKGKHSTKGLGK VPQES++VKW+D ++VPCGKPV S+VKASEL
Sbjct  905  LGEVYELTKAKYIEKLPKGKHSTKGLGKKVPQESEFVKWKDNIIVPCGKPVSSRVKASEL  964

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  965  MYNEYIVYNTAQVKMQFLLKVRFHHK  990



>gb|EPS63698.1| hypothetical protein M569_11084 [Genlisea aurea]
Length=981

 Score =   353 bits (906),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 185/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            +EDF+L+ KYLQ THA TH EW LE+E+VFSL+R+GE DK+APFRKKL NRMLLWHGSRL
Sbjct  776  TEDFKLINKYLQKTHAATHTEWTLELEEVFSLDREGETDKYAPFRKKLSNRMLLWHGSRL  835

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYCFT+  NPVG MLLSEVAL
Sbjct  836  TNFVGILSQGLRIAPPEAPVTGYMFGKGIYFADLVSKSAQYCFTDPDNPVGLMLLSEVAL  895

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G+M+EL K+QYM+KPPKGKHSTKGLGK VP ES++++WRD VVVPCGK V S VK+SEL+
Sbjct  896  GEMYELTKSQYMEKPPKGKHSTKGLGKNVPLESEFMQWRDGVVVPCGKAVTSGVKSSELM  955

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVYD AQVK+QFL+KVRF +K
Sbjct  956  YNEYIVYDSAQVKMQFLLKVRFHHK  980



>gb|EMT10594.1| Poly (ADP-ribose) polymerase 1 [Aegilops tauschii]
Length=607

 Score =   342 bits (877),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 201/251 (80%), Gaps = 14/251 (6%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++LVEKYL  THAPTHK+W+LE+E+V+ L+R GE +K++ ++  L N+MLLWHGSR
Sbjct  280  DSEDYKLVEKYLLNTHAPTHKDWSLELEEVYVLDRDGEGNKYSRYKNNLHNKMLLWHGSR  339

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNF+GILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +RKNP G MLLSEVA
Sbjct  340  LTNFIGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRKNPTGLMLLSEVA  399

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDMHELKKA  MDKPP+GKHSTKGLGKTVP ES++VKWRD+VVVPCGKPVP+ ++ASEL
Sbjct  400  LGDMHELKKATPMDKPPRGKHSTKGLGKTVPLESEFVKWRDDVVVPCGKPVPASIRASEL  459

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK**TKILHY*CFL-----ELYIMVEPMLDILLLST  113
            LYNEYIVY+ AQVK+QFL+K           LH  C +     EL+  + P     ++ST
Sbjct  460  LYNEYIVYNTAQVKMQFLLKYSVAS------LH--CCICNGIGELFRSLRPSQQKKIIST  511

Query  112  LPFEI-AWLFG  83
                + +WL+G
Sbjct  512  CKNHVSSWLYG  522



>ref|XP_006657714.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Oryza brachyantha]
Length=976

 Score =   350 bits (898),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            D+ED++LVEKYL  THAPTHK+W+LE+E+VF L+R GE +K++ ++  L N+MLLWHGSR
Sbjct  770  DTEDYKLVEKYLLNTHAPTHKDWSLELEEVFLLDRDGEFNKYSRYKNNLHNKMLLWHGSR  829

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +RKNPVG MLLSEVA
Sbjct  830  LTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRKNPVGLMLLSEVA  889

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDM+ELKKA  MDKPP+GKHSTKGLG+TVP ES++ KWRD+VVVPCGKPVP+ +KASEL
Sbjct  890  LGDMYELKKATSMDKPPRGKHSTKGLGRTVPLESEFAKWRDDVVVPCGKPVPANIKASEL  949

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  950  LYNEYIVYNTSQVKMQFLLKVRFHHK  975



>gb|EEC81908.1| hypothetical protein OsI_25738 [Oryza sativa Indica Group]
Length=977

 Score =   349 bits (896),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            D ED++LVEKYL  THAPTHKEW+LE+E+VFSL+R GE +K++ ++  L N+MLLWHGSR
Sbjct  771  DCEDYKLVEKYLLNTHAPTHKEWSLELEEVFSLDRDGEFNKYSRYKNNLHNKMLLWHGSR  830

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTN+VGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +RKNPVG MLLSEVA
Sbjct  831  LTNYVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRKNPVGLMLLSEVA  890

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++ KWRD+VVVPCGKPVP+ +K SEL
Sbjct  891  LGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEFAKWRDDVVVPCGKPVPASIKTSEL  950

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ +QVK+Q+L+KVRF +K
Sbjct  951  MYNEYIVYNTSQVKMQYLLKVRFHHK  976



>ref|NP_001059453.1| Os07g0413700 [Oryza sativa Japonica Group]
 sp|Q7EYV7.1|PARP1_ORYSJ RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Oryza sativa Japonica 
Group]
 dbj|BAC84104.1| putative poly(ADP)-ribose polymerase [Oryza sativa Japonica Group]
 dbj|BAF21367.1| Os07g0413700 [Oryza sativa Japonica Group]
 gb|EEE67019.1| hypothetical protein OsJ_23951 [Oryza sativa Japonica Group]
Length=977

 Score =   349 bits (895),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            D ED++LVEKYL  THAPTHKEW+LE+E+VFSL+R GE  K++ ++  L N+MLLWHGSR
Sbjct  771  DCEDYKLVEKYLLNTHAPTHKEWSLELEEVFSLDRDGEFSKYSRYKNNLHNKMLLWHGSR  830

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTN+VGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +RKNPVG MLLSEVA
Sbjct  831  LTNYVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRKNPVGLMLLSEVA  890

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++ KWRD+VVVPCGKPVP+ +K SEL
Sbjct  891  LGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEFAKWRDDVVVPCGKPVPASIKTSEL  950

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ +QVK+Q+L+KVRF +K
Sbjct  951  MYNEYIVYNTSQVKMQYLLKVRFHHK  976



>ref|XP_011028774.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Populus euphratica]
Length=996

 Score =   345 bits (886),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+EKYL  THAPTH +W+LE+E+VF LER+GE D+FAP+R+ LKNRMLLWHGSR
Sbjct  789  DSEDYQLIEKYLITTHAPTHTDWSLELEEVFLLERRGEFDRFAPYRETLKNRMLLWHGSR  848

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFAD+VSKSAQYCFT++KNPVG MLLSEVA
Sbjct  849  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADLVSKSAQYCFTDKKNPVGLMLLSEVA  908

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA YM+KPP+GKHSTKGLGK VP+ES  VKWR++V+VPCGKPV SKVKASEL
Sbjct  909  LGEVYELKKATYMEKPPEGKHSTKGLGKKVPEESGCVKWRNDVIVPCGKPVSSKVKASEL  968

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  969  MYNEYIVYNTAQVKMQFLLKVRFHHK  994



>ref|XP_002302058.2| poly (ADP-ribose) polymerase family protein [Populus trichocarpa]
 gb|EEE81331.2| poly (ADP-ribose) polymerase family protein [Populus trichocarpa]
Length=996

 Score =   345 bits (884),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/206 (80%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++L+EKYL  THAPTH +W+LE+E+VF LER+GE D+FA +R+ LKNRMLLWHGSR
Sbjct  789  DSEDYQLIEKYLLTTHAPTHTDWSLELEEVFLLERRGEFDRFARYRETLKNRMLLWHGSR  848

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFAD+VSKSAQYCFT++KNPVG MLLSEVA
Sbjct  849  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADLVSKSAQYCFTDKKNPVGLMLLSEVA  908

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++ELKKA YM+KPP+GKHSTKGLGK VP+ES YVKWR++V+VPCGKPV SKVKASEL
Sbjct  909  LGEVYELKKATYMEKPPEGKHSTKGLGKKVPEESGYVKWRNDVIVPCGKPVSSKVKASEL  968

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  969  MYNEYIVYNTAQVKMQFLLKVRFHHK  994



>emb|CDP03723.1| unnamed protein product [Coffea canephora]
Length=986

 Score =   344 bits (882),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 187/206 (91%), Gaps = 1/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED+ L+EKYL +THAPTH  W+LE+E+VF+LER+GE DKFAP+R+KL N+MLLWHGSR
Sbjct  782  DSEDYLLIEKYLHSTHAPTHTLWSLELEEVFALEREGEYDKFAPYREKLGNKMLLWHGSR  841

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP +GYMFGKG+YFAD+VSKSAQYCFT++KNPVG MLLSEVA
Sbjct  842  LTNFVGILSQGLRIAPPEAPASGYMFGKGIYFADLVSKSAQYCFTDKKNPVGLMLLSEVA  901

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++EL  A+YM+KPP GKHSTKGLGK VPQES ++KW+ +VVVPCG+PV S +K SEL
Sbjct  902  LGEVYELTNAKYMEKPPAGKHSTKGLGKNVPQESGFLKWQGDVVVPCGRPV-STLKPSEL  960

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVY+ AQVKLQFL+KVRF +K
Sbjct  961  LYNEYIVYNTAQVKLQFLLKVRFHHK  986



>emb|CAN75718.1| hypothetical protein VITISV_037618 [Vitis vinifera]
Length=1016

 Score =   344 bits (883),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSE++RL+EKYL  THAPTH +W LE+E+VFSLER+GE DKFA +R+KL+NRMLLWHGSR
Sbjct  802  DSEEYRLIEKYLLTTHAPTHMDWTLELEEVFSLEREGEFDKFASYREKLQNRMLLWHGSR  861

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYC+T+RKNPVG MLLSEVA
Sbjct  862  LTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCYTDRKNPVGLMLLSEVA  921

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++EL+KA YMDKPP+GKHSTKGLGK  PQ+S+YVKWRDEVVVPCGKPVPS VK++EL
Sbjct  922  LGEVYELRKAMYMDKPPEGKHSTKGLGKKKPQDSEYVKWRDEVVVPCGKPVPSNVKSTEL  981

Query  277  LYNEYIVYDIAQ  242
            +YNEYIVY+ AQ
Sbjct  982  MYNEYIVYNTAQ  993



>ref|XP_006410264.1| hypothetical protein EUTSA_v10016190mg [Eutrema salsugineum]
 gb|ESQ51717.1| hypothetical protein EUTSA_v10016190mg [Eutrema salsugineum]
Length=966

 Score =   343 bits (879),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DS D+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK++P+R+KL N+MLLWHGSR
Sbjct  769  DSNDYRLIEKYLNTTHAPTHTEWSLELEEVFTLEREGEFDKYSPYREKLGNKMLLWHGSR  828

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T ++NPVG MLLSEVA
Sbjct  829  LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKENPVGLMLLSEVA  888

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+SD+ KWRD+V VPCGKPV SKVKASEL
Sbjct  889  LGEVHELTKAKYMDKPPRGKHSTKGLGKKVPQDSDFAKWRDDVTVPCGKPVSSKVKASEL  948

Query  277  LYNEYIVYDIAQV  239
            +YNEYIVY+ AQV
Sbjct  949  MYNEYIVYNTAQV  961



>ref|XP_003557295.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Brachypodium distachyon]
Length=975

 Score =   342 bits (878),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSED++LVEKYL  THAPTHK+W+LE+E+VF L+R GE +K++ ++  L N+MLLWHGSR
Sbjct  769  DSEDYKLVEKYLLNTHAPTHKDWSLELEEVFVLDRDGESNKYSRYKNNLHNKMLLWHGSR  828

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ ++ NP G MLLSEVA
Sbjct  829  LTNFVGILSQGLRIAPPEAPMTGYMFGKGLYFADLVSKSAQYCYADKNNPTGLMLLSEVA  888

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDMHELKKA  MDKPP+GKHSTKGLGKTVP ES++V+W D VVVPCGKPVP+ ++ASEL
Sbjct  889  LGDMHELKKAMPMDKPPRGKHSTKGLGKTVPLESEFVEWSDGVVVPCGKPVPASIRASEL  948

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVY+ +QVK++FL+KVRF +K
Sbjct  949  LYNEYIVYNTSQVKMRFLLKVRFHHK  974



>gb|KHN10726.1| Poly [ADP-ribose] polymerase 1 [Glycine soja]
Length=1526

 Score =   347 bits (889),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  817   DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
             DSE+F L+EK+LQ THAPTH +W+LE+E+VFSLER+GE DKFAP+R KL NRMLLWHGSR
Sbjct  1323  DSEEFCLIEKFLQNTHAPTHTDWSLELEEVFSLEREGEFDKFAPYRDKLGNRMLLWHGSR  1382

Query  637   LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             LTNFVGIL+QGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYCFT++KNPVG MLLSEVA
Sbjct  1383  LTNFVGILNQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTDKKNPVGLMLLSEVA  1442

Query  457   LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
             LG+++ELKKA+YMDKPP+GKHSTKGLGK +PQES+YVKWR  V VPCGKPVPS VK+SEL
Sbjct  1443  LGNVYELKKAKYMDKPPEGKHSTKGLGKKMPQESEYVKWRGNVTVPCGKPVPSNVKSSEL  1502

Query  277   LYNEYIVYDIAQVKLQ  230
             +YNEYIVY+ AQV  +
Sbjct  1503  MYNEYIVYNTAQVSFK  1518



>ref|XP_006827511.1| hypothetical protein AMTR_s00009p00184050 [Amborella trichopoda]
 gb|ERM94927.1| hypothetical protein AMTR_s00009p00184050 [Amborella trichopoda]
Length=849

 Score =   328 bits (841),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DS D+++V+K+L  THAPTHK+W LEVE VF+LER GE DK+AP+R  LKN+MLLWHGSR
Sbjct  497  DSTDYQMVKKFLLNTHAPTHKDWTLEVEDVFALERDGEFDKYAPYRDNLKNKMLLWHGSR  556

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP+TGYMFGKGVYFAD+VSKSAQYC+T++K+ VG +LLSEVA
Sbjct  557  LTNFVGILSQGLRIAPPEAPSTGYMFGKGVYFADLVSKSAQYCYTDKKDAVGLLLLSEVA  616

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+M+ELKKA+YM+ PP+GKHSTKGLG+  P   ++ KWRDE+ VPCG PV S V+A+EL
Sbjct  617  LGEMYELKKAKYMESPPEGKHSTKGLGQKTPNALEFEKWRDEITVPCGSPVSSGVRATEL  676

Query  277  LYNEYIVYDIAQVKLQFLVKV  215
            +YNEYIVY+ AQVK+QFL+KV
Sbjct  677  MYNEYIVYNTAQVKMQFLLKV  697



>ref|XP_010111892.1| Poly [ADP-ribose] polymerase 1 [Morus notabilis]
 gb|EXC31926.1| Poly [ADP-ribose] polymerase 1 [Morus notabilis]
Length=1022

 Score =   328 bits (841),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 176/197 (89%), Gaps = 0/197 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DS+D++L+EKYL  THAPTH +W+LE+E+VFSLER+GE DKF P R+KL N+MLLWHGSR
Sbjct  793  DSDDYQLIEKYLLTTHAPTHTDWSLELEEVFSLERQGEYDKFHPHRQKLGNKMLLWHGSR  852

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T+ KN VG +LLSEVA
Sbjct  853  LTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTDTKNSVGLILLSEVA  912

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+++EL KA+YMDKPP+GKHSTKGLGK VPQ+S+YVKWRD+VVVP GKPV S V+ASEL
Sbjct  913  LGEVYELTKAKYMDKPPEGKHSTKGLGKKVPQKSEYVKWRDDVVVPAGKPVGSNVRASEL  972

Query  277  LYNEYIVYDIAQVKLQF  227
            +YNEYIVY+ AQ    F
Sbjct  973  MYNEYIVYNTAQCGCVF  989



>ref|XP_002969183.1| hypothetical protein SELMODRAFT_90144 [Selaginella moellendorffii]
 gb|EFJ30299.1| hypothetical protein SELMODRAFT_90144 [Selaginella moellendorffii]
Length=965

 Score =   310 bits (794),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DS +F LV+ YL+ THAPTH EW LEVE VF + R GE D +AP +  LKNRMLLWHGSR
Sbjct  760  DSPEFELVKNYLERTHAPTHTEWGLEVEDVFVVSRDGEHDLYAPMKSTLKNRMLLWHGSR  819

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             TNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYCFTNR NPVG MLLSEVA
Sbjct  820  TTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTNRSNPVGLMLLSEVA  879

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGD+ E   AQYM+KPP G  +TKG+G+T+P  S++ ++ D VVVPCG+PVPS+V+ S+L
Sbjct  880  LGDIKEYTHAQYMEKPPAGYMATKGVGRTMPDPSEFKEFDDGVVVPCGRPVPSQVR-SDL  938

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNE+IVY  +Q++L+FL+KVRF+YK
Sbjct  939  LYNEFIVYSTSQIQLRFLLKVRFKYK  964



>ref|XP_002973881.1| hypothetical protein SELMODRAFT_100128 [Selaginella moellendorffii]
 gb|EFJ24836.1| hypothetical protein SELMODRAFT_100128 [Selaginella moellendorffii]
Length=969

 Score =   310 bits (793),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 172/206 (83%), Gaps = 1/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DS +F LV+ YL+ THAPTH EW LEVE VF + R GE D +AP +  LKNRMLLWHGSR
Sbjct  764  DSPEFELVKNYLERTHAPTHTEWGLEVEDVFVVSRDGEHDLYAPMKSTLKNRMLLWHGSR  823

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             TNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+VSKSAQYCFTNR NPVG MLLSEVA
Sbjct  824  TTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLVSKSAQYCFTNRSNPVGLMLLSEVA  883

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGD+ E   AQYM+KPP G  +TKG+G+T+P  S++ ++ D VVVPCG+PVPS+V+ S+L
Sbjct  884  LGDIKEYTHAQYMEKPPAGYMATKGVGRTMPDPSEFKEFDDGVVVPCGRPVPSQVR-SDL  942

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNE+IVY  +Q++L+FL+KVRF+YK
Sbjct  943  LYNEFIVYSTSQIQLRFLLKVRFKYK  968



>ref|XP_001769461.1| predicted protein [Physcomitrella patens]
 gb|EDQ65830.1| predicted protein [Physcomitrella patens]
Length=989

 Score =   306 bits (784),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 174/206 (84%), Gaps = 1/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DS DF+LVEKYL+ THAPTH +WALE+E VF+++R+GE D FAPF+  L N MLLWHGSR
Sbjct  784  DSGDFKLVEKYLKQTHAPTHTDWALELEDVFAVDREGEADSFAPFKMCLDNHMLLWHGSR  843

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
             TN+VGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T +KNP G MLLSEVA
Sbjct  844  TTNYVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYTTKKNPTGLMLLSEVA  903

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG  + LK A+YM+KP +G +ST GLGKT P E+++ K+  +V VPCG+PVPS ++ S+L
Sbjct  904  LGKTNNLKSAKYMEKPLRGTNSTLGLGKTKPLETEFKKFEGDVTVPCGQPVPSGIR-SDL  962

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +YNEYIVYD AQVKL+FL+KV F++K
Sbjct  963  MYNEYIVYDTAQVKLRFLLKVNFKHK  988



>pdb|2RD6|A Chain A, Parp Complexed With A861695
 pdb|3GJW|A Chain A, Parp Complexed With A968427
 pdb|3GN7|A Chain A, Parp Complexed With A861696
 pdb|3L3M|A Chain A, Parp Complexed With A927929
 pdb|3L3L|A Chain A, Parp Complexed With A906894
Length=350

 Score =   267 bits (682),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  145  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  203

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  204  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  263

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  264  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  322

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  323  LLYNEYIVYDIAQVNLKYLLKLKFNFK  349



>pdb|1UK0|A Chain A, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase With A Novel Inhibitor
 pdb|1UK0|B Chain B, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase With A Novel Inhibitor
 pdb|1UK1|A Chain A, Crystal Structure Of Human Poly(Adp-Ribose) Polymerase 
Complexed With A Potent Inhibitor
 pdb|1UK1|B Chain B, Crystal Structure Of Human Poly(Adp-Ribose) Polymerase 
Complexed With A Potent Inhibitor
 pdb|1WOK|A Chain A, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase Complexed With A Quinoxaline-Type Inhibitor
 pdb|1WOK|B Chain B, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase Complexed With A Quinoxaline-Type Inhibitor
 pdb|1WOK|C Chain C, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase Complexed With A Quinoxaline-Type Inhibitor
 pdb|1WOK|D Chain D, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase Complexed With A Quinoxaline-Type Inhibitor
 pdb|2RCW|A Chain A, Parp Complexed With A620223
Length=350

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  145  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  203

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  204  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  263

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  264  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  322

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  323  LLYNEYIVYDIAQVNLKYLLKLKFNFK  349



>pdb|4L6S|A Chain A, Parp Complexed With Benzo[1,4]oxazin-3-one Inhibitor
 pdb|4L6S|B Chain B, Parp Complexed With Benzo[1,4]oxazin-3-one Inhibitor
Length=353

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  148  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  206

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  207  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  266

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  267  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  325

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  326  LLYNEYIVYDIAQVNLKYLLKLKFNFK  352



>pdb|4GV7|A Chain A, Human Artd1 (parp1) - Catalytic Domain In Complex With 
Inhibitor Me0328
 pdb|4GV7|B Chain B, Human Artd1 (parp1) - Catalytic Domain In Complex With 
Inhibitor Me0328
 pdb|4GV7|C Chain C, Human Artd1 (parp1) - Catalytic Domain In Complex With 
Inhibitor Me0328
 pdb|4GV7|D Chain D, Human Artd1 (parp1) - Catalytic Domain In Complex With 
Inhibitor Me0328
Length=358

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  146  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  204

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  205  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  264

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  265  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  323

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  324  LLYNEYIVYDIAQVNLKYLLKLKFNFK  350



>pdb|4HHY|A Chain A, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHY|B Chain B, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHY|C Chain C, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHY|D Chain D, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHZ|A Chain A, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHZ|B Chain B, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHZ|C Chain C, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHZ|D Chain D, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
Length=355

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  150  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  208

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  209  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  268

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  269  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  327

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  328  LLYNEYIVYDIAQVNLKYLLKLKFNFK  354



>pdb|4PJT|A Chain A, Structure Of Parp1 Catalytic Domain Bound To Inhibitor 
Bmn 673
 pdb|4PJT|B Chain B, Structure Of Parp1 Catalytic Domain Bound To Inhibitor 
Bmn 673
 pdb|4PJT|C Chain C, Structure Of Parp1 Catalytic Domain Bound To Inhibitor 
Bmn 673
 pdb|4PJT|D Chain D, Structure Of Parp1 Catalytic Domain Bound To Inhibitor 
Bmn 673
Length=370

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  165  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  223

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  224  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  283

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  284  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  342

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  343  LLYNEYIVYDIAQVNLKYLLKLKFNFK  369



>gb|KFB53217.1| AGAP003230-PA-like protein [Anopheles sinensis]
Length=361

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 1/207 (0%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            R SE+F L+++Y++ THA THK++ LE+E+VF ++R+GE  ++ PFR  L NR LLWHGS
Sbjct  155  RTSEEFALLQQYVRNTHAATHKDYELEIEEVFCVKRQGEDKRYEPFRG-LHNRKLLWHGS  213

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            RLTNFVGILS GLRIAPPEAP TGYMFGKG+YFADMVSKSA YCFTN  +P G MLL EV
Sbjct  214  RLTNFVGILSNGLRIAPPEAPATGYMFGKGIYFADMVSKSANYCFTNPADPKGLMLLCEV  273

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALGDM E  +A Y++K P G+HS KG+G+T P  +      D V +P GK V ++   S 
Sbjct  274  ALGDMQEYTRANYVEKLPTGRHSVKGIGRTQPDPTASHTRPDGVEIPLGKGVTNENMDSS  333

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNE+IVYD+AQV  Q+L+K++F YK
Sbjct  334  LLYNEFIVYDVAQVNCQYLLKMKFLYK  360



>ref|XP_005809620.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Xiphophorus 
maculatus]
Length=212

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            + +++  ++ +Y++ THA TH  + LEV+ +F + R+GE  ++ PF ++L NR LLWHGS
Sbjct  4    KTTQEAEIIMQYVKNTHAATHNTYTLEVQDIFKVAREGEHQRYRPF-EELHNRQLLWHGS  62

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL+EV
Sbjct  63   RATNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLILLAEV  122

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+MHELKKA ++ K PKGKHS KGLG+T P + +     + V VP GK V + +  + 
Sbjct  123  ALGNMHELKKASHITKLPKGKHSVKGLGRTAP-DPNASTTLNGVQVPLGKGVNTNIDDTS  181

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQ+ L++L+K+RF Y+
Sbjct  182  LLYNEYIVYDVAQINLKYLLKIRFNYQ  208



>emb|CAA46478.1| Poly(ADP-ribose) polymerase [Rattus norvegicus]
Length=492

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  284  RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  342

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  343  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  402

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct  403  ALGNMYELKHASHISKLPKGKHSVKGLGKTAPDPSASITL-DGVEVPLGTGIPSGVNDTC  461

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  462  LLYNEYIVYDIAQVNLKYLLKLKFNFK  488



>ref|XP_004333519.1| Poly(ADPribose) polymerase catalytic domain containing protein 
[Acanthamoeba castellanii str. Neff]
 gb|ELR11506.1| Poly(ADPribose) polymerase catalytic domain containing protein 
[Acanthamoeba castellanii str. Neff]
Length=774

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            + ++F++V KYL+ THAP+H +++LE+  +F ++R+GE+ ++  +  KL NRMLLWHGSR
Sbjct  570  EEKEFKMVSKYLRQTHAPSHSQYSLELLDLFKIDREGEMARYEKW-AKLHNRMLLWHGSR  628

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTN+ GILSQGLRIAPPEAP+TGYMFGKGVYFADM SKSA YCFT+R+N VG M LSEVA
Sbjct  629  LTNWAGILSQGLRIAPPEAPSTGYMFGKGVYFADMASKSANYCFTSRENNVGIMTLSEVA  688

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDM++L  ++YMDKPP G HSTKG G+T P  S  V  ++ V VPCG+P  S    S L
Sbjct  689  LGDMYQLLHSKYMDKPPAGYHSTKGCGQTEPDPSTAVLTKEGVKVPCGEPSKSGAVGSSL  748

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVYD+ Q+ +++L+KV+F YK
Sbjct  749  LYNEYIVYDVGQINIKYLLKVKFSYK  774



>pdb|4DQY|C Chain C, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break
 pdb|4DQY|F Chain F, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break
Length=506

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  290  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  348

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  349  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  408

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  409  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  467

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  468  LLYNEYIVYDIAQVNLKYLLKLKFNFK  494



>dbj|BAE88881.1| unnamed protein product [Macaca fascicularis]
Length=411

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  203  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  261

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct  262  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIVLGEV  321

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  322  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASISL-DGVEVPLGTGISSGVNDTC  380

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  381  LLYNEYIVYDIAQVNLKYLLKLKFNFK  407



>pdb|4OPX|C Chain C, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2r)-5-fluoro-2-methyl-2,3-dihydro-1-benzofuran-7- 
Carboxamide
 pdb|4OPX|F Chain F, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2r)-5-fluoro-2-methyl-2,3-dihydro-1-benzofuran-7- 
Carboxamide
 pdb|4OQA|C Chain C, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2z)-2-(2,4-dihydroxybenzylidene)-3-oxo-2,3-dihydro-1- 
Benzofuran-7-carboxamide
 pdb|4OQA|F Chain F, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2z)-2-(2,4-dihydroxybenzylidene)-3-oxo-2,3-dihydro-1- 
Benzofuran-7-carboxamide
 pdb|4OQB|C Chain C, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2z)-2-{4-[2-(morpholin-4-yl)ethoxy]benzylidene}-3-oxo- 
2,3-dihydro-1-benzofuran-7-carboxamide
 pdb|4OQB|F Chain F, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2z)-2-{4-[2-(morpholin-4-yl)ethoxy]benzylidene}-3-oxo- 
2,3-dihydro-1-benzofuran-7-carboxamide
Length=505

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  289  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  347

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  348  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  407

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  408  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  466

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  467  LLYNEYIVYDIAQVNLKYLLKLKFNFK  493



>ref|XP_011165140.1| PREDICTED: poly [ADP-ribose] polymerase-like [Solenopsis invicta]
 gb|EFZ14625.1| hypothetical protein SINV_00499 [Solenopsis invicta]
Length=979

 Score =   275 bits (702),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 166/207 (80%), Gaps = 1/207 (0%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            + S++F+++EKY++ THA TH+++ LE+E+VF ++R+GE  +F PF KKL NR LLWHGS
Sbjct  773  KTSDEFKMIEKYVKNTHAATHRQYELEIEEVFVIKRQGEEQRFKPF-KKLHNRKLLWHGS  831

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T+ ++P G ++L EV
Sbjct  832  RTTNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTHSQSPTGLLMLCEV  891

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+E  ++ Y++K PKGKHST G G+T P   D  K  D V VP GK VP+K+K S 
Sbjct  892  ALGNMYERYQSDYIEKLPKGKHSTMGCGQTHPDPQDVYKTEDGVEVPYGKGVPAKIKNSA  951

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQVK+++L+K+ F+YK
Sbjct  952  LLYNEYIVYDVAQVKVRYLIKMNFKYK  978



>gb|AAA51599.1| poly(ADP-ribose) polymerase, partial [Homo sapiens]
Length=574

 Score =   266 bits (679),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  366  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  424

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  425  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  484

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  485  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  543

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  544  LLYNEYIVYDIAQVNLKYLLKLKFNFK  570



>ref|XP_002163577.2| PREDICTED: poly [ADP-ribose] polymerase 1-like [Hydra vulgaris]
Length=398

 Score =   260 bits (665),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 157/206 (76%), Gaps = 1/206 (0%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            ++S+DF L+ +Y++ THA TH  ++L+V +VFS+ER GE  ++ PF K L N+ LLWHGS
Sbjct  192  KESKDFELIVEYVKNTHAKTHSNYSLDVIEVFSIERAGEKQRYRPF-KDLFNKKLLWHGS  250

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADM SKSA YC T R N  G MLL EV
Sbjct  251  RTTNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADMASKSANYCCTTRSNNTGLMLLCEV  310

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK+++++ K P GKHS KGLG T P  S       EV+VP GKP+ + +K S 
Sbjct  311  ALGNMYELKQSEHISKLPPGKHSCKGLGSTSPDPSMDKVIDGEVLVPLGKPISTNIKDST  370

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQY  203
            LLYNEYIVYD+AQV +++LV+++F Y
Sbjct  371  LLYNEYIVYDVAQVNIKYLVQLKFNY  396



>gb|AAF61293.1|AF126717_1 msPARP [Mus musculus]
Length=492

 Score =   263 bits (673),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  284  RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  342

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct  343  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIMLGEV  402

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  403  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  461

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  462  LLYNEYIVYDIAQVNLKYLLKLKFNFK  488



>gb|AAB35557.1| NAD+:protein(ADP-ribosyl)-transferase, ADPRT [mice, Peptide Partial, 
606 aa]
Length=606

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  398  RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRFLLWHGS  456

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct  457  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIMLGEV  516

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  517  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTA  575

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  576  LLYNEYIVYDIAQVNLKYLLKLKFNFK  602



>ref|XP_011063716.1| PREDICTED: poly [ADP-ribose] polymerase isoform X1 [Acromyrmex 
echinatior]
 gb|EGI59706.1| Poly [ADP-ribose] polymerase [Acromyrmex echinatior]
Length=981

 Score =   270 bits (689),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 165/208 (79%), Gaps = 2/208 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            + SE+F+++EKY++ THA THK++ LE+++VF ++R+GE  +F PF KKL NR LLWHGS
Sbjct  774  KTSEEFKMIEKYVKNTHAATHKQYELEIKEVFIIKRQGEEQRFKPF-KKLPNRKLLWHGS  832

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T+ +NP G +LL EV
Sbjct  833  RTTNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTHSQNPTGLLLLCEV  892

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKV-KAS  284
            ALG+M+E  +A Y++K PKGKHST G G+T P      K +D + VP GK VP+K+   S
Sbjct  893  ALGNMYEKYQADYIEKLPKGKHSTLGRGQTQPDPQTVYKTKDGIEVPYGKGVPAKLNNTS  952

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQVK+++LVK+ F+YK
Sbjct  953  ALLYNEYIVYDIAQVKVRYLVKMNFKYK  980



>ref|XP_011254366.1| PREDICTED: poly [ADP-ribose] polymerase [Camponotus floridanus]
 gb|EFN69632.1| Poly [ADP-ribose] polymerase [Camponotus floridanus]
Length=983

 Score =   269 bits (688),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 163/209 (78%), Gaps = 2/209 (1%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
             + SE+F++++KY+Q THA TH ++ LE+E+VF ++R+GE  +F PF KKL NR LLWHG
Sbjct  775  NKSSEEFKMIDKYVQNTHAATHTQYKLEIEEVFVVKRQGEEQRFKPF-KKLPNRKLLWHG  833

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T+ ++P G +LL E
Sbjct  834  SRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTHSQSPTGLLLLCE  893

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVP-SKVKA  287
            VALG+MHE  KA Y++K PKGKHST G G+T P   D  K  D V VP G  VP +  K 
Sbjct  894  VALGNMHERYKADYIEKLPKGKHSTLGRGQTEPDPKDVHKLDDGVEVPYGMGVPATHNKK  953

Query  286  SELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            S+LLYNEYIVYD+AQVK+++L+++ F+YK
Sbjct  954  SDLLYNEYIVYDVAQVKVRYLIRMNFKYK  982



>ref|XP_006744107.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Leptonychotes weddellii]
Length=686

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+   + KY++ THA TH  + LEV  +F++ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  478  RDSEEAETIRKYVKNTHATTHNAYDLEVIDIFTIEREGESRRYEPFRQ-LHNRRLLWHGS  536

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +PVG +LL EV
Sbjct  537  RATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCRTSQADPVGLILLGEV  596

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  +  +   D V VP G  + S V  + 
Sbjct  597  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPAASITM-DGVEVPLGTGISSGVSDTC  655

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  656  LLYNEYIVYDIAQVNLKYLLKLKFNFK  682



>pdb|1EFY|A Chain A, Crystal Structure Of The Catalytic Fragment Of Poly 
(Adp- Ribose) Polymerase Complexed With A Benzimidazole Inhibitor
Length=350

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++++Y++ THA TH  + L+V ++F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  145  KDSEEAKIIKQYVKNTHAATHNAYDLKVVEIFRIEREGESQRYKPF-KQLHNRQLLWHGS  203

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  204  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEV  263

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  +      D V VP G  + + +  + 
Sbjct  264  ALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTTL-DGVEVPLGNGISTGINDTC  322

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  323  LLYNEYIVYDVAQVNLKYLLKLKFNYK  349



>gb|AAB35558.1| NAD+:protein(ADP-ribosyl)-transferase, ADPRT [cattle, Peptide 
Partial, 607 aa]
Length=607

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  399  KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRFLLWHGS  457

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL E 
Sbjct  458  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEA  517

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A+++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  518  ALGNMYELKHARHISKLPKGKHSVKGLGKTTPDPSASITV-DGVEVPLGTGISSGVNDTC  576

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  577  LLYNEYIVYDIAQVHLKYLLKLKFNFK  603



>pdb|1A26|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase 
Complexed With Carba-Nad
 pdb|1PAX|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase 
Complexed With 3,4-Dihydro-5-Methyl-Isoquinolinone
 pdb|2PAW|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase
 pdb|2PAX|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase 
Complexed With 4-Amino-1,8-Naphthalimide
 pdb|3PAX|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase 
Complexed With 3-Methoxybenzamide
 pdb|4PAX|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase 
Complexed With 8-Hydroxy-2-Methyl-3-Hydro-Quinazolin-4-One
Length=361

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++++Y++ THA TH  + L+V ++F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  153  KDSEEAKIIKQYVKNTHAATHNAYDLKVVEIFRIEREGESQRYKPF-KQLHNRQLLWHGS  211

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  212  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEV  271

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  +      D V VP G  + + +  + 
Sbjct  272  ALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTTL-DGVEVPLGNGISTGINDTC  330

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  331  LLYNEYIVYDVAQVNLKYLLKLKFNYK  357



>gb|AAB35560.1| NAD+:protein(ADP-ribosyl)-transferase, ADPRT [Xenopus, Peptide 
Partial, 607 aa]
Length=607

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 155/208 (75%), Gaps = 2/208 (1%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
             +DSE+ R++  Y++ THA TH  + LEV ++F ++R+GE  ++ PF K+L NR LLWHG
Sbjct  397  AKDSEESRIICDYVKNTHADTHNAYDLEVLEIFKIDREGEYQRYKPF-KQLHNRQLLWHG  455

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC     +P+G +LL E
Sbjct  456  SRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHAMPGSPIGLILLGE  515

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALG+MHELK A  + K PKGKHS KGLG+T P  S  V+  D V VP GK   + +  +
Sbjct  516  VALGNMHELKAASQITKLPKGKHSVKGLGRTAPDPSATVQL-DGVDVPLGKGTSANISDT  574

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F YK
Sbjct  575  SLLYNEYIVYDIAQVNLKYLLKLKFNYK  602



>ref|XP_003396806.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase-like 
[Bombus terrestris]
Length=990

 Score =   267 bits (682),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 162/208 (78%), Gaps = 2/208 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            ++SE++++++KY+Q THA TH  + LE++ VF ++R+GE ++F PF KKL NR LLWHGS
Sbjct  783  KESEEYKVIKKYVQNTHAATHTLYELEIQDVFVIKRQGEDNRFKPF-KKLHNRKLLWHGS  841

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T+  NP G +LL EV
Sbjct  842  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTHSGNPTGLLLLCEV  901

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKV-KAS  284
            ALG+MHE  +A Y++K P GKHST G G+T P      K +D V VP G PV +K+ K S
Sbjct  902  ALGNMHERYRADYIEKLPSGKHSTWGRGRTQPDPETVYKMKDGVEVPYGVPVSAKLPKKS  961

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +LLYNEYIVYD+AQVK Q+L+K+ F+YK
Sbjct  962  DLLYNEYIVYDVAQVKAQYLLKMNFKYK  989



>ref|XP_007253978.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Astyanax mexicanus]
Length=1024

 Score =   267 bits (683),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 160/205 (78%), Gaps = 2/205 (1%)
 Frame = -2

Query  814   SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
             SE+ +L+ +Y++ THA TH  + LEVE++F ++R+GE  ++ PF K+L NR LLWHGSR 
Sbjct  818   SEEAQLIHQYVKNTHASTHNTYTLEVEEIFKIDREGEYQRYRPF-KELPNRQLLWHGSRT  876

Query  634   TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
             TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL EVAL
Sbjct  877   TNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEVAL  936

Query  454   GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
             G+MHELKKA ++ K PKGKHS KGLG+T P +   V  +  V +P GK V + +  + LL
Sbjct  937   GNMHELKKASHITKLPKGKHSVKGLGRTAPDQGATVSLKG-VDIPLGKGVNTNIDDTSLL  995

Query  274   YNEYIVYDIAQVKLQFLVKVRFQYK  200
             YNEYIVYD+AQV L++L+K+RF Y+
Sbjct  996   YNEYIVYDVAQVNLKYLLKIRFNYQ  1020



>ref|XP_010158766.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Eurypyga 
helias]
Length=255

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  47   KDSEEAKIIKQYVKNTHAATHNAYDLKVVDIFRIEREGESQRYKPF-KQLHNRQLLWHGS  105

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  106  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEV  165

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  +        V VP G  + + +  + 
Sbjct  166  ALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTTLGG-VEVPLGNGISTGINDTC  224

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  225  LLYNEYIVYDVAQVNLKYLLKLKFNYK  251



>ref|XP_005906361.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Bos 
mutus]
 gb|ELR48662.1| Poly [ADP-ribose] polymerase 1, partial [Bos mutus]
Length=676

 Score =   261 bits (668),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  468  KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  526

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  527  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  586

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  587  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITV-DGVEVPLGTGISSGVNDTC  645

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  646  LLYNEYIVYDIAQVHLKYLLKLKFNFK  672



>ref|NP_037195.1| poly [ADP-ribose] polymerase 1 [Rattus norvegicus]
 sp|P27008.4|PARP1_RAT RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Rattus 
norvegicus]
 gb|AAC53544.1| poly(ADP-ribose) polymerase [Rattus norvegicus]
 gb|AAH85765.1| Poly (ADP-ribose) polymerase 1 [Rattus norvegicus]
 gb|EDL94827.1| poly (ADP-ribose) polymerase family, member 1 [Rattus norvegicus]
Length=1014

 Score =   266 bits (680),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  806   RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTAPDPSASITL-DGVEVPLGTGIPSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_008559441.1| PREDICTED: poly [ADP-ribose] polymerase-like [Microplitis demolitor]
Length=985

 Score =   265 bits (678),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 159/208 (76%), Gaps = 2/208 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DS++F+++E Y + THA TH  + L++E VF ++RKGE  ++ PF  KL N+ LLWHGS
Sbjct  778  KDSDEFKMIETYTKNTHAATHSSYELQIEDVFVIKRKGEDKRYKPF-AKLPNKKLLWHGS  836

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC TN +NP G +LL EV
Sbjct  837  RTTNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTNSQNPTGLLLLCEV  896

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKV-KAS  284
            ALG+M+E  KA Y++K PKGKHST G G+T P  +  +K  D V VPCG PV  KV   +
Sbjct  897  ALGNMYERLKADYIEKLPKGKHSTFGKGQTGPDPNQALKTPDGVEVPCGPPVDQKVPSTA  956

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQVK ++LV++ F+YK
Sbjct  957  SLLYNEYIVYDVAQVKARYLVRMNFKYK  984



>ref|XP_004605484.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Sorex araneus]
Length=1015

 Score =   265 bits (678),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+ + + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  807   KDSEEAQTIRKYVKNTHATTHNAYDLEVLDIFKIEREGENQRYKPF-KQLHNRRLLWHGS  865

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  866   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  925

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct  926   ALGNMHELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGIPSGVNDTC  984

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYI+YDIAQV L++L+K++F +K
Sbjct  985   LLYNEYIIYDIAQVNLKYLLKLKFNFK  1011



>gb|ERE73581.1| poly [ADP-ribose] polymerase 1 [Cricetulus griseus]
Length=920

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  712  RDSEEAEVIRKYVKNTHATTHNAYDLEVMDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  770

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  771  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  830

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  831  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  889

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  890  LLYNEYIVYDIAQVNLKYLLKLKFNFK  916



>ref|XP_009960357.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Leptosomus 
discolor]
 ref|XP_010127952.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Chlamydotis 
macqueenii]
Length=296

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  88   KDSEEAKIIKQYVKNTHAATHNAYDLKVVDIFRIEREGESQRYKPF-KQLHNRQLLWHGS  146

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  147  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEV  206

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  +        V VP G  + + +  + 
Sbjct  207  ALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTTLGG-VEVPLGNGISTGINDTC  265

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  266  LLYNEYIVYDVAQVNLKYLLKLKFNYK  292



>ref|XP_003999138.2| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Felis catus]
Length=1013

 Score =   265 bits (677),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L+NR LLWHGS
Sbjct  805   RDSEEAETIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLRNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct  924   ALGNMYELKHAAHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGIPSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDVAQVNLKYLLKLKFNFK  1009



>gb|ABM82562.1| poly (ADP-ribose) polymerase family, member 1 [synthetic construct]
Length=1014

 Score =   265 bits (676),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_011138702.1| PREDICTED: poly [ADP-ribose] polymerase [Harpegnathos saltator]
 gb|EFN84955.1| Poly [ADP-ribose] polymerase [Harpegnathos saltator]
Length=983

 Score =   265 bits (676),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 161/207 (78%), Gaps = 1/207 (0%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            + SE+F+++E+Y++ THA TH ++ LE+E VF ++R+GE  ++ PF KKL NR LLWHGS
Sbjct  777  KKSEEFKMIEQYVKNTHAATHTQYELEIEDVFVVKRQGEEQRYKPF-KKLPNRKLLWHGS  835

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC TN  N  G +LL EV
Sbjct  836  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTNSSNSTGLLLLCEV  895

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+++E  +A Y++K PKGKHST G G+T P   +  K +D V VP G+ V + +K S 
Sbjct  896  ALGNIYERYQADYIEKLPKGKHSTMGRGQTHPDPENVYKTKDGVEVPYGEGVSANIKKSA  955

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQVK+++L+++ F+YK
Sbjct  956  LLYNEYIVYDVAQVKVRYLIRMDFKYK  982



>ref|XP_007071821.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Chelonia mydas]
Length=992

 Score =   265 bits (676),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  784  KDSEEAKIIKQYVKNTHASTHNAYDLKVVDIFKIEREGENQRYKPFRQ-LHNRQLLWHGS  842

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GI SQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  843  RATNFAGIFSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQTDPIGLILLGEV  902

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+MHELK A ++ K PKGKHS KGLGKT P  S  +   D V +P G  +PS +  + 
Sbjct  903  ALGNMHELKNASHITKLPKGKHSVKGLGKTAPDPSATITL-DGVDIPLGNGIPSGISDTC  961

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  962  LLYNEYIVYDVAQVNLKYLLKLKFNYK  988



>gb|AAB59447.1| poly(ADP-ribose) synthetase [Homo sapiens]
Length=1014

 Score =   265 bits (676),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_011289117.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Felis catus]
Length=985

 Score =   265 bits (676),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L+NR LLWHGS
Sbjct  777  RDSEEAETIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLRNRRLLWHGS  835

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  836  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  895

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct  896  ALGNMYELKHAAHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGIPSGVNDTC  954

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQV L++L+K++F +K
Sbjct  955  LLYNEYIVYDVAQVNLKYLLKLKFNFK  981



>ref|XP_003275213.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nomascus leucogenys]
Length=955

 Score =   264 bits (675),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  747  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  805

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  806  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  865

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  866  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASISL-DGVEVPLGTGISSGVNDTC  924

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  925  LLYNEYIVYDIAQVNLKYLLKLKFNFK  951



>gb|AAA60137.1| poly(ADP-ribose) polymerase [Homo sapiens]
Length=1014

 Score =   265 bits (676),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>dbj|BAG35260.1| unnamed protein product [Homo sapiens]
Length=1014

 Score =   265 bits (676),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>gb|AAH37545.1| Poly (ADP-ribose) polymerase 1 [Homo sapiens]
 gb|ABM85752.1| poly (ADP-ribose) polymerase family, member 1 [synthetic construct]
Length=1014

 Score =   265 bits (676),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|NP_001609.2| poly [ADP-ribose] polymerase 1 [Homo sapiens]
 sp|P09874.4|PARP1_HUMAN RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Homo 
sapiens]
 gb|AAM75364.1|AF524947_1 ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase) [Homo 
sapiens]
 gb|AAA51663.1| NAD+ ADP-ribosyltransferase [Homo sapiens]
 gb|EAW69783.1| poly (ADP-ribose) polymerase family, member 1, isoform CRA_a 
[Homo sapiens]
 gb|EAW69784.1| poly (ADP-ribose) polymerase family, member 1, isoform CRA_a 
[Homo sapiens]
Length=1014

 Score =   265 bits (676),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>dbj|BAG10250.1| poly [ADP-ribose] polymerase-1 [synthetic construct]
Length=1014

 Score =   265 bits (676),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_003424731.1| PREDICTED: poly [ADP-ribose] polymerase [Nasonia vitripennis]
Length=992

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 161/208 (77%), Gaps = 2/208 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            + S+DF+L+EKY++ THA TH+++ L VE+VF+ +R GE  ++ PF KKL NR LLWHGS
Sbjct  785  KKSDDFKLIEKYVKNTHAETHRQYELIVEEVFAAKRSGEESRYRPF-KKLPNRKLLWHGS  843

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R+TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC TN +N  G +LL +V
Sbjct  844  RVTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTNSQNSTGLLLLCDV  903

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKA-S  284
            ALG+M+E   A Y++K P GKHST G GKT+P     VK +  V VPCG  + + +K  S
Sbjct  904  ALGNMYERYNADYIEKLPHGKHSTWGRGKTMPDPEKSVKLKSGVEVPCGPGIQADLKEKS  963

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNE+IVYD+AQVK+++LVK+ F+YK
Sbjct  964  SLLYNEFIVYDVAQVKVEYLVKMNFKYK  991



>dbj|BAE35080.1| unnamed protein product [Mus musculus]
Length=1014

 Score =   265 bits (676),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  806   RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>dbj|BAE27352.1| unnamed protein product [Mus musculus]
Length=1014

 Score =   265 bits (676),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  806   RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>dbj|BAE41080.1| unnamed protein product [Mus musculus]
Length=1014

 Score =   265 bits (676),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  806   RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>dbj|BAE39743.1| unnamed protein product [Mus musculus]
Length=1014

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  806   RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|NP_031441.2| poly [ADP-ribose] polymerase 1 [Mus musculus]
 gb|AAH12041.1| Poly (ADP-ribose) polymerase family, member 1 [Mus musculus]
 dbj|BAC27173.1| unnamed protein product [Mus musculus]
 dbj|BAC40500.1| unnamed protein product [Mus musculus]
 gb|EDL13152.1| poly (ADP-ribose) polymerase family, member 1 [Mus musculus]
Length=1014

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  806   RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_001177436.2| PREDICTED: poly [ADP-ribose] polymerase 1-like [Strongylocentrotus 
purpuratus]
Length=988

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 155/206 (75%), Gaps = 1/206 (0%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            + S++F+L+++Y   THA TH  + L VE+VF + R GE  +F PF KKL NR LLWHGS
Sbjct  782  KKSDEFKLIKEYTDNTHAATHNWYRLSVEEVFRINRDGEGTRFKPF-KKLHNRQLLWHGS  840

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMV+KSA YC+ N  + +G M+LS+V
Sbjct  841  RKTNFGGILSQGLRIAPPEAPATGYMFGKGLYFADMVTKSANYCYANASSNIGLMILSDV  900

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALGDM+EL  A+ M KPP GKHSTKGLG+T P  S  V   D + VP GK   S +  + 
Sbjct  901  ALGDMYELYGAKGMSKPPAGKHSTKGLGRTCPDPSGLVTIEDNLQVPMGKGCDSNINNTS  960

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQY  203
            LLYNEYIVYD+AQV++++L+K++F Y
Sbjct  961  LLYNEYIVYDVAQVQMRYLIKMKFNY  986



>ref|XP_009976244.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Tauraco erythrolophus]
Length=324

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  116  KDSEEAKIIKQYVKNTHAATHNAYDLKVVDIFRIEREGESQRYKPF-KQLHNRQLLWHGS  174

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  175  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEV  234

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  +        V VP G  + + +  + 
Sbjct  235  ALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTTLGG-VEVPLGNGISTGINDTC  293

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  294  LLYNEYIVYDVAQVNLKYLLKLKFNYK  320



>ref|XP_005289623.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Chrysemys 
picta bellii]
Length=969

 Score =   264 bits (674),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  761  KDSEEAKIIKQYVKNTHASTHNAYDLKVVDIFKIEREGENQRYKPFRQ-LHNRQLLWHGS  819

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GI SQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  820  RATNFAGIFSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQTDPIGLILLGEV  879

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+MHELK A ++ K PKGKHS KGLGKT P  +  +   D V +P G  +PS V  + 
Sbjct  880  ALGNMHELKNASHITKLPKGKHSVKGLGKTAPDPTATITL-DGVDIPLGNGIPSGVSDTC  938

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  939  LLYNEYIVYDVAQVNLKYLLKLKFNYK  965



>ref|XP_011232467.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ailuropoda melanoleuca]
Length=975

 Score =   264 bits (674),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  767  RDSEEAETIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  825

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  826  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEV  885

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  886  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGISSGVNDTC  944

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K+RF +K
Sbjct  945  LLYNEYIVYDIAQVNLRYLLKLRFNFK  971



>ref|XP_004354000.1| Poly(ADPribose) polymerase catalytic domain containing protein, 
partial [Acanthamoeba castellanii str. Neff]
 gb|ELR24303.1| Poly(ADPribose) polymerase catalytic domain containing protein, 
partial [Acanthamoeba castellanii str. Neff]
Length=216

 Score =   246 bits (627),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 155/207 (75%), Gaps = 1/207 (0%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            R+S D+ +V +Y++ THAPTH  + L +++++++ER GE ++F P+   L N+ LLWHGS
Sbjct  11   RNSRDWSIVAQYVKNTHAPTHTSYKLRLKELYAVERPGEEERFKPY-AALGNQQLLWHGS  69

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            RLTN++GILSQGLRIAPPEAP+TGYMFGKGVYFAD+V+KSA YC  +R+NPVG MLLS V
Sbjct  70   RLTNWMGILSQGLRIAPPEAPSTGYMFGKGVYFADLVTKSANYCHASRENPVGVMLLSRV  129

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG  ++  +A++M+    G  STKG G T P  ++ V   D  VVP GKPVP+    + 
Sbjct  130  ALGKTYDCTQAEFMNANKPGFDSTKGCGATGPDPAENVTMADGTVVPLGKPVPTGTSNTS  189

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNE+IVYD+AQ+ +++LV V F+Y 
Sbjct  190  LLYNEFIVYDVAQLLIKYLVVVEFKYS  216



>ref|XP_005289622.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Chrysemys 
picta bellii]
Length=1011

 Score =   264 bits (674),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  803   KDSEEAKIIKQYVKNTHASTHNAYDLKVVDIFKIEREGENQRYKPFRQ-LHNRQLLWHGS  861

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GI SQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  862   RATNFAGIFSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQTDPIGLILLGEV  921

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHELK A ++ K PKGKHS KGLGKT P  +  +   D V +P G  +PS V  + 
Sbjct  922   ALGNMHELKNASHITKLPKGKHSVKGLGKTAPDPTATITL-DGVDIPLGNGIPSGVSDTC  980

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  981   LLYNEYIVYDVAQVNLKYLLKLKFNYK  1007



>gb|EFB29647.1| hypothetical protein PANDA_016433 [Ailuropoda melanoleuca]
Length=981

 Score =   264 bits (674),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  773  RDSEEAETIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  831

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  832  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEV  891

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  892  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGISSGVNDTC  950

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K+RF +K
Sbjct  951  LLYNEYIVYDIAQVNLRYLLKLRFNFK  977



>ref|XP_004375937.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Trichechus 
manatus latirostris]
 ref|XP_004375938.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 2 [Trichechus 
manatus latirostris]
Length=1013

 Score =   264 bits (674),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  805   RDSEEAEIIRKYVKNTHASTHNAYDLEVIDIFKIEREGETQRYKPFRQ-LHNRQLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>gb|EGW11182.1| Poly [ADP-ribose] polymerase 1 [Cricetulus griseus]
Length=971

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  763  RDSEEAEVIRKYVKNTHATTHNAYDLEVMDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  821

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  822  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  881

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  882  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  940

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  941  LLYNEYIVYDIAQVNLKYLLKLKFNFK  967



>sp|P11103.3|PARP1_MOUSE RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1; Short=msPARP 
[Mus musculus]
 emb|CAA32421.1| unnamed protein product [Mus musculus]
Length=1013

 Score =   264 bits (674),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  805   RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIMLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTA  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_010589425.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Loxodonta africana]
Length=1000

 Score =   264 bits (674),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  792  RDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGENQRYKPFRQ-LHNRQLLWHGS  850

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  851  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  910

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  911  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGISSGVNDTS  969

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  970  LLYNEYIVYDIAQVNLKYLLKLKFNFK  996



>ref|NP_001233650.1| poly [ADP-ribose] polymerase 1 [Cricetulus griseus]
 sp|Q9R152.3|PARP1_CRIGR RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Cricetulus 
griseus]
 gb|AAD45817.1|AF168781_1 poly ADP-ribose polymerase [Cricetulus griseus]
Length=1013

 Score =   264 bits (674),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   RDSEEAEVIRKYVKNTHATTHNAYDLEVMDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_004065376.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Gorilla gorilla gorilla]
Length=1021

 Score =   264 bits (674),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  813   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  871

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  872   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  931

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  932   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  990

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  991   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1017



>ref|XP_010972367.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelus bactrianus]
Length=1016

 Score =   264 bits (674),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  808   KDSEEAETIRKYVKNTHATTHNAYDLEVIDIFKIEREGETQRYKPF-KQLHNRRLLWHGS  866

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  867   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  926

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct  927   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVDVPLGTGIPSGVSDTC  985

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  986   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1012



>ref|XP_002809428.2| PREDICTED: poly [ADP-ribose] polymerase 1 [Pongo abelii]
Length=972

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  764  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  822

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  823  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  882

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  883  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASISL-DGVEVPLGTGISSGVNDTC  941

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  942  LLYNEYIVYDIAQVNLKYLLKLKFNFK  968



>ref|XP_003487068.1| PREDICTED: poly [ADP-ribose] polymerase-like [Bombus impatiens]
Length=990

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 162/208 (78%), Gaps = 2/208 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            ++SE++++++KY+Q THA TH  + LE++ VF ++R+GE +++ PF KKL NR LLWHGS
Sbjct  783  KESEEYKVIKKYVQNTHAATHTLYELEIQDVFVIKRQGEDNRYKPF-KKLHNRKLLWHGS  841

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T+  +P G +LL EV
Sbjct  842  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTHSGSPTGLLLLCEV  901

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKV-KAS  284
            ALG+MHE  +A Y++K P GKHST G G+T P      K +D V VP G PV +K+ K S
Sbjct  902  ALGNMHERYRADYIEKLPSGKHSTWGRGRTQPDPETVYKMKDGVEVPYGVPVSAKLPKKS  961

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +LLYNEYIVYD+AQVK Q+L+K+ F+YK
Sbjct  962  DLLYNEYIVYDVAQVKAQYLLKMNFKYK  989



>ref|XP_002760624.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Callithrix jacchus]
Length=1013

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   RDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_006118141.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Pelodiscus sinensis]
Length=1173

 Score =   264 bits (675),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  965   KDSEEAKIIKQYVKNTHASTHNAYDLKVVDIFKIEREGESQRYKPF-KQLHNRQLLWHGS  1023

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GI SQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +P+G +LL EV
Sbjct  1024  RTTNFAGIFSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQTDPIGLILLGEV  1083

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHELK A ++ K PKGKHS KGLGKT P  S  +   D V +P G  +PS +  + 
Sbjct  1084  ALGNMHELKNASHISKLPKGKHSVKGLGKTAPDPSATITL-DGVDIPLGNGIPSGISDTC  1142

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  1143  LLYNEYIVYDVAQVNLKYLLKLKFNYK  1169



>ref|XP_005078195.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Mesocricetus auratus]
Length=1013

 Score =   263 bits (673),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_006897812.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Elephantulus edwardii]
Length=1014

 Score =   263 bits (673),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+ +++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF++ L NR LLWHGS
Sbjct  806   KDSEEAKIIRKYVKNTHATTHNAYDLEVIDIFKIEREGETQRYKPFQQ-LHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +PVG +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPVGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  +  +   D V VP G  VPS V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPAATINL-DGVEVPLGTGVPSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1010



>ref|XP_009025261.1| hypothetical protein HELRODRAFT_95414 [Helobdella robusta]
 gb|ESN96355.1| hypothetical protein HELRODRAFT_95414 [Helobdella robusta]
Length=1045

 Score =   263 bits (673),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 159/207 (77%), Gaps = 1/207 (0%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             + SE+F+ + ++++ THA TH E+ L+V +VF++ R GE   +  F K L NRMLLWHGS
Sbjct  836   KSSEEFQRICQFVKNTHAATHDEYDLQVSEVFTISRLGESKVYESF-KSLHNRMLLWHGS  894

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             RLTN+ GILS+GLRIAP EAP+TGYMFGKG+YFADM SKSA YCFT+RK+P G MLLSEV
Sbjct  895   RLTNYAGILSKGLRIAPKEAPSTGYMFGKGIYFADMASKSANYCFTSRKDPTGLMLLSEV  954

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHEL +A ++ + P+GKHS KGLG T P         D VV+P GK V +KVK + 
Sbjct  955   ALGNMHELTQANFITELPRGKHSVKGLGTTAPDPKQNYVCEDGVVIPMGKGVKTKVKLTS  1014

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQV +++L+K+ F+YK
Sbjct  1015  LLYNEYIVYDVAQVNMKYLLKLNFKYK  1041



>ref|XP_011499146.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
[Ceratosolen solmsi marchali]
Length=995

 Score =   263 bits (672),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 161/209 (77%), Gaps = 2/209 (1%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
             ++S++F+L+EKY++ THA THK++ L +E +F  +R GE  ++ PF KKL NR LLWHG
Sbjct  787  NKESDEFKLIEKYVKNTHAETHKQFELVIEDIFVTKRNGEERRYKPF-KKLSNRKLLWHG  845

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SR+TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC TN K+  G +LL +
Sbjct  846  SRVTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTNAKDSKGLLLLCD  905

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKA-  287
            VALG+MHEL  A Y++K P GKHST G GKT P     +K +  V VPCG  + +++K  
Sbjct  906  VALGNMHELYHADYIEKLPHGKHSTWGRGKTQPDPEKSIKLKSGVEVPCGPAISAELKKD  965

Query  286  SELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            S LLYNE+IVYD+AQVK++++VK+ F+YK
Sbjct  966  SSLLYNEFIVYDVAQVKVEYIVKLDFKYK  994



>ref|XP_009808696.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Gavia 
stellata]
Length=360

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  152  KDSEEAKIIKQYVKNTHAATHNAYDLKVVDIFRIEREGESQRYKPF-KQLHNRQLLWHGS  210

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  211  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEV  270

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  +        V VP G  + + +  + 
Sbjct  271  ALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTTLGG-VEVPLGNGISTGINDTC  329

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  330  LLYNEYIVYDVAQVNLKYLLKLKFNYK  356



>ref|XP_010990763.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelus dromedarius]
Length=1013

 Score =   263 bits (672),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAETIRKYVKNTHATTHNAYDLEVIDIFKIEREGETQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVDVPLGTGIPSGVSDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_006188179.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelus ferus]
Length=1013

 Score =   263 bits (672),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAETIRKYVKNTHATTHNAYDLEVIDIFKIEREGETQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVDVPLGTGIPSGVSDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_003357689.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Sus scrofa]
Length=1018

 Score =   263 bits (672),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  810   RDSEEAETIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  868

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  869   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  928

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  +  +   D V VP G  +PS V  + 
Sbjct  929   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPAASITM-DGVEVPLGTGIPSGVNDTC  987

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  988   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1014



>dbj|BAG64403.1| unnamed protein product [Homo sapiens]
Length=993

 Score =   263 bits (672),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++  Y++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  785  RDSEEAEIIRNYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  843

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  844  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  903

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  904  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVNDTS  962

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  963  LLYNEYIVYDIAQVNLKYLLKLKFNFK  989



>ref|XP_004690817.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Condylura cristata]
Length=1033

 Score =   263 bits (672),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  825   KDSEEAETIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  883

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  884   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  943

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  V   D V VP G  +PS V  + 
Sbjct  944   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASVTM-DGVEVPLGTGIPSGVNDTC  1002

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  1003  LLYNEYIVYDIAQVNLKYLLKLKFNFK  1029



>ref|XP_004653313.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Jaculus jaculus]
Length=1014

 Score =   263 bits (672),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   KDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK+A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  925   ALGNMYELKQASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_005349022.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Microtus ochrogaster]
Length=1013

 Score =   263 bits (671),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLLLLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  VPS V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGVPSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_003930339.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Saimiri boliviensis 
boliviensis]
Length=1013

 Score =   263 bits (671),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   RDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGIGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_006198888.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Vicugna pacos]
Length=1018

 Score =   263 bits (671),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  810   KDSEEAETIRKYVKNTHATTHNAYDLEVIDIFKIEREGETQRYKPF-KQLHNRRLLWHGS  868

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  869   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  928

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct  929   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVDVPLGTGIPSGVSDTC  987

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  988   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1014



>ref|XP_003814976.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Pan paniscus]
Length=1014

 Score =   263 bits (671),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+  NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQFHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V +P G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISL-DGVDIPLGTGISSGVNDTS  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_007986456.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Chlorocebus sabaeus]
Length=1014

 Score =   263 bits (671),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIISKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIVLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASISL-DGVEVPLGTGISSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_006974251.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Peromyscus maniculatus 
bairdii]
Length=1013

 Score =   262 bits (670),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGEGQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>ref|XP_001638875.1| predicted protein [Nematostella vectensis]
 gb|EDO46812.1| predicted protein, partial [Nematostella vectensis]
Length=968

 Score =   262 bits (669),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 154/205 (75%), Gaps = 1/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            S +F L+ +Y+  THA TH+++ LE+  VF ++R+GE   F PF K+L NR LLWHGSR 
Sbjct  762  SAEFGLISEYVSNTHADTHRQYELELLDVFKIKREGEEALFKPF-KQLHNRQLLWHGSRT  820

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T+  N +G +LL EVAL
Sbjct  821  TNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCCTSPSNNIGLLLLCEVAL  880

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G+MHELK A ++ K PKGKHS KGLGKT P  S    + D  +VP GK  P+ VK S LL
Sbjct  881  GNMHELKHASFIKKVPKGKHSVKGLGKTAPDPSATHTFEDGTIVPKGKGCPAPVKDSSLL  940

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVYD AQ+ +++L+K +F+YK
Sbjct  941  YNEYIVYDTAQINMKYLLKTKFKYK  965



>ref|XP_007935170.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Orycteropus afer afer]
Length=1016

 Score =   262 bits (670),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  808   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGENQRYKPFRQ-LHNRRLLWHGS  866

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  867   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  926

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S +  + 
Sbjct  927   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGISSGINDTC  985

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  986   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1012



>ref|XP_006871190.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Chrysochloris 
asiatica]
Length=1013

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  805   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGENQRYKPFRQ-LHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S +  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGISSGINDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>gb|EHH15492.1| hypothetical protein EGK_01593 [Macaca mulatta]
Length=1014

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIVLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASISL-DGVEVPLGTGISSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_010380279.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Rhinopithecus roxellana]
Length=1014

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIVLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASISL-DGVEVPLGTGISSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_005541069.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Macaca fascicularis]
 gb|EHH50496.1| hypothetical protein EGM_01339 [Macaca fascicularis]
Length=1014

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIVLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASISL-DGVEVPLGTGISSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_001090984.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 4 [Macaca mulatta]
Length=1014

 Score =   262 bits (670),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIVLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASISL-DGVEVPLGTGISSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_001090628.2| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Macaca mulatta]
Length=993

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  785  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  843

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct  844  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIVLGEV  903

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  904  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASISL-DGVEVPLGTGISSGVNDTC  962

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  963  LLYNEYIVYDIAQVNLKYLLKLKFNFK  989



>ref|XP_008579018.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Galeopterus 
variegatus]
Length=975

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  767  KDSEEAEVIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  825

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  826  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  885

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  886  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGISSGVNDTC  944

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  945  LLYNEYIVYDIAQVNLKYLLKLKFNFK  971



>ref|XP_006157311.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Tupaia chinensis]
Length=1014

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  806   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGISSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_004761981.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X5 [Mustela 
putorius furo]
 ref|XP_004805440.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Mustela 
putorius furo]
Length=1013

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 155/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  805   RDSEEAETIRKYVKNTHATTHNAYDLEVVDIFRIEREGESQRYKPFRQ-LHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC  ++ +PVG +LL EV
Sbjct  864   RATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHASQADPVGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  V S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGVSSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYI+YD+AQV L++L+K+RF +K
Sbjct  983   LLYNEYIIYDVAQVNLKYLLKLRFNFK  1009



>ref|XP_008058853.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Tarsius syrichta]
Length=919

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+  ++ KY++ THA TH  + LEV  +F ++R+GE  ++ PF K+L NR LLWHGS
Sbjct  711  KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIDREGESQRYKPF-KQLHNRRLLWHGS  769

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  770  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  829

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  V   D V VP G  + S V  + 
Sbjct  830  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASVTL-DGVEVPLGTGISSGVNDTC  888

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  889  LLYNEYIVYDIAQVNLKYLLKLKFNFK  915



>gb|KFB53219.1| AGAP003230-PA-like protein [Anopheles sinensis]
Length=1000

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 153/207 (74%), Gaps = 1/207 (0%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            R SE+F L+E+Y++ THA TH  + LE+E++F ++RKGE  +F PFRK L NR LLWHGS
Sbjct  794  RKSEEFALLEQYVRNTHAATHTTYELEIEEIFRIKRKGEDRRFQPFRK-LHNRKLLWHGS  852

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            RLTNFVGIL+ GL+IAPPEAP TGYMFGKG+YFADMVSKSA YC TN  +P G MLL EV
Sbjct  853  RLTNFVGILTHGLKIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTNSADPKGLMLLCEV  912

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALGDM E  +A Y+ K P GKHS KG+G+T P  +   K  D V +P GK V  +   S 
Sbjct  913  ALGDMQEYTQAHYVTKLPTGKHSVKGIGRTQPDPTASHKRPDGVEIPLGKGVTDEKTKSS  972

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNE+IVYD+ QV  Q+L K+ F+YK
Sbjct  973  LLYNEFIVYDVGQVNCQYLFKMNFKYK  999



>gb|ELW49552.1| Poly [ADP-ribose] polymerase 1 [Tupaia chinensis]
Length=1081

 Score =   262 bits (669),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  873   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  931

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  932   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  991

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  992   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGISSGVNDTC  1050

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  1051  LLYNEYIVYDIAQVNLKYLLKLKFNFK  1077



>gb|ACN58594.1| Poly synthetase 1 [Salmo salar]
Length=189

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 141/187 (75%), Gaps = 2/187 (1%)
 Frame = -2

Query  760  HKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEA  581
            H  + LEVE++F + R+GE  K+ PF+  L NR LLWHGSR TN+ GILSQGLRIAPPEA
Sbjct  1    HNTYTLEVEEIFKIVREGEYQKYRPFQD-LPNRQLLWHGSRATNYAGILSQGLRIAPPEA  59

Query  580  PTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKG  401
            P TGYMFGKGVYFADMVSKSA YC T++ +P G +LL EVALG+MHELKKA ++ K PKG
Sbjct  60   PVTGYMFGKGVYFADMVSKSANYCHTSQSDPTGLLLLGEVALGNMHELKKASHITKLPKG  119

Query  400  KHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLV  221
            KHS KGLG+  P  S  V   D V VP GK   + +  + LLYNEYIVYD+AQV L++L+
Sbjct  120  KHSVKGLGRNAPDPSATVTL-DGVQVPLGKGTNTNIDDTSLLYNEYIVYDVAQVNLKYLL  178

Query  220  KVRFQYK  200
            K++F Y+
Sbjct  179  KIKFNYQ  185



>ref|XP_009184638.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Papio anubis]
Length=1085

 Score =   262 bits (669),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  877   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  935

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct  936   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIVLGEV  995

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  996   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASISL-DGVEVPLGTGISSGVNDTC  1054

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  1055  LLYNEYIVYDIAQVNLKYLLKLKFNFK  1081



>ref|XP_008820594.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nannospalax galili]
Length=1013

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>gb|KFD59055.1| hypothetical protein M513_00218 [Trichuris suis]
 gb|KFD73096.1| hypothetical protein M514_00218 [Trichuris suis]
Length=892

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            S DF ++ +Y++ TH  TH ++ L V+QV+ ++R  E  ++ PF KKL+NRMLLWHGSR 
Sbjct  689  SSDFEMICRYVKNTHGQTHSDYTLAVQQVYVIDRLNEQKRYRPF-KKLQNRMLLWHGSRN  747

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            +N+ GIL QGLRIAPPEAP TGYMFGKG+YFADMV+KSA YC+  +  P G++LL EVAL
Sbjct  748  SNYAGILCQGLRIAPPEAPVTGYMFGKGIYFADMVTKSANYCYATKDEPYGYLLLCEVAL  807

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G++ ELK A+Y++K P GKHS KG+G+T+P  ++     D VV+P GKPV S VK + LL
Sbjct  808  GNVLELKNAKYLEKLPTGKHSVKGIGETMPDPAEQETTDDGVVIPLGKPVASNVKKTSLL  867

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVYDI+Q+ ++FLVK++F +K
Sbjct  868  YNEYIVYDISQLHIKFLVKLKFNFK  892



>ref|XP_007534861.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Erinaceus europaeus]
Length=937

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  729  KDSEEAETIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  787

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  788  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  847

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  V   + + VP G  +PS V  + 
Sbjct  848  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASVTM-EGIEVPLGTGIPSGVNDTC  906

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  907  LLYNEYIVYDIAQVHLKYLLKLKFNFK  933



>ref|XP_007464233.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Lipotes vexillifer]
Length=1013

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVSLKYLLKLKFNFK  1009



>ref|XP_007102732.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Physeter catodon]
Length=1013

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVSLKYLLKLKFNFK  1009



>ref|XP_006914334.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Pteropus alecto]
 gb|ELK10638.1| Poly [ADP-ribose] polymerase 1 [Pteropus alecto]
Length=1011

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+ +++ KY++ THA TH  + L+V  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  803   RDSEEAKIIRKYVKNTHATTHNAYDLKVIDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  861

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC   + +PVG +LL EV
Sbjct  862   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHAFQGDPVGLILLGEV  921

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  VPS V  + 
Sbjct  922   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGVPSGVNDTC  980

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  981   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1007



>ref|XP_004083528.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Oryzias latipes]
Length=1015

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 160/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             + +++  ++ +Y++ THA TH  + LEV+++F + R+GE  +F PF ++L NR LLWHGS
Sbjct  807   KSTQEAEVITQYVKNTHAATHNTYTLEVQEIFKIGREGERQRFRPF-EELHNRQLLWHGS  865

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL+EV
Sbjct  866   RATNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLILLAEV  925

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHELKKA ++ K PKGKHS KGLG+T P  S  V   D V VP GK V + +  + 
Sbjct  926   ALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPSATVTL-DGVQVPLGKGVQTNIDDTS  984

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQ+ L++L+K++F Y+
Sbjct  985   LLYNEYIVYDVAQINLKYLLKIKFNYQ  1011



>dbj|BAE38574.1| unnamed protein product [Mus musculus]
Length=1014

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  806   RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
               TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   MTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-EGVEVPLGTGIPSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_003216114.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Anolis carolinensis]
Length=1006

 Score =   261 bits (667),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 160/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +D+++ +++++Y++ THA TH  + LEV ++F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  798   KDTDEAKIIKQYVKNTHASTHNAYDLEVVEIFKIEREGEYQRYKPFRE-LHNRQLLWHGS  856

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ + VG +LL EV
Sbjct  857   RATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQTDSVGLILLGEV  916

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  V   + V VP G  +PS V  + 
Sbjct  917   ALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPSATVSL-NGVDVPLGSGIPSGVSNTC  975

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K+ F+YK
Sbjct  976   LLYNEYIVYDIAQVNLKYLLKLDFKYK  1002



>ref|XP_008266574.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Oryctolagus cuniculus]
Length=1013

 Score =   261 bits (667),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAEVIRKYVKNTHATTHNAYDLEVVDIFKIERDGESQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK+A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKQASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>emb|CBY18306.1| unnamed protein product [Oikopleura dioica]
Length=999

 Score =   261 bits (667),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 155/207 (75%), Gaps = 1/207 (0%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +D ++F ++++Y++ THA TH++++LE+  VF ++R  E  KF PF K  +NR LLWHGS
Sbjct  789  QDEDEFAIIDEYVKTTHAKTHQDYSLEINTVFKIDRNKEAKKFKPFSK-FENRQLLWHGS  847

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            RLTN+ GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YCF +  N  G +LL EV
Sbjct  848  RLTNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCFASPDNSRGLLLLGEV  907

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+MHELK A+Y++K PKG HS KGLG T P  +   +  +   VPCGK VPS    + 
Sbjct  908  ALGNMHELKAAEYIEKLPKGCHSVKGLGSTEPDPACVRELPNGTKVPCGKGVPSNADNTS  967

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD AQV L++L+  +F++K
Sbjct  968  LLYNEYIVYDAAQVNLKYLIDFKFKFK  994



>gb|KHJ46115.1| Poly(ADP-ribose) polymerase catalytic domain protein [Trichuris 
suis]
Length=959

 Score =   261 bits (666),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = -2

Query  814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
            S DF ++ +Y++ TH  TH ++ L V+QV+ ++R  E  ++ PF KKL+NRMLLWHGSR 
Sbjct  756  SSDFEMICRYVKNTHGQTHSDYTLAVQQVYVIDRLNEQKRYRPF-KKLQNRMLLWHGSRN  814

Query  634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
            +N+ GIL QGLRIAPPEAP TGYMFGKG+YFADMV+KSA YC+  +  P G++LL EVAL
Sbjct  815  SNYAGILCQGLRIAPPEAPVTGYMFGKGIYFADMVTKSANYCYATKDEPYGYLLLCEVAL  874

Query  454  GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
            G++ ELK A+Y++K P GKHS KG+G+T+P  ++     D VV+P GKPV S VK + LL
Sbjct  875  GNVLELKNAKYLEKLPTGKHSVKGIGETMPDPAEQETTDDGVVIPLGKPVASNVKKTSLL  934

Query  274  YNEYIVYDIAQVKLQFLVKVRFQYK  200
            YNEYIVYDI+Q+ ++FLVK++F +K
Sbjct  935  YNEYIVYDISQLHIKFLVKLKFNFK  959



>ref|XP_004271024.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Orcinus orca]
Length=1013

 Score =   261 bits (667),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVSLKYLLKLKFNFK  1009



>ref|XP_004393605.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Odobenus rosmarus 
divergens]
Length=1014

 Score =   261 bits (667),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+   + KY++ THA TH  + LEV  +F++ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  806   RDSEEAETIRKYVKNTHATTHNAYDLEVIDIFTVEREGESQRYEPFRQ-LHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +PVG +LL EV
Sbjct  865   RATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCRTSQADPVGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  +  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPAASITM-DGVEVPLGTGISSGVSDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_002941174.2| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Xenopus 
(Silurana) tropicalis]
Length=1013

 Score =   261 bits (667),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             ++SE+ R++  Y++ THA TH  + LEV ++F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  802   KESEESRIIRDYVKNTHAETHNAYDLEVLEIFKIEREGEYQRYKPF-KQLHNRQLLWHGS  860

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC     NP+G +LL EV
Sbjct  861   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCNAMPGNPIGLILLGEV  920

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHEL+ A ++ K PKGKHS KGLG+T P  S  VK  D V VP GK   + +  + 
Sbjct  921   ALGNMHELRAASHITKLPKGKHSVKGLGRTAPDPSATVKL-DGVDVPLGKGSATNITDAS  979

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  980   LLYNEYIVYDVAQVNLKYLLKLKFNYK  1006



>ref|XP_004761979.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X3 [Mustela 
putorius furo]
Length=1024

 Score =   261 bits (667),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 155/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  816   RDSEEAETIRKYVKNTHATTHNAYDLEVVDIFRIEREGESQRYKPFRQ-LHNRRLLWHGS  874

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC  ++ +PVG +LL EV
Sbjct  875   RATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHASQADPVGLILLGEV  934

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  V S V  + 
Sbjct  935   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGVSSGVNDTC  993

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYI+YD+AQV L++L+K+RF +K
Sbjct  994   LLYNEYIIYDVAQVNLKYLLKLRFNFK  1020



>ref|XP_007167258.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Balaenoptera acutorostrata scammoni]
Length=1021

 Score =   261 bits (667),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  813   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  871

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  872   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  931

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  932   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGISSGVNDTC  990

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  991   LLYNEYIVYDIAQVSLKYLLKLKFNFK  1017



>ref|XP_008311175.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Cynoglossus 
semilaevis]
Length=1015

 Score =   261 bits (666),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 157/205 (77%), Gaps = 2/205 (1%)
 Frame = -2

Query  814   SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
             SE+ +++  Y++ THA TH  + LEV+++F + R+GE  +F PF ++L NR LLWHGSR 
Sbjct  809   SEEAKILLDYVKNTHAATHNTYTLEVQEIFKIVREGEHQRFRPF-EELHNRQLLWHGSRT  867

Query  634   TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
             TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL+EVAL
Sbjct  868   TNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLLLLAEVAL  927

Query  454   GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
             G+MHELKKA ++ K PKGKHS KGLG+T P   D     D V VP GK V + +  + LL
Sbjct  928   GNMHELKKASHITKLPKGKHSVKGLGRTAPDPRDSFNM-DGVQVPLGKGVSTNIDDTSLL  986

Query  274   YNEYIVYDIAQVKLQFLVKVRFQYK  200
             YNEYIVYD+AQ+ +++L+K RF Y+
Sbjct  987   YNEYIVYDVAQINMKYLLKTRFNYQ  1011



>ref|XP_007670669.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ornithorhynchus anatinus]
Length=1002

 Score =   261 bits (666),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ R++ +Y++ THA TH  + L+V  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  794  KDSEEARIIREYVKNTHATTHNAYDLQVVDIFKIEREGESQRYKPF-KQLHNRQLLWHGS  852

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  853  RATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  912

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  913  ALGNMYELKNASHISKLPKGKHSVKGLGKTAPDPSASITL-DGVEVPLGTGISSGVSDTC  971

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  972  LLYNEYIVYDIAQVNLKYLLKLKFNFK  998



>ref|XP_003385071.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Amphimedon queenslandica]
Length=883

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 164/208 (79%), Gaps = 3/208 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            ++SE+F+ + +Y+  THA TH ++ LEV++VF+LER GE  ++ PF  KL+NRMLLWHGS
Sbjct  677  KESEEFKRLVEYVANTHAATHNQYQLEVQEVFNLERHGEKKRYKPF-SKLENRMLLWHGS  735

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            RLTNFVGILSQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC+T+ ++PVG MLL EV
Sbjct  736  RLTNFVGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCWTSPQSPVGLMLLCEV  795

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQ-ESDYVKWRDEVVVPCGKPVPSKVKAS  284
            ALG+M+E + A Y+   P GKHSTKG+G+T P   S+YV      ++P GK   S  +++
Sbjct  796  ALGNMYEREHADYITSLPAGKHSTKGIGRTAPDPTSNYVS-ESGAIIPMGKGTTSSSRST  854

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQ+ +++L+K+ F+Y+
Sbjct  855  SLLYNEYIVYDVAQINMKYLIKMNFKYR  882



>ref|XP_003971725.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Takifugu rubripes]
Length=1013

 Score =   261 bits (666),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             + +++  ++ +Y++ THA TH  + LEV+++F + R+GE  ++ PF ++L NR LLWHGS
Sbjct  805   KSAKEADIILQYVKNTHAATHNTYTLEVQEIFKIRREGEHQRYRPF-EELHNRQLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++  PVGF+LL+EV
Sbjct  864   RATNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQSEPVGFLLLAEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHELKKA ++ K PKGKHS KGLG+T P  S  V   D V VP G  V + +  + 
Sbjct  924   ALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPSATVTL-DGVQVPLGNGVNTNIDDTS  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQ+ L++L+KVRF Y+
Sbjct  983   LLYNEYIVYDVAQINLKYLLKVRFNYQ  1009



>ref|XP_008311174.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Cynoglossus 
semilaevis]
Length=1021

 Score =   261 bits (666),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 157/205 (77%), Gaps = 2/205 (1%)
 Frame = -2

Query  814   SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
             SE+ +++  Y++ THA TH  + LEV+++F + R+GE  +F PF ++L NR LLWHGSR 
Sbjct  815   SEEAKILLDYVKNTHAATHNTYTLEVQEIFKIVREGEHQRFRPF-EELHNRQLLWHGSRT  873

Query  634   TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
             TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL+EVAL
Sbjct  874   TNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLLLLAEVAL  933

Query  454   GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
             G+MHELKKA ++ K PKGKHS KGLG+T P   D     D V VP GK V + +  + LL
Sbjct  934   GNMHELKKASHITKLPKGKHSVKGLGRTAPDPRDSFNM-DGVQVPLGKGVSTNIDDTSLL  992

Query  274   YNEYIVYDIAQVKLQFLVKVRFQYK  200
             YNEYIVYD+AQ+ +++L+K RF Y+
Sbjct  993   YNEYIVYDVAQINMKYLLKTRFNYQ  1017



>ref|XP_003791037.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Otolemur garnettii]
Length=1014

 Score =   260 bits (665),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + L+V  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   KDSEEAEIIRKYVKNTHATTHNAYDLQVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  V   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASVTL-DGVEVPLGTGISSGVNDTC  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_547506.3| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Canis lupus 
familiaris]
Length=1043

 Score =   260 bits (665),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  835   RDSEEAETIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  893

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  894   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  953

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  954   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGISSGVNDTC  1012

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  1013  LLYNEYIVYDIAQVNLKYLLKLKFNFK  1039



>ref|XP_001491507.4| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Equus caballus]
Length=999

 Score =   260 bits (664),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  791  KDSEEAETIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  849

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  850  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  909

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  V   D V VP G  + S V  + 
Sbjct  910  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASVTM-DGVEVPLGTGISSGVSDTC  968

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  969  LLYNEYIVYDIAQVNLKYLLKLKFNFK  995



>ref|XP_005404552.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Chinchilla lanigera]
Length=1013

 Score =   260 bits (664),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F + R+GE  ++ PFR+ L NR LLWHGS
Sbjct  805   RDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIAREGESQRYKPFRQ-LHNRKLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +  +  V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDSSASITLQG-VEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_006046141.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Bubalus 
bubalis]
Length=1013

 Score =   260 bits (664),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-VDGVEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>ref|XP_004439616.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ceratotherium simum 
simum]
Length=971

 Score =   259 bits (663),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+   + KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  763  KDSEEAETIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  821

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  822  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLVLLGEV  881

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  V   D V VP G  + S V  + 
Sbjct  882  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASVTL-DGVEVPLGTGISSGVNDTC  940

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  941  LLYNEYIVYDIAQVNLKYLLKLKFNFK  967



>ref|XP_006046140.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Bubalus 
bubalis]
Length=1016

 Score =   260 bits (664),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  808   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  866

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  867   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  926

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  927   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-VDGVEVPLGTGISSGVNDTC  985

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  986   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1012



>ref|XP_010851175.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Bison bison 
bison]
Length=1013

 Score =   260 bits (664),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-VDGVEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>ref|XP_004013685.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ovis aries]
Length=1013

 Score =   260 bits (664),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGEGQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-MDGVEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>gb|KFB53220.1| AGAP003230-PA-like protein [Anopheles sinensis]
Length=1004

 Score =   260 bits (664),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 152/206 (74%), Gaps = 1/206 (0%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            +SE+FRL++KY++ THA TH  + LE+E++F ++R GE D++ PFR  L NR LLWHGSR
Sbjct  795  NSEEFRLLQKYVRNTHAATHNSFELEIEEIFRIKRNGEADRYQPFRT-LHNRKLLWHGSR  853

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTNFVGIL+ GL+IAPPEAP TGYMFGKG+YFADMVSKSA YC T+  +  G MLL EVA
Sbjct  854  LTNFVGILTNGLKIAPPEAPATGYMFGKGIYFADMVSKSANYCCTHPADTTGLMLLCEVA  913

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LGDM E   AQY+   P GKHS KG+G T P  +   K  D V +P GK VP +   S L
Sbjct  914  LGDMQEFSNAQYVKNLPIGKHSVKGVGHTQPDPTASHKRPDGVEIPLGKGVPVEGVNSPL  973

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVYD+AQV  Q+L+K+ F YK
Sbjct  974  LYNEYIVYDVAQVNCQYLLKMDFNYK  999



>ref|XP_005216853.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Bos taurus]
Length=1013

 Score =   260 bits (664),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-VDGVEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>ref|XP_005959159.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Pantholops hodgsonii]
Length=993

 Score =   259 bits (663),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  785  KDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGEGQRYKPF-KQLHNRRLLWHGS  843

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  844  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  903

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  904  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-MDGVEVPLGTGISSGVNDTC  962

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  963  LLYNEYIVYDIAQVHLKYLLKLKFNFK  989



>ref|XP_010851174.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Bison bison 
bison]
Length=1016

 Score =   260 bits (664),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  808   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  866

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  867   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  926

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  927   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-VDGVEVPLGTGISSGVNDTC  985

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  986   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1012



>tpg|DAA21368.1| TPA: poly [ADP-ribose] polymerase 1 [Bos taurus]
Length=1016

 Score =   260 bits (664),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  808   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  866

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  867   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  926

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  927   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-VDGVEVPLGTGISSGVNDTC  985

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  986   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1012



>ref|XP_005690591.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Capra hircus]
Length=1013

 Score =   259 bits (663),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGEGQRYKPF-KQLHNRRLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  864   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  924   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-MDGVEVPLGTGISSGVNDTC  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  983   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>ref|XP_005690590.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Capra hircus]
Length=1016

 Score =   259 bits (663),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  808   KDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGEGQRYKPF-KQLHNRRLLWHGS  866

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  867   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  926

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  927   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITM-DGVEVPLGTGISSGVNDTC  985

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  986   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1012



>ref|XP_006625727.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Lepisosteus oculatus]
Length=1007

 Score =   259 bits (663),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 158/205 (77%), Gaps = 2/205 (1%)
 Frame = -2

Query  814   SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
             S++  ++ +Y++ THA TH  + LEVE+VF + R+GE  ++ PF K L NR LLWHGSR 
Sbjct  801   SKEAEVILEYVKNTHAATHNTYTLEVEEVFKIAREGEYQRYKPF-KDLPNRQLLWHGSRA  859

Query  634   TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
             TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T+  +PVG +LL+EVAL
Sbjct  860   TNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSTTDPVGLILLAEVAL  919

Query  454   GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
             G+MHELK+A ++ K PKGKHS KG+GKT P  S  V   D + VP GK + + ++ + LL
Sbjct  920   GNMHELKRASHITKLPKGKHSVKGVGKTAPDPSSTVTL-DGMQVPLGKGINTNIQDTSLL  978

Query  274   YNEYIVYDIAQVKLQFLVKVRFQYK  200
             YNEYIVYD+AQV L++L+K++F Y+
Sbjct  979   YNEYIVYDVAQVNLKYLLKIKFNYQ  1003



>ref|XP_010293489.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Phaethon 
lepturus]
Length=432

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  224  KDSEEAKIIKQYVKNTHAATHNAYDLKVVDIFRIEREGESQRYKPF-KQLHNRQLLWHGS  282

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  283  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEV  342

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  +        V VP G  + + +  + 
Sbjct  343  ALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTTLGG-VEVPLGNGISTGINDTC  401

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  402  LLYNEYIVYDVAQVNLKYLLKLKFNYK  428



>ref|XP_005014800.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1, partial [Anas platyrhynchos]
Length=877

 Score =   258 bits (659),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  669  KDSEEAKIIKQYVKNTHAATHNAYDLKVVDIFRIEREGESQRYKPF-KQLHNRQLLWHGS  727

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  728  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEV  787

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  +      D V VP G  + + +  + 
Sbjct  788  ALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTSL-DGVEVPLGNGISTGINDTC  846

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  847  LLYNEYIVYDVAQVNLKYLLKLKFNYK  873



>ref|XP_004700007.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Echinops telfairi]
Length=1016

 Score =   259 bits (662),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF + L NR LLWHGS
Sbjct  808   RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGENQRYKPFTQ-LHNRRLLWHGS  866

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  867   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  926

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  +  +   D V VP G  + S V  + 
Sbjct  927   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPAASITL-DGVEVPLGTGISSGVNDTC  985

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  986   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1012



>ref|XP_006016655.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Alligator sinensis]
Length=1049

 Score =   259 bits (662),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 160/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  841   KDSEEAKIIKQYVKNTHAATHNAYDLKVVDIFKIEREGESQRYKPFRQ-LHNRQLLWHGS  899

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL EV
Sbjct  900   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEV  959

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  +  + + + V VP G  + + +  + 
Sbjct  960   ALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATISY-EGVEVPLGNGMSTGINDTC  1018

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  1019  LLYNEYIVYDVAQVNLKYLLKLKFNYK  1045



>ref|XP_004472547.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Dasypus novemcinctus]
Length=1122

 Score =   259 bits (663),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             R SE+  ++ KY++ THA TH  + LEVE +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  914   RASEEAEIIRKYVRNTHAATHNAYDLEVEDIFRIEREGEGQRYKPFRQ-LHNRRLLWHGS  972

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P G +LL EV
Sbjct  973   RATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPTGLVLLGEV  1032

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  V S V  + 
Sbjct  1033  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGPGVSSGVNDTC  1091

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQV L++L+K++F +K
Sbjct  1092  LLYNEYIVYDVAQVNLKYLLKLKFNFK  1118



>ref|XP_006268817.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Alligator mississippiensis]
Length=1011

 Score =   259 bits (661),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 160/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+ +++++Y++ THA TH  + L+V  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct  803   KDSEEAKIIKQYVKNTHAATHNAYDLKVVDIFKIEREGESQRYKPFRQ-LHNRQLLWHGS  861

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL EV
Sbjct  862   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEV  921

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  +  + + + V VP G  + + +  + 
Sbjct  922   ALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATISY-EGVEVPLGNGMSTGINDTC  980

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  981   LLYNEYIVYDVAQVNLKYLLKLKFNYK  1007



>ref|XP_010780561.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Notothenia coriiceps]
Length=802

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            + + +  ++ +Y++ THA TH  + LEVE++F + R+GE  ++ PF ++L NR LLWHGS
Sbjct  594  KSTTEAEIITQYVKNTHAATHNTYTLEVEEIFKIVREGERQRYRPF-EELNNRQLLWHGS  652

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL+EV
Sbjct  653  RKTNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLLLLAEV  712

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+MHELKKA ++ K PKGKHS KG+G+T P  S  V   D V VP GK   + +  + 
Sbjct  713  ALGNMHELKKASHITKVPKGKHSVKGVGRTAPDPSASVTL-DGVQVPLGKGSNTNIDDTS  771

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD++QV +++L+K++F Y+
Sbjct  772  LLYNEYIVYDVSQVNMKYLLKIKFNYQ  798



>ref|XP_003462410.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Cavia porcellus]
Length=1011

 Score =   259 bits (661),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F + R+GE  ++ PFR+ L NR LLWHGS
Sbjct  803   RDSEEAEVIRKYVKNTHATTHNAYDLEVVDIFKIAREGESQRYKPFRQ-LHNRKLLWHGS  861

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  862   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  921

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +  +  V VP G  + S V  + 
Sbjct  922   ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASITLQG-VEVPLGTGISSGVNDTC  980

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  981   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1007



>ref|XP_006375453.1| Poly [ADP-ribose] polymerase family protein [Populus trichocarpa]
 gb|ERP53250.1| Poly [ADP-ribose] polymerase family protein [Populus trichocarpa]
Length=640

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 147/207 (71%), Gaps = 2/207 (1%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSEDF ++  YLQ THA TH ++ +++ Q+F + R+ E + F  F    KNRMLLWHGSR
Sbjct  434  DSEDFAMIAMYLQNTHAKTHSQYTVDIAQIFKVSREDENESFRKF-SNTKNRMLLWHGSR  492

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM SKSA YC+ N   P G +LL EVA
Sbjct  493  LTNWTGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYANHAAPAGVLLLCEVA  552

Query  457  LGDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            LGDM EL  A Y  DK P GK STKG+G+T P  SD     D VVVP GKP   +     
Sbjct  553  LGDMAELLYANYDADKLPSGKLSTKGVGRTAPDLSDARALEDGVVVPLGKPKEQRGSKGA  612

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVY++ Q++++++V+V F YK
Sbjct  613  LLYNEYIVYNVGQIRMRYVVQVNFNYK  639



>ref|NP_777176.1| poly [ADP-ribose] polymerase 1 [Bos taurus]
 sp|P18493.2|PARP1_BOVIN RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Bos 
taurus]
 dbj|BAA14114.1| poly(ADP-ribose) synthetase [Bos taurus]
Length=1016

 Score =   259 bits (661),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  808   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS  866

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL E 
Sbjct  867   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEA  926

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A+++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  927   ALGNMYELKHARHISKLPKGKHSVKGLGKTTPDPSASIT-VDGVEVPLGTGISSGVNDTC  985

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  986   LLYNEYIVYDIAQVHLKYLLKLKFNFK  1012



>ref|XP_009860226.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ciona intestinalis]
Length=980

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 158/209 (76%), Gaps = 4/209 (2%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+F++VEKY Q THA TH ++ L +E +F + RKGEL +F PF+  L N  LLWHGS
Sbjct  769  KDSEEFKMVEKYTQLTHASTHNQYKLTIEHLFKINRKGELSRFRPFQS-LPNHKLLWHGS  827

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R+TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T+ +NP+G  LL++V
Sbjct  828  RMTNYAGILSQGLRIAPPEAPVTGYMFGKGLYFADMVSKSANYCSTSSRNPIGLALLADV  887

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPS---KVK  290
            ALG+ +ELK A+ + K PK KHS  GLGKTVP  S ++     +VVP GK V +   K K
Sbjct  888  ALGNPYELKYAKDVRKLPKSKHSVIGLGKTVPDPSTHITVDSNLVVPMGKGVEADLGKDK  947

Query  289  ASELLYNEYIVYDIAQVKLQFLVKVRFQY  203
             + LLYNEYIVYD+AQV L++LV+ +F Y
Sbjct  948  ETSLLYNEYIVYDVAQVNLKYLVQFKFHY  976



>sp|P31669.1|PARP1_XENLA RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1, partial 
[Xenopus laevis]
 emb|CAA78126.1| NAD(+) ADP-ribosyltransferase [Xenopus laevis]
Length=998

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 155/208 (75%), Gaps = 2/208 (1%)
 Frame = -2

Query  823  TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
             +DSE+ R++  Y++ THA TH  + LEV ++F ++R+GE  ++ PF K+L NR LLWHG
Sbjct  788  AKDSEESRIICDYVKNTHADTHNAYDLEVLEIFKIDREGEYQRYKPF-KQLHNRQLLWHG  846

Query  643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
            SR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC     +P+G +LL E
Sbjct  847  SRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHAMPGSPIGLILLGE  906

Query  463  VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
            VALG+MHELK A  + K PKGKHS KGLG+T P  S  V+  D V VP GK   + +  +
Sbjct  907  VALGNMHELKAASQITKLPKGKHSVKGLGRTAPDPSATVQL-DGVDVPLGKGTSANISDT  965

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F YK
Sbjct  966  SLLYNEYIVYDIAQVNLKYLLKLKFNYK  993



>gb|AAI00002.1| Poly (ADP-ribose) polymerase family, member 1 [Danio rerio]
Length=1011

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             + S + +L+ +Y++ THA TH  + L+VE++F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  803   KSSHEAQLILQYVKNTHAATHNTYTLDVEEIFKIEREGEYQRYRPF-KELPNRQLLWHGS  861

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL EV
Sbjct  862   RTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEV  921

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHELKKA ++ K PKGKHS KGLG++ P     V   + V +P GK + + +  + 
Sbjct  922   ALGNMHELKKASHITKLPKGKHSVKGLGRSAPDPRATVSL-NGVDIPLGKGMNTNIDDTS  980

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD++QV L++L+K+RF Y+
Sbjct  981   LLYNEYIVYDVSQVNLKYLLKIRFNYQ  1007



>ref|NP_001038407.1| poly [ADP-ribose] polymerase 1 [Danio rerio]
Length=1013

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             + S + +L+ +Y++ THA TH  + L+VE++F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  805   KSSHEAQLILQYVKNTHAATHNTYTLDVEEIFKIEREGEYQRYRPF-KELPNRQLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL EV
Sbjct  864   RTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHELKKA ++ K PKGKHS KGLG++ P     V   + V +P GK + + +  + 
Sbjct  924   ALGNMHELKKASHITKLPKGKHSVKGLGRSAPDPRATVSL-NGVDIPLGKGMNTNIDDTS  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD++QV L++L+K+RF Y+
Sbjct  983   LLYNEYIVYDVSQVNLKYLLKIRFNYQ  1009



>ref|NP_001081571.1| poly [ADP-ribose] polymerase 1 [Xenopus laevis]
 gb|AAI10779.1| PARP protein [Xenopus laevis]
Length=1011

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 155/208 (75%), Gaps = 2/208 (1%)
 Frame = -2

Query  823   TRDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG  644
              +DSE+ R++  Y++ THA TH  + LEV ++F ++R+GE  ++ PF K+L NR LLWHG
Sbjct  801   AKDSEESRIICDYVKNTHADTHNAYDLEVLEIFKIDREGEYQRYKPF-KQLHNRQLLWHG  859

Query  643   SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE  464
             SR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC     +P+G +LL E
Sbjct  860   SRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHAMPGSPIGLILLGE  919

Query  463   VALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKAS  284
             VALG+MHELK A  + K PKGKHS KGLG+T P  S  V+  D V VP GK   + +  +
Sbjct  920   VALGNMHELKAASQITKLPKGKHSVKGLGRTAPDPSATVQL-DGVDVPLGKGTSANISDT  978

Query  283   ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
              LLYNEYIVYDIAQV L++L+K++F YK
Sbjct  979   SLLYNEYIVYDIAQVNLKYLLKLKFNYK  1006



>ref|XP_010611507.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Fukomys damarensis]
Length=991

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+  ++ KY++ THA TH  + LEV  +F + R+GE  ++ PF K+L NR LLWHGS
Sbjct  783  KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIAREGESQRYKPF-KQLHNRKLLWHGS  841

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  842  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  901

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A +++K PKGKHS KGLGKT P  S  +  +  V VP G  + S V  + 
Sbjct  902  ALGNMYELKHASHINKLPKGKHSVKGLGKTTPDPSTSITLQG-VEVPLGTGISSGVNDTC  960

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961  LLYNEYIVYDIAQVNLKYLLKLKFNFK  987



>ref|XP_005880205.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Myotis brandtii]
Length=969

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++ KY++ THA TH  + L+V ++F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  761  KDSEEAKIIRKYVKNTHATTHNAYDLKVLEIFKIEREGENQRYKPF-KQLHNRRLLWHGS  819

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +PVG +LL EV
Sbjct  820  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPVGLVLLGEV  879

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  V S V  + 
Sbjct  880  ALGNMYELKHALHVSKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGNGVSSGVDDTS  938

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD AQV L++L+K++F +K
Sbjct  939  LLYNEYIVYDTAQVNLKYLLKLKFNFK  965



>ref|XP_011334668.1| PREDICTED: poly [ADP-ribose] polymerase [Cerapachys biroi]
 gb|EZA56984.1| Poly [ADP-ribose] polymerase [Cerapachys biroi]
Length=986

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 157/208 (75%), Gaps = 2/208 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            + SE+F+++E+Y++ THA TH ++ LE++ VF ++R+GE  +F PF KKL NR LLWHGS
Sbjct  780  KTSEEFKMIEQYVRNTHATTHMQYELEIDDVFVIKREGEEQRFKPF-KKLPNRKLLWHGS  838

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T+  NP G +LL EV
Sbjct  839  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTHSGNPTGLLLLCEV  898

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKV-KAS  284
            ALG+M+E   A Y+ K PKGKHST G G+T P      K  D V VP G  VP+ + K S
Sbjct  899  ALGNMYERYNADYIVKLPKGKHSTVGRGQTHPDPQSVYKTEDGVEVPYGTGVPANISKQS  958

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQVK ++L+++ F+YK
Sbjct  959  ALLYNEYIVYDVAQVKARYLLRMNFKYK  986



>ref|XP_008159430.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Eptesicus fuscus]
Length=972

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +DSE+ +++ KY++ THA TH  + L+V ++F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  764  KDSEEAKVIRKYVKNTHATTHNAYDLKVLEIFKIEREGEHQRYKPF-KQLHNRRLLWHGS  822

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +PVG +LL EV
Sbjct  823  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPVGLILLGEV  882

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  V S V  + 
Sbjct  883  ALGNMYELKHALHVSKLPKGKHSVKGLGKTTPDPSASITL-DGVEVPLGTGVSSGVDDTS  941

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNEYIVYD AQV L++L+K++F +K
Sbjct  942  LLYNEYIVYDTAQVNLKYLLKLKFNFK  968



>ref|XP_002058751.1| GJ11149 [Drosophila virilis]
 gb|EDW63180.1| GJ11149 [Drosophila virilis]
Length=989

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 155/207 (75%), Gaps = 1/207 (0%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            ++SE+F ++ KY+Q THA TH  + L+V  VF + R+GE  +F PF KKL+NR LLWHGS
Sbjct  783  KNSEEFTILNKYVQNTHASTHSSYELQVIDVFKVARQGEARRFKPF-KKLQNRKLLWHGS  841

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            RLTNFVGILS GL+IAPPEAP TGYMFGKG+YFADMVSKSA YC T+++N  G +LLSEV
Sbjct  842  RLTNFVGILSHGLKIAPPEAPPTGYMFGKGIYFADMVSKSANYCCTSQQNSTGLLLLSEV  901

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
            ALGDM E   A+Y++K PKGKHS  G G+T+P   +     D V +P GKP+      S 
Sbjct  902  ALGDMMECTAAKYVNKLPKGKHSCFGHGRTMPNPKESYVRADGVEIPLGKPITDANFTSS  961

Query  280  LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LLYNE+IVYDIAQV +Q+L ++ F+YK
Sbjct  962  LLYNEFIVYDIAQVNVQYLFRMEFKYK  988



>ref|XP_010732988.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Larimichthys crocea]
Length=1014

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 160/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             + +E+ +++ +Y++ THA TH  + LEV+++F + R+GE  ++ PF ++L NR LLWHGS
Sbjct  806   KTTEEAQVILQYVKNTHAATHNTYTLEVQEIFKIVREGERQRYRPF-EELHNRQLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL+EV
Sbjct  865   RTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLLLLAEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHELKKA ++ K PKGKHS KG+G+T P  S  V   D V VP GK   + +  + 
Sbjct  925   ALGNMHELKKASHITKLPKGKHSVKGVGRTAPDPSAAVTL-DGVQVPLGKGAHTNIDDTS  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQV +++L+K++F Y+
Sbjct  984   LLYNEYIVYDVAQVNMKYLLKIKFNYQ  1010



>ref|XP_006812383.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Saccoglossus 
kowalevskii]
Length=1004

 Score =   258 bits (658),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 151/205 (74%), Gaps = 1/205 (0%)
 Frame = -2

Query  814   SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL  635
             S++F ++EKY++ THA TH +++LE+  V+ L+R GE  K+ PF K+L NR LLWHGSR 
Sbjct  799   SDEFTMIEKYMKNTHAATHTQYSLELLDVYQLDRAGECSKYKPF-KQLHNRQLLWHGSRT  857

Query  634   TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL  455
             +N+ GILSQGLRIAPPEAP TGYMFGKGVYFADM SKSA YC T   N +G MLL EVAL
Sbjct  858   SNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMSSKSANYCRTTPSNNIGLMLLCEVAL  917

Query  454   GDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELL  275
             G+M+EL  A+ + KPP GKHSTKGLG T P  +  +  +D V VP GK        + LL
Sbjct  918   GNMYELTNAKSLSKPPSGKHSTKGLGATGPDPTAAITTKDGVTVPLGKGAIDGSLKTSLL  977

Query  274   YNEYIVYDIAQVKLQFLVKVRFQYK  200
             YNEYIVYD+AQV++++L K +F YK
Sbjct  978   YNEYIVYDVAQVQMKYLCKAKFNYK  1002



>ref|XP_003693603.1| PREDICTED: poly [ADP-ribose] polymerase-like [Apis florea]
Length=991

 Score =   258 bits (658),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 162/208 (78%), Gaps = 2/208 (1%)
 Frame = -2

Query  820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
            +++E+++++++Y++ THA TH ++ LE+E +F ++R+GE +++ PF KKL N+ LLWHGS
Sbjct  784  KENEEYKVIKQYVENTHAKTHTQYELEIEDIFIIKRQGEDNRYKPF-KKLHNKKLLWHGS  842

Query  640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC TN +NP G +LL EV
Sbjct  843  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTNSENPTGLLLLCEV  902

Query  460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKV-KAS  284
            ALG+M+E   A Y++K P GKHST G G+T P   +  K +D V VP G  V  K+ K S
Sbjct  903  ALGNMYERFHADYIEKLPSGKHSTWGRGQTQPDPENIYKMKDGVEVPYGVSVSVKLPKKS  962

Query  283  ELLYNEYIVYDIAQVKLQFLVKVRFQYK  200
            +LLYNEYIVYDIAQVK ++L+K+ F+YK
Sbjct  963  DLLYNEYIVYDIAQVKARYLLKMNFKYK  990



>gb|KFO19690.1| Poly [ADP-ribose] polymerase 1 [Fukomys damarensis]
Length=1015

 Score =   258 bits (658),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             +DSE+  ++ KY++ THA TH  + LEV  +F + R+GE  ++ PF K+L NR LLWHGS
Sbjct  807   KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIAREGESQRYKPF-KQLHNRKLLWHGS  865

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct  866   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV  925

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A +++K PKGKHS KGLGKT P  S  +  +  V VP G  + S V  + 
Sbjct  926   ALGNMYELKHASHINKLPKGKHSVKGLGKTTPDPSTSITLQG-VEVPLGTGISSGVNDTC  984

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  985   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1011



>ref|XP_007552911.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Poecilia formosa]
Length=1015

 Score =   258 bits (658),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 160/207 (77%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             + +++  ++ +Y++ THA TH  + LEV+ +F + R+GE  +++PF ++L NR LLWHGS
Sbjct  807   KTTQEAEIIMQYVKNTHAATHNTYTLEVQDIFKVTREGEHQRYSPF-EELHNRQLLWHGS  865

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL+EV
Sbjct  866   RATNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQSDPVGLILLAEV  925

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHELKKA ++ K PKGKHS KGLG+T P + +     + V VP GK V + +  + 
Sbjct  926   ALGNMHELKKASHITKLPKGKHSVKGLGRTAP-DPNASATLNGVQVPLGKGVNTNIDDTS  984

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQ+ L++L+K+RF Y+
Sbjct  985   LLYNEYIVYDVAQINLKYLLKIRFNYQ  1011



>gb|KFM63822.1| Poly [ADP-ribose] polymerase 1, partial [Stegodyphus mimosarum]
Length=975

 Score =   257 bits (657),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 161/206 (78%), Gaps = 2/206 (1%)
 Frame = -2

Query  817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR  638
            DSE+++ +E YL  THA TH ++ L++++VF+++R+GE +K+  F K L N+ LLWHGSR
Sbjct  769  DSEEYKYIETYLHNTHAKTHDQYTLDLDEVFTIKRRGENEKYKKF-KDLHNKKLLWHGSR  827

Query  637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA  458
            LTN+VGILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC+T +KNP G +LL EVA
Sbjct  828  LTNYVGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCYTTKKNPTGLLLLCEVA  887

Query  457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL  278
            LG+M+E   A++++K PK KHSTKGLG T+P   +   +  +V VP GKPV S V  S L
Sbjct  888  LGNMYEKTSAEFVEKLPKDKHSTKGLGMTIPDPKEKA-FIGDVEVPFGKPVKSNVSNSAL  946

Query  277  LYNEYIVYDIAQVKLQFLVKVRFQYK  200
            LYNEYIVY+  QV +++L+KV F+++
Sbjct  947  LYNEYIVYNKNQVNIKYLLKVNFKWR  972



>emb|CDQ76498.1| unnamed protein product [Oncorhynchus mykiss]
Length=1013

 Score =   258 bits (658),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 155/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             + +E+  ++ +Y++ THA TH  + LEVE++F + R+GE  K+ PF+  L NR LLWHGS
Sbjct  805   KTTEEAEIILQYVKNTHAATHNTYTLEVEEIFKIVREGEYQKYRPFQD-LPNRQLLWHGS  863

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +P G +LL EV
Sbjct  864   RATNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQSDPTGLLLLGEV  923

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+MHELKKA ++ K PKGKHS KGLG+  P  S  V   D V VP GK   + +  + 
Sbjct  924   ALGNMHELKKASHITKLPKGKHSVKGLGRNAPDPSATVTL-DGVQVPLGKGTNTNIDDTS  982

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  983   LLYNEYIVYDVAQVNLKYLLKIKFNYQ  1009



>gb|AAA60155.1| poly(ADP-ribose) polymerase [Homo sapiens]
Length=1014

 Score =   257 bits (657),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 156/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  820   RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS  641
             RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct  806   RDSEEAEIIRKYVKNTHATTHSAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS  864

Query  640   RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV  461
             R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA Y  T++ +P+G +LL EV
Sbjct  865   RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYYHTSQGDPIGLILLGEV  924

Query  460   ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE  281
             ALG+M+ELK A ++ + PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct  925   ALGNMYELKHASHISRLPKGKHSVKGLGKTTPDPSANISL-DGVDVPLGTGISSGVIDTS  983

Query  280   LLYNEYIVYDIAQVKLQFLVKVRFQYK  200
             LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  984   LLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1686516490435