BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF039D04

Length=815
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAD20980.1|  translation initiation factor 4A2                       395   6e-136   Zea mays [maize]
ref|XP_009780782.1|  PREDICTED: eukaryotic initiation factor 4A-1...    401   2e-135   Nicotiana sylvestris
gb|AFC90091.1|  eukaryotic initiation factor 4A-14                      400   2e-135   Nicotiana benthamiana
ref|XP_004245077.1|  PREDICTED: eukaryotic initiation factor 4A-2       400   4e-135   Solanum lycopersicum
ref|XP_007202168.1|  hypothetical protein PRUPE_ppa006450mg             400   5e-135   Prunus persica
ref|XP_006453067.1|  hypothetical protein CICLE_v10008468mg             400   5e-135   Citrus clementina [clementine]
ref|XP_008337727.1|  PREDICTED: eukaryotic initiation factor 4A-11      400   6e-135   Malus domestica [apple tree]
ref|XP_007012776.1|  Eukaryotic translation initiation factor 4A1...    399   6e-135   
gb|KDO65152.1|  hypothetical protein CISIN_1g015129mg                   395   7e-135   Citrus sinensis [apfelsine]
ref|XP_004253094.1|  PREDICTED: eukaryotic initiation factor 4A-2...    399   7e-135   Solanum lycopersicum
ref|XP_004291063.1|  PREDICTED: eukaryotic initiation factor 4A-2       399   8e-135   Fragaria vesca subsp. vesca
ref|XP_004253093.1|  PREDICTED: eukaryotic initiation factor 4A-2       399   9e-135   Solanum lycopersicum
ref|XP_002277703.1|  PREDICTED: eukaryotic initiation factor 4A-8       399   1e-134   Vitis vinifera
ref|XP_011010150.1|  PREDICTED: eukaryotic initiation factor 4A-8       399   1e-134   Populus euphratica
ref|XP_006342504.1|  PREDICTED: eukaryotic initiation factor 4A-2...    399   1e-134   Solanum tuberosum [potatoes]
ref|XP_006342502.1|  PREDICTED: eukaryotic initiation factor 4A-2...    399   1e-134   Solanum tuberosum [potatoes]
ref|XP_009784285.1|  PREDICTED: eukaryotic initiation factor 4A-14      399   1e-134   Nicotiana sylvestris
sp|Q40469.1|IF4A6_TOBAC  RecName: Full=Eukaryotic initiation fact...    393   1e-134   Nicotiana tabacum [American tobacco]
gb|KDO65151.1|  hypothetical protein CISIN_1g015129mg                   397   1e-134   Citrus sinensis [apfelsine]
ref|XP_002304104.1|  translation initiation factor 4A family protein    399   1e-134   
ref|XP_007222702.1|  hypothetical protein PRUPE_ppa006409mg             399   2e-134   Prunus persica
ref|XP_008220506.1|  PREDICTED: eukaryotic initiation factor 4A-1...    399   2e-134   Prunus mume [ume]
ref|XP_004141688.1|  PREDICTED: eukaryotic initiation factor 4A-1...    398   2e-134   Cucumis sativus [cucumbers]
emb|CDP08290.1|  unnamed protein product                                398   2e-134   Coffea canephora [robusta coffee]
ref|XP_009602748.1|  PREDICTED: eukaryotic initiation factor 4A-11      398   2e-134   Nicotiana tomentosiformis
ref|XP_002278119.1|  PREDICTED: eukaryotic initiation factor 4A-11      398   3e-134   Vitis vinifera
emb|CAN61608.1|  hypothetical protein VITISV_040122                     398   3e-134   Vitis vinifera
sp|P41379.1|IF4A2_NICPL  RecName: Full=Eukaryotic initiation fact...    398   3e-134   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009604178.1|  PREDICTED: eukaryotic initiation factor 4A-6...    390   3e-134   Nicotiana tomentosiformis
ref|XP_011100200.1|  PREDICTED: eukaryotic initiation factor 4A-14      397   4e-134   Sesamum indicum [beniseed]
ref|XP_009372398.1|  PREDICTED: eukaryotic initiation factor 4A-8       397   4e-134   Pyrus x bretschneideri [bai li]
ref|XP_009604758.1|  PREDICTED: eukaryotic initiation factor 4A-1...    397   4e-134   Nicotiana tomentosiformis
ref|XP_008392378.1|  PREDICTED: eukaryotic initiation factor 4A-8       397   5e-134   Malus domestica [apple tree]
ref|XP_009389913.1|  PREDICTED: eukaryotic initiation factor 4A-11      397   6e-134   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW75865.1|  putative DEAD-box ATP-dependent RNA helicase fami...    397   6e-134   
ref|XP_010087709.1|  Eukaryotic initiation factor 4A-8                  397   7e-134   
ref|XP_006426587.1|  hypothetical protein CICLE_v10025724mg             397   7e-134   
gb|AFW69337.1|  putative DEAD-box ATP-dependent RNA helicase fami...    397   7e-134   
ref|XP_010033764.1|  PREDICTED: eukaryotic initiation factor 4A-2...    397   7e-134   Eucalyptus grandis [rose gum]
gb|ACN34609.1|  unknown                                                 397   7e-134   Zea mays [maize]
ref|XP_010113097.1|  Eukaryotic initiation factor 4A-1                  388   8e-134   
ref|XP_007215455.1|  hypothetical protein PRUPE_ppa006399mg             397   9e-134   Prunus persica
gb|EYU29343.1|  hypothetical protein MIMGU_mgv1a007274mg                397   9e-134   Erythranthe guttata [common monkey flower]
ref|XP_007024535.1|  Eukaryotic translation initiation factor 4A1...    396   1e-133   Theobroma cacao [chocolate]
ref|XP_009624937.1|  PREDICTED: eukaryotic initiation factor 4A-8...    396   1e-133   Nicotiana tomentosiformis
ref|XP_008379513.1|  PREDICTED: eukaryotic initiation factor 4A-8       396   1e-133   Malus domestica [apple tree]
ref|XP_010533343.1|  PREDICTED: eukaryotic initiation factor 4A-1...    394   1e-133   Tarenaya hassleriana [spider flower]
ref|XP_006357392.1|  PREDICTED: eukaryotic initiation factor 4A-8...    396   1e-133   
sp|Q40465.1|IF411_TOBAC  RecName: Full=Eukaryotic initiation fact...    396   1e-133   Nicotiana tabacum [American tobacco]
ref|XP_006338111.1|  PREDICTED: eukaryotic initiation factor 4A-1...    396   2e-133   Solanum tuberosum [potatoes]
ref|XP_003533770.1|  PREDICTED: eukaryotic initiation factor 4A-1...    396   2e-133   
ref|XP_009624936.1|  PREDICTED: eukaryotic initiation factor 4A-8...    396   2e-133   Nicotiana tomentosiformis
sp|Q40467.1|IF414_TOBAC  RecName: Full=Eukaryotic initiation fact...    396   2e-133   Nicotiana tabacum [American tobacco]
ref|XP_004146811.1|  PREDICTED: eukaryotic initiation factor 4A-8...    396   2e-133   Cucumis sativus [cucumbers]
ref|XP_002521376.1|  dead box ATP-dependent RNA helicase, putative      396   2e-133   Ricinus communis
ref|XP_004303662.1|  PREDICTED: eukaryotic initiation factor 4A-8       396   2e-133   Fragaria vesca subsp. vesca
ref|XP_009798256.1|  PREDICTED: eukaryotic initiation factor 4A-8       396   2e-133   Nicotiana sylvestris
ref|XP_010322836.1|  PREDICTED: eukaryotic initiation factor 4A-8...    396   2e-133   Solanum lycopersicum
ref|XP_010322839.1|  PREDICTED: eukaryotic initiation factor 4A-8...    396   2e-133   Solanum lycopersicum
gb|KJB70132.1|  hypothetical protein B456_011G063400                    396   2e-133   Gossypium raimondii
gb|KDP33852.1|  hypothetical protein JCGZ_07423                         396   2e-133   Jatropha curcas
ref|XP_010552227.1|  PREDICTED: eukaryotic initiation factor 4A-1       394   2e-133   Tarenaya hassleriana [spider flower]
ref|XP_008447621.1|  PREDICTED: eukaryotic initiation factor 4A-8       395   2e-133   Cucumis melo [Oriental melon]
ref|XP_006338110.1|  PREDICTED: eukaryotic initiation factor 4A-1...    395   2e-133   
emb|CBI27885.3|  unnamed protein product                                395   3e-133   Vitis vinifera
ref|XP_007012323.1|  Eukaryotic translation initiation factor 4A1       395   3e-133   Theobroma cacao [chocolate]
ref|NP_001105396.1|  translational initiation factor eIF-4A             395   3e-133   
gb|KJB56903.1|  hypothetical protein B456_009G142800                    395   3e-133   Gossypium raimondii
dbj|BAH20394.1|  AT3G13920                                              389   3e-133   Arabidopsis thaliana [mouse-ear cress]
gb|KHN28839.1|  Eukaryotic initiation factor 4A-15                      395   4e-133   Glycine soja [wild soybean]
ref|XP_002438954.1|  hypothetical protein SORBIDRAFT_10g028940          395   4e-133   Sorghum bicolor [broomcorn]
sp|Q40468.1|IF415_TOBAC  RecName: Full=Eukaryotic initiation fact...    395   5e-133   Nicotiana tabacum [American tobacco]
ref|XP_010501104.1|  PREDICTED: eukaryotic initiation factor 4A-1...    393   5e-133   Camelina sativa [gold-of-pleasure]
emb|CAC43286.1|  translation initiation factor eIF-4A1                  393   5e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011046150.1|  PREDICTED: eukaryotic initiation factor 4A-8...    395   5e-133   Populus euphratica
sp|P41381.1|IF4A8_TOBAC  RecName: Full=Eukaryotic initiation fact...    395   5e-133   Nicotiana tabacum [American tobacco]
ref|NP_001242064.1|  uncharacterized protein LOC100786735               395   5e-133   Glycine max [soybeans]
ref|XP_010915249.1|  PREDICTED: eukaryotic initiation factor 4A-8...    395   5e-133   Elaeis guineensis
ref|XP_009764703.1|  PREDICTED: eukaryotic initiation factor 4A-1...    395   5e-133   Nicotiana sylvestris
sp|P41382.1|IF410_TOBAC  RecName: Full=Eukaryotic initiation fact...    395   5e-133   Nicotiana tabacum [American tobacco]
ref|XP_006369263.1|  hypothetical protein POPTR_0001s20480g             395   5e-133   
ref|XP_003522265.1|  PREDICTED: eukaryotic initiation factor 4A-11      395   5e-133   Glycine max [soybeans]
emb|CDY08220.1|  BnaA05g13990D                                          395   5e-133   Brassica napus [oilseed rape]
ref|XP_011081667.1|  PREDICTED: eukaryotic initiation factor 4A-2       395   5e-133   Sesamum indicum [beniseed]
ref|XP_008462340.1|  PREDICTED: eukaryotic initiation factor 4A-11      395   5e-133   Cucumis melo [Oriental melon]
ref|XP_009764706.1|  PREDICTED: eukaryotic initiation factor 4A-6...    393   5e-133   Nicotiana sylvestris
ref|XP_010062659.1|  PREDICTED: eukaryotic initiation factor 4A-1...    394   5e-133   Eucalyptus grandis [rose gum]
ref|XP_009597977.1|  PREDICTED: eukaryotic initiation factor 4A-15      395   5e-133   Nicotiana tomentosiformis
ref|XP_008801403.1|  PREDICTED: eukaryotic initiation factor 4A-15      394   6e-133   Phoenix dactylifera
gb|KJB34989.1|  hypothetical protein B456_006G095400                    394   6e-133   Gossypium raimondii
ref|XP_010929386.1|  PREDICTED: eukaryotic initiation factor 4A-2       394   6e-133   Elaeis guineensis
ref|XP_009604756.1|  PREDICTED: eukaryotic initiation factor 4A-7       394   7e-133   Nicotiana tomentosiformis
gb|EYU29345.1|  hypothetical protein MIMGU_mgv1a007246mg                394   7e-133   Erythranthe guttata [common monkey flower]
ref|XP_010534921.1|  PREDICTED: eukaryotic initiation factor 4A-1       394   7e-133   Tarenaya hassleriana [spider flower]
ref|XP_008782542.1|  PREDICTED: eukaryotic initiation factor 4A-1...    394   8e-133   Phoenix dactylifera
gb|KDP40743.1|  hypothetical protein JCGZ_24742                         394   8e-133   Jatropha curcas
ref|XP_008798133.1|  PREDICTED: eukaryotic initiation factor 4A-14      394   9e-133   Phoenix dactylifera
ref|XP_003526019.1|  PREDICTED: eukaryotic initiation factor 4A-11      394   9e-133   Glycine max [soybeans]
ref|NP_001058481.1|  Os06g0701100                                       394   9e-133   
ref|XP_010929385.1|  PREDICTED: eukaryotic initiation factor 4A-15      394   1e-132   Elaeis guineensis
gb|AAN74635.1|  DEAD box RNA helicase                                   394   1e-132   Pisum sativum [garden pea]
ref|NP_001104874.1|  translation initiation factor                      394   1e-132   Zea mays [maize]
ref|XP_006656443.1|  PREDICTED: eukaryotic initiation factor 4A-1...    394   1e-132   Oryza brachyantha
ref|XP_011038130.1|  PREDICTED: eukaryotic initiation factor 4A-15      394   1e-132   Populus euphratica
ref|XP_004951905.1|  PREDICTED: eukaryotic initiation factor 4A-like    394   1e-132   Setaria italica
dbj|BAJ96964.1|  predicted protein                                      394   1e-132   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002324737.1|  translation initiation factor eIF-4A family ...    394   2e-132   Populus trichocarpa [western balsam poplar]
ref|NP_001189885.1|  translational initiation factor 4A-1               393   2e-132   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ89461.1|  predicted protein                                      393   2e-132   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001078148.1|  translational initiation factor 4A-1               393   2e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501441.1|  PREDICTED: eukaryotic initiation factor 4A-1       393   2e-132   Camelina sativa [gold-of-pleasure]
ref|XP_003563508.1|  PREDICTED: eukaryotic initiation factor 4A         393   2e-132   Brachypodium distachyon [annual false brome]
ref|XP_007154632.1|  hypothetical protein PHAVU_003G134800g             393   2e-132   Phaseolus vulgaris [French bean]
ref|XP_004966111.1|  PREDICTED: eukaryotic initiation factor 4A-3...    393   2e-132   Setaria italica
gb|EMS68416.1|  Eukaryotic initiation factor 4A-1                       393   2e-132   Triticum urartu
ref|XP_006307670.1|  hypothetical protein CARUB_v10009297mg             393   2e-132   Capsella rubella
ref|XP_009399791.1|  PREDICTED: eukaryotic initiation factor 4A-8       393   2e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_566469.1|  translational initiation factor 4A-1                  393   2e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004513437.1|  PREDICTED: eukaryotic initiation factor 4A-1...    393   2e-132   
ref|NP_001151064.1|  LOC100284697                                       393   2e-132   Zea mays [maize]
ref|XP_006297793.1|  hypothetical protein CARUB_v10013828mg             393   2e-132   Capsella rubella
dbj|BAE98559.1|  eukaryotic protein synthesis initiation factor 4A      393   2e-132   Arabidopsis thaliana [mouse-ear cress]
gb|AAF19805.1|  EIF4A protein                                           391   2e-132   Brassica oleracea
ref|XP_003574572.1|  PREDICTED: eukaryotic initiation factor 4A-1...    393   2e-132   Brachypodium distachyon [annual false brome]
gb|AFC88837.1|  initiation factor 4A-3-like protein                     392   2e-132   Miscanthus sinensis
ref|XP_010542416.1|  PREDICTED: eukaryotic initiation factor 4A-1       393   2e-132   Tarenaya hassleriana [spider flower]
ref|XP_010480021.1|  PREDICTED: eukaryotic initiation factor 4A-1...    393   2e-132   Camelina sativa [gold-of-pleasure]
ref|XP_009757031.1|  PREDICTED: eukaryotic initiation factor 4A-9       393   2e-132   Nicotiana sylvestris
ref|XP_010049453.1|  PREDICTED: eukaryotic initiation factor 4A-15      393   2e-132   
sp|Q40471.1|IF4A9_TOBAC  RecName: Full=Eukaryotic initiation fact...    393   3e-132   Nicotiana tabacum [American tobacco]
ref|XP_009135344.1|  PREDICTED: eukaryotic initiation factor 4A-1...    393   3e-132   Brassica rapa
ref|XP_009106914.1|  PREDICTED: eukaryotic initiation factor 4A-1...    393   3e-132   Brassica rapa
ref|XP_002451536.1|  hypothetical protein SORBIDRAFT_04g003390          393   3e-132   Sorghum bicolor [broomcorn]
ref|XP_010927213.1|  PREDICTED: eukaryotic initiation factor 4A-2...    393   3e-132   Elaeis guineensis
ref|XP_010462344.1|  PREDICTED: eukaryotic initiation factor 4A-1...    393   3e-132   
ref|XP_010242273.1|  PREDICTED: eukaryotic initiation factor 4A-11      393   3e-132   Nelumbo nucifera [Indian lotus]
emb|CDY39079.1|  BnaA01g29770D                                          393   3e-132   Brassica napus [oilseed rape]
ref|XP_006392695.1|  hypothetical protein EUTSA_v10011528mg             392   3e-132   Eutrema salsugineum [saltwater cress]
ref|XP_010925445.1|  PREDICTED: eukaryotic initiation factor 4A-8...    392   3e-132   Elaeis guineensis
ref|XP_009117360.1|  PREDICTED: eukaryotic initiation factor 4A-1...    392   3e-132   Brassica rapa
ref|XP_009415521.1|  PREDICTED: eukaryotic initiation factor 4A-15      392   3e-132   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY02469.1|  BnaA08g00760D                                          392   4e-132   
emb|CDY10607.1|  BnaC03g70070D                                          392   4e-132   Brassica napus [oilseed rape]
ref|XP_002891805.1|  predicted protein                                  392   4e-132   Arabidopsis lyrata subsp. lyrata
ref|XP_006407149.1|  hypothetical protein EUTSA_v10020824mg             392   4e-132   
emb|CDP03140.1|  unnamed protein product                                392   4e-132   Coffea canephora [robusta coffee]
ref|XP_006597014.1|  PREDICTED: uncharacterized protein LOC100786...    394   5e-132   
ref|XP_002884997.1|  predicted protein                                  392   5e-132   Arabidopsis lyrata subsp. lyrata
ref|XP_011019413.1|  PREDICTED: eukaryotic initiation factor 4A-9...    392   5e-132   Populus euphratica
ref|XP_007136846.1|  hypothetical protein PHAVU_009G079100g             392   5e-132   Phaseolus vulgaris [French bean]
ref|NP_001045878.1|  Os02g0146600                                       392   5e-132   
ref|XP_002308545.1|  translation initiation factor eIF-4A family ...    392   5e-132   Populus trichocarpa [western balsam poplar]
ref|XP_003595233.1|  Eukaryotic initiation factor 4A                    392   6e-132   Medicago truncatula
dbj|BAJ85348.1|  predicted protein                                      392   6e-132   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIZ68204.1|  eukaryotic initiation factor 4A-14                      392   6e-132   Ornithogalum longebracteatum [sea-onion]
ref|XP_009334736.1|  PREDICTED: eukaryotic initiation factor 4A-6...    392   6e-132   
ref|XP_010536184.1|  PREDICTED: eukaryotic initiation factor 4A-9...    392   7e-132   Tarenaya hassleriana [spider flower]
ref|XP_009334735.1|  PREDICTED: eukaryotic initiation factor 4A-6...    392   7e-132   
gb|AAL91176.1|  eukaryotic translation initiation factor                392   8e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009334734.1|  PREDICTED: eukaryotic initiation factor 4A-1...    392   8e-132   
ref|XP_009334732.1|  PREDICTED: eukaryotic initiation factor 4A-6...    392   8e-132   
gb|ACJ84921.1|  unknown                                                 392   9e-132   Medicago truncatula
ref|XP_009107078.1|  PREDICTED: eukaryotic initiation factor 4A-1       392   9e-132   Brassica rapa
ref|XP_009334733.1|  PREDICTED: eukaryotic initiation factor 4A-1...    392   9e-132   
ref|XP_006390626.1|  hypothetical protein EUTSA_v10018626mg             391   9e-132   Eutrema salsugineum [saltwater cress]
gb|KHN17683.1|  Eukaryotic initiation factor 4A-15                      391   1e-131   Glycine soja [wild soybean]
ref|XP_009127949.1|  PREDICTED: eukaryotic initiation factor 4A-3...    391   1e-131   Brassica rapa
ref|XP_009127948.1|  PREDICTED: eukaryotic initiation factor 4A-3...    391   1e-131   Brassica rapa
ref|XP_008798130.1|  PREDICTED: eukaryotic initiation factor 4A-8...    391   1e-131   Phoenix dactylifera
ref|XP_007138709.1|  hypothetical protein PHAVU_009G230600g             391   1e-131   Phaseolus vulgaris [French bean]
ref|XP_006646878.1|  PREDICTED: eukaryotic initiation factor 4A-3...    391   1e-131   Oryza brachyantha
ref|XP_010927212.1|  PREDICTED: eukaryotic initiation factor 4A-1...    391   1e-131   Elaeis guineensis
gb|AFK46989.1|  unknown                                                 384   1e-131   Lotus japonicus
ref|XP_011079970.1|  PREDICTED: eukaryotic initiation factor 4A-8       391   1e-131   Sesamum indicum [beniseed]
gb|AAM63951.1|  Eukaryotic initiation factor 4A, putative               391   1e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385793.1|  PREDICTED: eukaryotic initiation factor 4A-1...    391   1e-131   Musa acuminata subsp. malaccensis [pisang utan]
sp|P41378.1|IF4A_WHEAT  RecName: Full=Eukaryotic initiation facto...    391   2e-131   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008793233.1|  PREDICTED: eukaryotic initiation factor 4A-1...    390   2e-131   Phoenix dactylifera
gb|KJB54655.1|  hypothetical protein B456_009G043400                    390   2e-131   Gossypium raimondii
gb|ABK93239.1|  unknown                                                 390   2e-131   Populus trichocarpa [western balsam poplar]
ref|XP_006453066.1|  hypothetical protein CICLE_v10008460mg             390   2e-131   Citrus clementina [clementine]
ref|XP_010688701.1|  PREDICTED: eukaryotic initiation factor 4A-9...    390   2e-131   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006853908.1|  hypothetical protein AMTR_s00036p00181640          390   2e-131   Amborella trichopoda
ref|XP_006474427.1|  PREDICTED: eukaryotic initiation factor 4A-9...    390   3e-131   Citrus sinensis [apfelsine]
emb|CDY49861.1|  BnaA02g16100D                                          391   3e-131   Brassica napus [oilseed rape]
ref|XP_006302320.1|  hypothetical protein CARUB_v10020373mg             390   3e-131   Capsella rubella
sp|Q40470.1|IF4A7_TOBAC  RecName: Full=Eukaryotic initiation fact...    390   3e-131   Nicotiana tabacum [American tobacco]
ref|XP_009146433.1|  PREDICTED: eukaryotic initiation factor 4A-1...    390   4e-131   Brassica rapa
ref|XP_010669372.1|  PREDICTED: eukaryotic initiation factor 4A-9       390   4e-131   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010416036.1|  PREDICTED: eukaryotic initiation factor 4A-3       390   4e-131   Camelina sativa [gold-of-pleasure]
gb|AAR23806.1|  initiation factor eIF4A-15                              390   5e-131   Helianthus annuus
sp|Q41741.1|IF4A_MAIZE  RecName: Full=Eukaryotic initiation facto...    389   5e-131   Zea mays [maize]
emb|CDO97887.1|  unnamed protein product                                390   5e-131   Coffea canephora [robusta coffee]
gb|ACU21478.1|  unknown                                                 389   6e-131   Glycine max [soybeans]
ref|XP_003627168.1|  Eukaryotic initiation factor 4A                    389   7e-131   Medicago truncatula
ref|XP_007135520.1|  hypothetical protein PHAVU_010G136300g             389   7e-131   Phaseolus vulgaris [French bean]
ref|XP_003531602.1|  PREDICTED: eukaryotic initiation factor 4A-10      389   8e-131   Glycine max [soybeans]
ref|XP_007012324.1|  Eukaryotic translation initiation factor 4A1       389   9e-131   Theobroma cacao [chocolate]
ref|XP_011072546.1|  PREDICTED: eukaryotic initiation factor 4A-8...    389   1e-130   Sesamum indicum [beniseed]
gb|EPS63850.1|  hypothetical protein M569_10933                         389   1e-130   Genlisea aurea
dbj|BAH20352.1|  AT1G54270                                              385   1e-130   Arabidopsis thaliana [mouse-ear cress]
gb|KHN06630.1|  Eukaryotic initiation factor 4A-15                      389   1e-130   Glycine soja [wild soybean]
ref|XP_004510408.1|  PREDICTED: eukaryotic initiation factor 4A-1...    389   1e-130   Cicer arietinum [garbanzo]
ref|XP_002888890.1|  predicted protein                                  389   1e-130   Arabidopsis lyrata subsp. lyrata
ref|NP_001185220.1|  eukaryotic initiation factor 4A-2                  388   1e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003597562.1|  Eukaryotic initiation factor 4A                    388   2e-130   Medicago truncatula
gb|KEH39505.1|  DEAD-box ATP-dependent RNA helicase                     388   2e-130   Medicago truncatula
ref|NP_177417.1|  eukaryotic initiation factor 4A-3                     388   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008242400.1|  PREDICTED: eukaryotic initiation factor 4A-2       400   3e-130   
ref|NP_175829.1|  eukaryotic initiation factor 4A-2                     388   3e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006583001.1|  PREDICTED: eukaryotic initiation factor 4A-10      388   3e-130   Glycine max [soybeans]
emb|CAA09211.1|  RNA helicase                                           389   3e-130   Arabidopsis thaliana [mouse-ear cress]
gb|KHN39326.1|  Eukaryotic initiation factor 4A-10                      387   4e-130   Glycine soja [wild soybean]
dbj|BAA02152.1|  eukaryotic initiation factor 4A                        387   4e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009105938.1|  PREDICTED: eukaryotic initiation factor 4A-3       387   5e-130   Brassica rapa
gb|KHN32709.1|  Eukaryotic initiation factor 4A-10                      387   7e-130   Glycine soja [wild soybean]
ref|XP_007150491.1|  hypothetical protein PHAVU_005G157100g             387   7e-130   Phaseolus vulgaris [French bean]
ref|XP_003543580.1|  PREDICTED: eukaryotic initiation factor 4A-1...    386   9e-130   Glycine max [soybeans]
gb|EYU21355.1|  hypothetical protein MIMGU_mgv1a0072631mg               386   9e-130   Erythranthe guttata [common monkey flower]
gb|AFK40852.1|  unknown                                                 386   1e-129   Lotus japonicus
gb|KHN30068.1|  Eukaryotic initiation factor 4A-10                      386   1e-129   Glycine soja [wild soybean]
gb|ABR18348.1|  unknown                                                 386   1e-129   Picea sitchensis
ref|XP_001758216.1|  predicted protein                                  386   1e-129   
ref|XP_004486853.1|  PREDICTED: eukaryotic initiation factor 4A-1...    386   1e-129   Cicer arietinum [garbanzo]
gb|AFK44355.1|  unknown                                                 381   1e-129   Medicago truncatula
ref|XP_001783934.1|  predicted protein                                  386   2e-129   
gb|AAY33860.1|  eukaryotic initiation factor 4A                         385   2e-129   Cenchrus americanus [bulrush millet]
ref|XP_009361722.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    400   2e-129   
ref|XP_001765568.1|  predicted protein                                  385   3e-129   
gb|ACJ84369.1|  unknown                                                 378   4e-129   Medicago truncatula
gb|EYU45869.1|  hypothetical protein MIMGU_mgv1a007331mg                385   4e-129   Erythranthe guttata [common monkey flower]
ref|XP_001771324.1|  predicted protein                                  384   5e-129   
gb|KEH32495.1|  DEAD-box ATP-dependent RNA helicase                     384   5e-129   Medicago truncatula
ref|XP_009403035.1|  PREDICTED: eukaryotic initiation factor 4A-1...    384   6e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001691452.1|  eukaryotic initiation factor 4A-like protein       384   7e-129   Chlamydomonas reinhardtii
ref|XP_002514133.1|  dead box ATP-dependent RNA helicase, putative      395   7e-129   
gb|KEH32494.1|  DEAD-box ATP-dependent RNA helicase                     384   1e-128   Medicago truncatula
gb|AAN74636.1|  DEAD box RNA helicase                                   384   1e-128   Pisum sativum [garden pea]
ref|XP_010656491.1|  PREDICTED: uncharacterized protein LOC100244028    395   4e-128   Vitis vinifera
ref|XP_009381599.1|  PREDICTED: eukaryotic initiation factor 4A-9...    382   5e-128   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006858971.1|  hypothetical protein AMTR_s00068p00116790          377   6e-128   
ref|XP_002982302.1|  hypothetical protein SELMODRAFT_228839             381   8e-128   
gb|EAZ02256.1|  hypothetical protein OsI_24355                          380   4e-127   Oryza sativa Indica Group [Indian rice]
gb|EPS65096.1|  hypothetical protein M569_09681                         380   4e-127   Genlisea aurea
ref|XP_006357714.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic i...    380   4e-127   
ref|XP_002966232.1|  hypothetical protein SELMODRAFT_143895             379   4e-127   Selaginella moellendorffii
emb|CDY32586.1|  BnaC03g15540D                                          378   6e-127   Brassica napus [oilseed rape]
gb|ABR16834.1|  unknown                                                 374   8e-127   Picea sitchensis
ref|XP_011470735.1|  PREDICTED: eukaryotic initiation factor 4A-9       391   1e-126   Fragaria vesca subsp. vesca
ref|XP_009132534.1|  PREDICTED: eukaryotic initiation factor 4A-1...    379   1e-126   Brassica rapa
ref|XP_005644820.1|  eukaryotic initiation factor 4A-like protein       379   1e-126   Coccomyxa subellipsoidea C-169
gb|ACN40838.1|  unknown                                                 378   1e-126   Picea sitchensis
ref|XP_002966250.1|  hypothetical protein SELMODRAFT_85554              378   2e-126   
ref|XP_009410226.1|  PREDICTED: eukaryotic initiation factor 4A-9...    377   4e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006601410.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    390   5e-126   
ref|XP_010262239.1|  PREDICTED: uncharacterized protein LOC104600806    392   1e-125   
gb|ACN40422.1|  unknown                                                 376   1e-125   Picea sitchensis
ref|XP_006595337.1|  PREDICTED: eukaryotic initiation factor 4A-14      387   2e-125   
gb|ACN40356.1|  unknown                                                 375   2e-125   Picea sitchensis
ref|XP_002499673.1|  hypothetical protein MICPUN_106753                 375   2e-125   Micromonas commoda
ref|XP_010090077.1|  Eukaryotic initiation factor 4A-15                 387   7e-125   
emb|CAN70196.1|  hypothetical protein VITISV_040309                     373   2e-124   Vitis vinifera
ref|XP_002951303.1|  hypothetical protein VOLCADRAFT_120953             372   3e-124   Volvox carteri f. nagariensis
ref|XP_003058151.1|  predicted protein                                  372   3e-124   Micromonas pusilla CCMP1545
ref|XP_004508240.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    386   4e-124   
ref|XP_005845171.1|  eukaryotic initiation factor 4A (ATP-depende...    372   4e-124   Chlorella variabilis
ref|XP_010324046.1|  PREDICTED: eukaryotic initiation factor 4A-9...    371   1e-123   Solanum lycopersicum
emb|CDY33073.1|  BnaC06g07060D                                          370   3e-123   Brassica napus [oilseed rape]
ref|XP_009147530.1|  PREDICTED: eukaryotic initiation factor 4A-1       369   4e-123   Brassica rapa
emb|CDY24057.1|  BnaA06g00550D                                          369   6e-123   Brassica napus [oilseed rape]
ref|XP_007513631.1|  predicted protein                                  369   7e-123   Bathycoccus prasinos
ref|XP_009779503.1|  PREDICTED: eukaryotic initiation factor 4A-9...    368   2e-122   Nicotiana sylvestris
ref|XP_001418972.1|  predicted protein                                  368   2e-122   Ostreococcus lucimarinus CCE9901
emb|CEF98795.1|  Helicase, C-terminal                                   368   2e-122   Ostreococcus tauri
gb|KIZ04417.1|  Eukaryotic initiation factor 4A-3                       367   2e-121   Monoraphidium neglectum
gb|KDD74664.1|  DEAD/DEAH box helicase                                  365   5e-121   Helicosporidium sp. ATCC 50920
ref|XP_011398174.1|  Eukaryotic initiation factor 4A-10                 361   5e-120   Auxenochlorella protothecoides
gb|KJB65515.1|  hypothetical protein B456_010G098500                    358   3e-119   Gossypium raimondii
ref|XP_008377701.1|  PREDICTED: eukaryotic initiation factor 4A-1...    360   3e-119   
gb|KJB65513.1|  hypothetical protein B456_010G098500                    358   1e-118   
dbj|BAH56988.1|  AT3G13920                                              357   2e-118   
dbj|BAB21258.1|  eukaryotic initiation factor 4A                        355   3e-117   
ref|XP_007024536.1|  Eukaryotic translation initiation factor 4A1...    349   5e-117   
ref|XP_007024537.1|  Eukaryotic translation initiation factor 4A1...    350   1e-116   
emb|CDY55205.1|  BnaCnng28430D                                          352   5e-116   
ref|NP_001030693.1|  translational initiation factor 4A-1               350   2e-115   
emb|CDX97528.1|  BnaA05g25510D                                          350   2e-115   
emb|CDX82505.1|  BnaA03g33160D                                          350   2e-115   
emb|CDX75739.1|  BnaC03g38220D                                          349   7e-115   
gb|ACJ85073.1|  unknown                                                 345   2e-114   
gb|AAK74073.1|  eukaryotic translation initiation factor 4A-1           337   7e-114   
ref|XP_002524306.1|  dead box ATP-dependent RNA helicase, putative      341   4e-112   
gb|AGF69177.1|  eukaryotic initiation factor 4A-like protein            336   7e-112   
gb|AAO17729.1|  translation initition factor eIF4A                      328   2e-110   
ref|XP_010422963.1|  PREDICTED: eukaryotic initiation factor 4A-6...    330   3e-110   
ref|XP_010490377.1|  PREDICTED: eukaryotic initiation factor 4A-6...    322   3e-106   
emb|CCI41478.1|  unnamed protein product                                325   1e-105   
ref|XP_009036016.1|  hypothetical protein AURANDRAFT_70153              321   2e-105   
ref|XP_005834643.1|  hypothetical protein GUITHDRAFT_159541             322   1e-104   
ref|XP_008914162.1|  ATP-dependent RNA helicase eIF4A                   322   2e-104   
emb|CCA22814.1|  predicted protein putative                             321   3e-104   
emb|CAA73168.1|  translation initiation factor eIF4A II                 321   3e-104   
emb|CCA22812.1|  predicted protein putative                             322   1e-103   
ref|XP_002997444.1|  ATP-dependent RNA helicase eIF4A, putative         320   1e-103   
emb|CCA22813.1|  predicted protein putative                             321   1e-103   
gb|EWM22954.1|  eukaryotic initiation factor 4a                         319   2e-103   
ref|XP_005367981.1|  PREDICTED: eukaryotic initiation factor 4A-I...    315   2e-103   
ref|XP_002116186.1|  conserved hypothetical protein                     312   2e-103   
ref|XP_008605124.1|  ATP-dependent RNA helicase eIF4A                   318   3e-103   
ref|XP_008876208.1|  ATP-dependent RNA helicase eIF4A                   317   1e-102   
ref|XP_009517402.1|  hypothetical protein PHYSODRAFT_358814             322   2e-102   
ref|XP_009825545.1|  ATP-dependent RNA helicase eIF4A                   316   4e-102   
emb|CBJ30606.1|  eukaryotic initiation factor 4A                        315   4e-102   
ref|XP_004402364.1|  PREDICTED: eukaryotic initiation factor 4A-I...    313   3e-101   
ref|XP_002186399.1|  predicted protein                                  313   3e-101   
ref|XP_002293690.1|  eukaryotic translation initiation factor 4A        311   7e-101   
ref|XP_004629607.1|  PREDICTED: eukaryotic initiation factor 4A-I...    309   2e-100   
gb|EJK47731.1|  hypothetical protein THAOC_33528                        312   7e-100   
emb|CDP92497.1|  Protein Bm13696, isoform c                             309   2e-99    
gb|KDP34074.1|  hypothetical protein JCGZ_07645                         300   6e-99    
ref|XP_003137738.1|  hypothetical protein LOAG_02152                    307   1e-98    
dbj|BAN65202.1|  eukaryotic translation initiation factor 4A, put...    300   2e-98    
gb|AFO68181.1|  eukaryotic initiation factor 4A                         297   2e-98    
ref|XP_006279086.1|  hypothetical protein CARUB_v10012714mg             306   3e-98    
gb|KHN88002.1|  Eukaryotic initiation factor 4A                         304   1e-97    
ref|XP_005714120.1|  Translation initiation factor eIF4, subunit A      304   3e-97    
ref|XP_008268024.1|  PREDICTED: eukaryotic initiation factor 4A-I...    300   3e-97    
emb|CCF72996.1|  unnamed protein product                                303   4e-97    
ref|XP_001952053.1|  PREDICTED: eukaryotic initiation factor 4A         303   5e-97    
dbj|BAB46863.1|  hypothetical protein                                   296   1e-96    
ref|XP_003966803.1|  PREDICTED: eukaryotic initiation factor 4A-I...    300   3e-96    
ref|XP_005163337.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   4e-96    
ref|XP_005989463.1|  PREDICTED: eukaryotic initiation factor 4A-I...    300   5e-96    
gb|ERZ98750.1|  hypothetical protein GLOINDRAFT_339458                  300   5e-96    
emb|CAF97552.1|  unnamed protein product                                298   6e-96    
dbj|BAG60234.1|  unnamed protein product                                293   6e-96    
gb|ETN68655.1|  helicase protein                                        294   6e-96    
ref|XP_003886231.1|  DEAD-box ATP-dependent RNA helicase 34, related    300   6e-96    
ref|XP_008888515.1|  eukaryotic initiation factor-4A, putative          300   7e-96    
ref|XP_004599876.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   7e-96    
ref|XP_005989464.1|  PREDICTED: eukaryotic initiation factor 4A-I...    299   7e-96    
dbj|BAN64713.1|  eukaryotic translation initiation factor 4A, put...    299   8e-96    
ref|XP_001612149.1|  eukaryotic translation initiation factor 4A        299   8e-96    
gb|KIL66572.1|  hypothetical protein M378DRAFT_160563                   299   8e-96    
ref|XP_009758623.1|  PREDICTED: eukaryotic initiation factor 4A-1...    303   8e-96    
ref|XP_002367359.1|  eukaryotic translation initiation factor 4A        300   9e-96    
ref|XP_005989462.1|  PREDICTED: eukaryotic initiation factor 4A-I...    299   9e-96    
ref|NP_001116509.1|  eukaryotic initiation factor 4A-II isoform b       296   1e-95    
ref|XP_003975803.1|  PREDICTED: eukaryotic initiation factor 4A-I...    299   1e-95    
ref|XP_002424727.1|  eukaryotic initiation factor 4A-II, putative       300   1e-95    
ref|XP_005006926.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   1e-95    
ref|XP_009758622.1|  PREDICTED: eukaryotic initiation factor 4A-1...    303   1e-95    
ref|XP_004647191.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   1e-95    
ref|XP_006460368.1|  hypothetical protein AGABI2DRAFT_192108            299   1e-95    
ref|XP_011484696.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   1e-95    
ref|XP_008821869.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   1e-95    
ref|XP_002186364.1|  predicted protein                                  298   1e-95    
ref|XP_006171517.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   1e-95    
ref|XP_004954515.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    299   1e-95    
ref|XP_003508263.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   1e-95    
emb|CCX34983.1|  eukaryotic translation initiation factor 4aIII         292   1e-95    
ref|XP_006985125.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   1e-95    
gb|ABA01152.1|  eukaryotic translation initiation factor                290   1e-95    
ref|XP_004899728.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   1e-95    
gb|ELV09446.1|  Eukaryotic initiation factor 4A-II                      295   2e-95    
ref|XP_009922828.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   2e-95    
ref|XP_004473758.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   2e-95    
dbj|BAK62365.1|  eukaryotic initiation factor 4A-II                     295   2e-95    
ref|XP_005331053.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   2e-95    
ref|XP_009599773.1|  PREDICTED: eukaryotic initiation factor 4A-9...    303   2e-95    
ref|NP_001105848.1|  putative RH2 protein                               298   2e-95    
gb|AAF64266.1|AF208852_1  BM-010                                        295   2e-95    
emb|CDQ62034.1|  unnamed protein product                                295   2e-95    
ref|XP_008861498.1|  eukaryotic initiation factor 4A-III                298   2e-95    
gb|ACF98296.1|  eIF-4A                                                  298   2e-95    
ref|XP_006069518.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   3e-95    
ref|XP_008803953.1|  PREDICTED: eukaryotic initiation factor 4A-3       298   3e-95    
gb|EHB13760.1|  Eukaryotic initiation factor 4A-II                      290   3e-95    
ref|XP_002499891.1|  predicted protein                                  297   4e-95    
ref|XP_002741112.1|  PREDICTED: eukaryotic initiation factor 4A-III     297   4e-95    
ref|XP_008291140.1|  PREDICTED: eukaryotic initiation factor 4A-I       297   4e-95    
gb|KIM68898.1|  hypothetical protein SCLCIDRAFT_1209115                 297   4e-95    
ref|XP_003055263.1|  predicted protein                                  297   5e-95    
ref|XP_009418656.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    297   5e-95    
ref|XP_010732076.1|  PREDICTED: eukaryotic initiation factor 4A-II      297   6e-95    
ref|XP_002454843.1|  hypothetical protein SORBIDRAFT_04g038330          297   6e-95    
ref|XP_008646449.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    297   7e-95    
dbj|BAE87228.1|  unnamed protein product                                292   7e-95    
emb|CDR93880.1|  eukaryotic translation initiation factor 4A, put...    297   7e-95    
gb|AET01642.2|  DEAD-box ATP-dependent RNA helicase                     294   7e-95    
ref|XP_007861849.1|  DEAD-domain-containing protein                     296   8e-95    
emb|CCM05551.1|  predicted protein                                      296   8e-95    
gb|KIL70221.1|  hypothetical protein M378DRAFT_156297                   296   8e-95    
emb|CCX09205.1|  Similar to eukaryotic translation initiation fac...    296   8e-95    
gb|KIO12610.1|  hypothetical protein M404DRAFT_959197                   296   9e-95    
gb|AAY86964.1|  eukaryotic translation initiation factor 4A             292   9e-95    
ref|XP_007391832.1|  hypothetical protein PHACADRAFT_113708             296   9e-95    
gb|KIK67836.1|  hypothetical protein GYMLUDRAFT_81358                   296   1e-94    
ref|XP_004576025.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   1e-94    
ref|XP_003627166.1|  Eukaryotic initiation factor 4A                    294   1e-94    
gb|EMD40918.1|  hypothetical protein CERSUDRAFT_111502                  296   1e-94    
ref|XP_010739064.1|  PREDICTED: eukaryotic initiation factor 4A-I       296   1e-94    
ref|XP_010935461.1|  PREDICTED: eukaryotic initiation factor 4A-3       296   1e-94    
gb|KIP10664.1|  hypothetical protein PHLGIDRAFT_18229                   296   1e-94    
gb|EJU06331.1|  DEAD-domain-containing protein                          296   1e-94    
ref|XP_569893.1|  hypothetical protein                                  296   1e-94    
ref|XP_003192635.1|  hypothetical protein CGB_C1160C                    296   1e-94    
gb|AFR97753.2|  ATP-dependent RNA helicase FAL1                         296   1e-94    
ref|NP_998616.2|  eukaryotic initiation factor 4A-II                    296   1e-94    
dbj|BAE31038.1|  unnamed protein product                                292   1e-94    
ref|XP_005802438.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   1e-94    
ref|XP_009822450.1|  eukaryotic initiation factor 4A-III                296   1e-94    
ref|XP_005476057.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   1e-94    
ref|XP_003038113.1|  hypothetical protein SCHCODRAFT_63532              296   1e-94    
emb|CEG64573.1|  Putative ATP-dependent RNA helicase FAL1               295   2e-94    
gb|ENN79250.1|  hypothetical protein YQE_04286                          296   2e-94    
ref|XP_005802437.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   2e-94    
ref|XP_004080057.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   2e-94    
gb|ELK28651.1|  Eukaryotic initiation factor 4A-II                      295   2e-94    
ref|XP_003437851.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   2e-94    
gb|EYB84561.1|  hypothetical protein Y032_0314g2232                     295   2e-94    
ref|XP_006262091.1|  PREDICTED: eukaryotic initiation factor 4A-II      295   2e-94    
ref|XP_003390551.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   2e-94    
ref|XP_004576023.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   2e-94    
ref|XP_005331052.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   2e-94    
ref|XP_007250744.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   2e-94    
ref|XP_005464226.1|  PREDICTED: eukaryotic initiation factor 4A-I...    296   2e-94    
ref|XP_003570724.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    296   2e-94    
ref|XP_002414033.1|  DEAD box ATP-dependent RNA helicase, putative      296   2e-94    
ref|XP_008332344.1|  PREDICTED: eukaryotic initiation factor 4A-II      296   2e-94    
ref|XP_004312485.1|  PREDICTED: eukaryotic initiation factor 4A-I...    294   2e-94    
gb|KDR83911.1|  hypothetical protein GALMADRAFT_236407                  295   2e-94    
ref|XP_001785785.1|  predicted protein                                  295   2e-94    
gb|KIK29272.1|  hypothetical protein PISMIDRAFT_89866                   295   2e-94    
ref|XP_010395597.1|  PREDICTED: eukaryotic initiation factor 4A-II      295   2e-94    
gb|EPT03584.1|  hypothetical protein FOMPIDRAFT_1022210                 295   2e-94    
ref|XP_003766125.1|  PREDICTED: eukaryotic initiation factor 4A-II      295   2e-94    
gb|KIH55792.1|  helicase protein                                        288   2e-94    
gb|EYB84565.1|  hypothetical protein Y032_0314g2232                     295   2e-94    
gb|EEC75594.1|  hypothetical protein OsI_12293                          295   2e-94    
ref|NP_001050506.1|  Os03g0566800                                       295   2e-94    
gb|KIK04633.1|  hypothetical protein K443DRAFT_675656                   295   2e-94    
ref|XP_005708863.1|  ATP-dependent RNA helicase DEAD                    296   3e-94    
ref|XP_004576024.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   3e-94    
ref|XP_003458967.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   3e-94    
ref|XP_001780266.1|  predicted protein                                  295   3e-94    
ref|XP_008282835.1|  PREDICTED: eukaryotic initiation factor 4A-II      296   3e-94    
ref|XP_006637458.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   3e-94    
ref|XP_004278520.1|  PREDICTED: eukaryotic initiation factor 4A-II      295   3e-94    
ref|XP_007116335.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   3e-94    
ref|XP_004078949.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   3e-94    
gb|EYB84563.1|  hypothetical protein Y032_0314g2232                     295   3e-94    
gb|KIJ70153.1|  hypothetical protein HYDPIDRAFT_104824                  295   3e-94    
ref|XP_001877056.1|  predicted protein                                  295   3e-94    
ref|XP_007071060.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   3e-94    
ref|XP_005506650.1|  PREDICTED: eukaryotic initiation factor 4A-II      295   3e-94    
ref|NP_001043673.1|  Os01g0639100                                       295   3e-94    
ref|NP_989880.1|  eukaryotic initiation factor 4A-II                    295   3e-94    
ref|XP_009074201.1|  PREDICTED: eukaryotic initiation factor 4A-II      295   3e-94    
ref|XP_008813196.1|  PREDICTED: eukaryotic initiation factor 4A-3...    295   3e-94    
ref|XP_007846278.1|  eukaryotic translation initiation factor eif-4a    295   3e-94    
ref|XP_004398557.1|  PREDICTED: eukaryotic initiation factor 4A-I...    294   3e-94    
gb|KDQ64342.1|  hypothetical protein JAAARDRAFT_27968                   295   3e-94    
ref|XP_006637457.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   3e-94    
ref|XP_006171515.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   3e-94    
gb|KFM75183.1|  Eukaryotic initiation factor 4A-I                       296   3e-94    
ref|XP_004594846.1|  PREDICTED: eukaryotic initiation factor 4A-I...    294   3e-94    
gb|KJA29899.1|  hypothetical protein HYPSUDRAFT_31927                   295   3e-94    
gb|KII94924.1|  hypothetical protein PLICRDRAFT_33755                   295   3e-94    
ref|XP_004673341.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    295   3e-94    
ref|XP_006171516.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   3e-94    
ref|XP_007315794.1|  hypothetical protein SERLADRAFT_461600             295   3e-94    
gb|AAH15842.1|  Eukaryotic translation initiation factor 4A, isof...    295   3e-94    
ref|XP_004473756.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   3e-94    
gb|EFB26304.1|  hypothetical protein PANDA_002799                       295   3e-94    
ref|XP_009901849.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   4e-94    
gb|AIC61961.1|  EIF4A2                                                  295   4e-94    
ref|XP_009901850.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   4e-94    
ref|XP_004713471.1|  PREDICTED: eukaryotic initiation factor 4A-II      295   4e-94    
ref|XP_004603081.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   4e-94    
ref|XP_003256667.1|  PREDICTED: eukaryotic initiation factor 4A-II      295   4e-94    
ref|XP_007767871.1|  DEAD-domain-containing protein                     295   4e-94    
emb|CAA26843.1|  unnamed protein product                                294   4e-94    
ref|XP_006627626.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   4e-94    
ref|XP_002147618.1|  eukaryotic translation initiation factor eIF...    291   4e-94    
gb|KIK46629.1|  hypothetical protein CY34DRAFT_75606                    295   4e-94    
gb|KIJ20344.1|  hypothetical protein PAXINDRAFT_108322                  295   4e-94    
ref|XP_006650261.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    295   4e-94    
ref|NP_001008336.1|  eukaryotic initiation factor 4A-II                 295   4e-94    
ref|XP_006752550.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    295   4e-94    
ref|XP_003412833.1|  PREDICTED: eukaryotic initiation factor 4A-II      295   4e-94    
gb|KIK93451.1|  hypothetical protein PAXRUDRAFT_828980                  295   4e-94    
ref|NP_001271641.1|  eukaryotic initiation factor 4A-II                 295   4e-94    
ref|XP_681285.1|  hypothetical protein AN8016.2                         295   4e-94    
ref|XP_001837040.1|  ATP-dependent RNA helicase FAL1                    295   4e-94    
ref|XP_005652416.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   4e-94    
gb|KIM91152.1|  hypothetical protein PILCRDRAFT_811650                  295   4e-94    
ref|XP_008149790.1|  PREDICTED: eukaryotic initiation factor 4A-I...    295   5e-94    
ref|XP_975511.1|  PREDICTED: eukaryotic initiation factor 4A-III        295   5e-94    
ref|XP_002998253.1|  eukaryotic initiation factor 4A-III, putative      295   5e-94    



>gb|AAD20980.1| translation initiation factor 4A2 [Zea mays]
Length=215

 Score =   395 bits (1014),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKL+TLCDLYETLA
Sbjct  21   FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLDTLCDLYETLA  80

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  81   ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  140

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  141  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  200

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  201  NVLIEELPANVADLL  215



>ref|XP_009780782.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Nicotiana 
sylvestris]
Length=413

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/195 (99%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>gb|AFC90091.1| eukaryotic initiation factor 4A-14 [Nicotiana benthamiana]
Length=413

 Score =   400 bits (1029),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/195 (99%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_004245077.1| PREDICTED: eukaryotic initiation factor 4A-2 [Solanum lycopersicum]
 ref|XP_006351592.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Solanum tuberosum]
Length=413

 Score =   400 bits (1028),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 192/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELPANVADLL
Sbjct  399  NVVVEELPANVADLL  413



>ref|XP_007202168.1| hypothetical protein PRUPE_ppa006450mg [Prunus persica]
 gb|EMJ03367.1| hypothetical protein PRUPE_ppa006450mg [Prunus persica]
Length=411

 Score =   400 bits (1027),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  217  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  276

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  277  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  336

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  337  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  396

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  397  NVLVEELPSNVADLL  411



>ref|XP_006453067.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 ref|XP_006453068.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 ref|XP_006474428.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Citrus sinensis]
 gb|ESR66307.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 gb|ESR66308.1| hypothetical protein CICLE_v10008468mg [Citrus clementina]
 gb|KDO73513.1| hypothetical protein CISIN_1g015158mg [Citrus sinensis]
 gb|KDO73514.1| hypothetical protein CISIN_1g015158mg [Citrus sinensis]
Length=412

 Score =   400 bits (1027),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 192/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  398  NVVIEELPANVADLL  412



>ref|XP_008337727.1| PREDICTED: eukaryotic initiation factor 4A-11 [Malus domestica]
Length=412

 Score =   400 bits (1027),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_007012776.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 ref|XP_007012777.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY30395.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY30396.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
Length=413

 Score =   399 bits (1026),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 192/195 (98%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFV +DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVIRDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVIIEELPANVADLL  413



>gb|KDO65152.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65153.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65154.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
Length=286

 Score =   395 bits (1014),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  92   FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  151

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  152  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  211

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  212  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  271

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  272  NVVIEELPSNVADLL  286



>ref|XP_004253094.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum lycopersicum]
Length=410

 Score =   399 bits (1026),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 192/195 (98%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  216  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  275

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  276  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  335

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  336  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  395

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  396  NVVIEELPANVADLL  410



>ref|XP_004291063.1| PREDICTED: eukaryotic initiation factor 4A-2 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   399 bits (1026),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 192/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDM+QNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMEQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_004253093.1| PREDICTED: eukaryotic initiation factor 4A-2 [Solanum lycopersicum]
Length=413

 Score =   399 bits (1025),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 192/195 (98%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_002277703.1| PREDICTED: eukaryotic initiation factor 4A-8 [Vitis vinifera]
Length=413

 Score =   399 bits (1025),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_011010150.1| PREDICTED: eukaryotic initiation factor 4A-8 [Populus euphratica]
Length=413

 Score =   399 bits (1025),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DD+RMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDDRMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVIIEELPSNVADLL  413



>ref|XP_006342504.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum tuberosum]
Length=413

 Score =   399 bits (1025),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELPANVADLL
Sbjct  399  NVVVEELPANVADLL  413



>ref|XP_006342502.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Solanum tuberosum]
Length=410

 Score =   399 bits (1024),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  216  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  275

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  276  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  335

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  336  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  395

Query  274  NVMIEELPANVADLL  230
            NV++EELPANVADLL
Sbjct  396  NVVVEELPANVADLL  410



>ref|XP_009784285.1| PREDICTED: eukaryotic initiation factor 4A-14 [Nicotiana sylvestris]
Length=413

 Score =   399 bits (1025),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>sp|Q40469.1|IF4A6_TOBAC RecName: Full=Eukaryotic initiation factor 4A-6; Short=eIF-4A-6; 
AltName: Full=ATP-dependent RNA helicase eIF4A-6, partial 
[Nicotiana tabacum]
 emb|CAA55740.1| unnamed protein product [Nicotiana tabacum]
Length=253

 Score =   393 bits (1009),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/194 (98%), Positives = 193/194 (99%), Gaps = 0/194 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  60   FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  119

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  120  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  179

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGV+INFVTKDDERMLFDIQKFY
Sbjct  180  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVSINFVTKDDERMLFDIQKFY  239

Query  274  NVMIEELPANVADL  233
            NV+IEELPANVADL
Sbjct  240  NVVIEELPANVADL  253



>gb|KDO65151.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
Length=369

 Score =   397 bits (1020),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  175  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  234

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  235  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  294

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  295  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  354

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  355  NVVIEELPSNVADLL  369



>ref|XP_002304104.1| translation initiation factor 4A family protein [Populus trichocarpa]
 ref|XP_002304185.2| hypothetical protein POPTR_0003s04150g [Populus trichocarpa]
 gb|ABK94270.1| unknown [Populus trichocarpa]
 gb|EEE79083.1| translation initiation factor 4A family protein [Populus trichocarpa]
 gb|EEE79164.2| hypothetical protein POPTR_0003s04150g [Populus trichocarpa]
Length=413

 Score =   399 bits (1024),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DD+RMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDDRMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_007222702.1| hypothetical protein PRUPE_ppa006409mg [Prunus persica]
 gb|EMJ23901.1| hypothetical protein PRUPE_ppa006409mg [Prunus persica]
Length=413

 Score =   399 bits (1024),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDD+RMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_008220506.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Prunus mume]
Length=413

 Score =   399 bits (1024),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDD+RMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_004141688.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus]
 ref|XP_004155930.1| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus]
 gb|KGN45514.1| hypothetical protein Csa_7G450710 [Cucumis sativus]
Length=413

 Score =   398 bits (1023),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTNDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>emb|CDP08290.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   398 bits (1023),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>ref|XP_009602748.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nicotiana tomentosiformis]
 ref|XP_009791873.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nicotiana sylvestris]
Length=413

 Score =   398 bits (1023),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGV+INFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVSINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_002278119.1| PREDICTED: eukaryotic initiation factor 4A-11 [Vitis vinifera]
 emb|CBI20640.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   398 bits (1022),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  399  NVVVEELPSNVADLL  413



>emb|CAN61608.1| hypothetical protein VITISV_040122 [Vitis vinifera]
Length=413

 Score =   398 bits (1022),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  399  NVVVEELPSNVADLL  413



>sp|P41379.1|IF4A2_NICPL RecName: Full=Eukaryotic initiation factor 4A-2; Short=eIF-4A-2; 
AltName: Full=ATP-dependent RNA helicase eIF4A-2 [Nicotiana 
plumbaginifolia]
 emb|CAA43513.1| nicotiana eukaryotic translation initiation factor 4A [Nicotiana 
plumbaginifolia]
Length=413

 Score =   398 bits (1022),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/195 (98%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAIN VTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINSVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_009604178.1| PREDICTED: eukaryotic initiation factor 4A-6-like [Nicotiana 
tomentosiformis]
Length=228

 Score =   390 bits (1003),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  34   FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  93

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  94   ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  153

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGV+INFVT DDERML DIQ+FY
Sbjct  154  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVSINFVTNDDERMLSDIQRFY  213

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  214  NVVIEELPANVADLL  228



>ref|XP_011100200.1| PREDICTED: eukaryotic initiation factor 4A-14 [Sesamum indicum]
Length=413

 Score =   397 bits (1021),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDD+RMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_009372398.1| PREDICTED: eukaryotic initiation factor 4A-8 [Pyrus x bretschneideri]
 ref|XP_009340681.1| PREDICTED: eukaryotic initiation factor 4A-8 [Pyrus x bretschneideri]
Length=413

 Score =   397 bits (1021),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML+DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLYDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_009604758.1| PREDICTED: eukaryotic initiation factor 4A-10 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   397 bits (1021),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 192/195 (98%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_008392378.1| PREDICTED: eukaryotic initiation factor 4A-8 [Malus domestica]
Length=413

 Score =   397 bits (1021),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML+DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLYDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_009389913.1| PREDICTED: eukaryotic initiation factor 4A-11 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   397 bits (1020),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADL+
Sbjct  399  NVVIEELPSNVADLI  413



>gb|AFW75865.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
1 [Zea mays]
 gb|AFW75866.1| putative DEAD-box ATP-dependent RNA helicase family protein isoform 
2 [Zea mays]
Length=414

 Score =   397 bits (1020),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVLIEELPANVADLL  414



>ref|XP_010087709.1| Eukaryotic initiation factor 4A-8 [Morus notabilis]
 gb|EXB29697.1| Eukaryotic initiation factor 4A-8 [Morus notabilis]
Length=423

 Score =   397 bits (1021),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNV+KEEWKLETLCDLYETLA
Sbjct  229  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVEKEEWKLETLCDLYETLA  288

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  289  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  348

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT++DERMLFDIQKFY
Sbjct  349  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTREDERMLFDIQKFY  408

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  409  NVVVEELPSNVADLL  423



>ref|XP_006426587.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 ref|XP_006426588.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 ref|XP_006465995.1| PREDICTED: eukaryotic initiation factor 4A-8-like isoform X1 
[Citrus sinensis]
 ref|XP_006465996.1| PREDICTED: eukaryotic initiation factor 4A-8-like isoform X2 
[Citrus sinensis]
 gb|ESR39827.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 gb|ESR39828.1| hypothetical protein CICLE_v10025724mg [Citrus clementina]
 gb|KDO65148.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65149.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
 gb|KDO65150.1| hypothetical protein CISIN_1g015129mg [Citrus sinensis]
Length=413

 Score =   397 bits (1020),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>gb|AFW69337.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=411

 Score =   397 bits (1019),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKL+TLCDLYETLA
Sbjct  217  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLDTLCDLYETLA  276

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  277  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  336

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  337  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  396

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  397  NVLIEELPANVADLL  411



>ref|XP_010033764.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Eucalyptus 
grandis]
 gb|KCW53567.1| hypothetical protein EUGRSUZ_J028421 [Eucalyptus grandis]
Length=412

 Score =   397 bits (1019),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKR+ELTLEGIKQFHVNVDKEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKREELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGR GRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRGGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>gb|ACN34609.1| unknown [Zea mays]
 gb|AFW69338.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=414

 Score =   397 bits (1019),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVLIEELPANVADLL  414



>ref|XP_010113097.1| Eukaryotic initiation factor 4A-1 [Morus notabilis]
 gb|EXC64543.1| Eukaryotic initiation factor 4A-1 [Morus notabilis]
Length=191

 Score =   388 bits (997),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 186/191 (97%), Positives = 191/191 (100%), Gaps = 0/191 (0%)
 Frame = -2

Query  802  MPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLAITQS  623
            MPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNV+KEEWKLETLCDLYETLAITQS
Sbjct  1    MPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVEKEEWKLETLCDLYETLAITQS  60

Query  622  VIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARG  443
            VIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARG
Sbjct  61   VIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARG  120

Query  442  IDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFYNVMI  263
            IDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDE+MLFDIQKFYNV++
Sbjct  121  IDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDEKMLFDIQKFYNVVV  180

Query  262  EELPANVADLL  230
            EELPANVADLL
Sbjct  181  EELPANVADLL  191



>ref|XP_007215455.1| hypothetical protein PRUPE_ppa006399mg [Prunus persica]
 ref|XP_008228255.1| PREDICTED: eukaryotic initiation factor 4A-11 [Prunus mume]
 ref|XP_008228256.1| PREDICTED: eukaryotic initiation factor 4A-11 [Prunus mume]
 gb|ADB07168.1| DEAD-box RNA helicase-like protein [Prunus persica]
 gb|ADB07169.1| DEAD-box RNA helicase-like protein [Prunus persica]
 gb|EMJ16654.1| hypothetical protein PRUPE_ppa006399mg [Prunus persica]
Length=413

 Score =   397 bits (1019),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERML+DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLYDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>gb|EYU29343.1| hypothetical protein MIMGU_mgv1a007274mg [Erythranthe guttata]
Length=413

 Score =   397 bits (1019),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM KPVRILVKRDELTLEGIKQF+VNVDKE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMAKPVRILVKRDELTLEGIKQFYVNVDKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIF+NTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFINTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELPANVADLL
Sbjct  399  NVVVEELPANVADLL  413



>ref|XP_007024535.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
 gb|EOY27157.1| Eukaryotic translation initiation factor 4A1 isoform 1 [Theobroma 
cacao]
Length=413

 Score =   396 bits (1018),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  399  NVVVEELPSNVADLL  413



>ref|XP_009624937.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X2 [Nicotiana 
tomentosiformis]
Length=400

 Score =   396 bits (1017),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  206  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  265

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  266  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  325

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  326  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDERMLFDIQKFY  385

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  386  NVIIEELPSNVADLL  400



>ref|XP_008379513.1| PREDICTED: eukaryotic initiation factor 4A-8 [Malus domestica]
Length=413

 Score =   396 bits (1018),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERML+DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLYDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_010533343.1| PREDICTED: eukaryotic initiation factor 4A-1-like, partial [Tarenaya 
hassleriana]
Length=359

 Score =   394 bits (1012),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  165  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  224

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  225  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  284

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  285  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  344

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  345  NVVVEELPSNVADLL  359



>ref|XP_006357392.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Solanum tuberosum]
Length=413

 Score =   396 bits (1017),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>sp|Q40465.1|IF411_TOBAC RecName: Full=Eukaryotic initiation factor 4A-11; Short=eIF-4A-11; 
AltName: Full=ATP-dependent RNA helicase eIF4A-11 [Nicotiana 
tabacum]
 emb|CAA55737.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   396 bits (1017),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIG SGRFGRKGV+INFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGHSGRFGRKGVSINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_006338111.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X2 
[Solanum tuberosum]
 ref|XP_006338112.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X3 
[Solanum tuberosum]
Length=414

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQ+FY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLSDIQRFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>ref|XP_003533770.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoformX1 
[Glycine max]
 ref|XP_003533771.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoformX2 
[Glycine max]
 ref|XP_006587022.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X3 
[Glycine max]
 gb|KHN35869.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNV+KEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVEKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDE+MLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDEKMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVA+LL
Sbjct  399  NVVIEELPSNVAELL  413



>ref|XP_009624936.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Nicotiana 
tomentosiformis]
Length=413

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVIIEELPSNVADLL  413



>sp|Q40467.1|IF414_TOBAC RecName: Full=Eukaryotic initiation factor 4A-14; Short=eIF-4A-14; 
AltName: Full=ATP-dependent RNA helicase eIF4A-14 [Nicotiana 
tabacum]
 emb|CAA55742.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRD++TLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMSKPVRILVKRDDVTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_004146811.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Cucumis sativus]
 ref|XP_004154791.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Cucumis sativus]
 gb|KGN59802.1| hypothetical protein Csa_3G848120 [Cucumis sativus]
Length=413

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT +DERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTEDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_002521376.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF41044.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=413

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGR GRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRGGRFGRKGVAINFVTRDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_004303662.1| PREDICTED: eukaryotic initiation factor 4A-8 [Fragaria vesca 
subsp. vesca]
Length=413

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQN RDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNQRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_009798256.1| PREDICTED: eukaryotic initiation factor 4A-8 [Nicotiana sylvestris]
Length=413

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVIIEELPSNVADLL  413



>ref|XP_010322836.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322837.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322838.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X1 [Solanum 
lycopersicum]
Length=416

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  222  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  281

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  282  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  341

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  342  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDERMLFDIQKFY  401

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  402  NVVIEELPSNVADLL  416



>ref|XP_010322839.1| PREDICTED: eukaryotic initiation factor 4A-8 isoform X2 [Solanum 
lycopersicum]
Length=413

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>gb|KJB70132.1| hypothetical protein B456_011G063400 [Gossypium raimondii]
 gb|KJB70133.1| hypothetical protein B456_011G063400 [Gossypium raimondii]
Length=413

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRD+IMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDVIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>gb|KDP33852.1| hypothetical protein JCGZ_07423 [Jatropha curcas]
Length=413

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGR GRFGRKGVAINFVTKDD+RMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRGGRFGRKGVAINFVTKDDDRMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_010552227.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=369

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  175  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  234

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  235  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  294

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  295  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  354

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  355  NVVVEELPSNVADLL  369



>ref|XP_008447621.1| PREDICTED: eukaryotic initiation factor 4A-8 [Cucumis melo]
 gb|ADN33729.1| helicase [Cucumis melo subsp. melo]
Length=413

 Score =   395 bits (1016),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT +DERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTEDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVIIEELPANVADLL  413



>ref|XP_006338110.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X1 
[Solanum tuberosum]
Length=416

 Score =   395 bits (1016),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  222  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  281

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  282  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  341

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQ+FY
Sbjct  342  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLSDIQRFY  401

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  402  NVVIEELPANVADLL  416



>emb|CBI27885.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   395 bits (1016),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_007012323.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
 gb|EOY29942.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
Length=412

 Score =   395 bits (1016),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADL+
Sbjct  398  NVVVEELPSNVADLI  412



>ref|NP_001105396.1| translational initiation factor eIF-4A [Zea mays]
 gb|AAB67607.1| translational initiation factor eIF-4A [Zea mays]
Length=414

 Score =   395 bits (1015),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+D+ERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDNERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVLIEELPANVADLL  414



>gb|KJB56903.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
 gb|KJB56904.1| hypothetical protein B456_009G142800 [Gossypium raimondii]
Length=413

 Score =   395 bits (1015),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERML+DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTNDDERMLYDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVIIEELPSNVADLL  413



>dbj|BAH20394.1| AT3G13920 [Arabidopsis thaliana]
Length=237

 Score =   389 bits (998),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  43   FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  102

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  103  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  162

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAIN VT+DDERMLFDIQKFY
Sbjct  163  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINLVTRDDERMLFDIQKFY  222

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  223  NVVVEELPSNVADLL  237



>gb|KHN28839.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   395 bits (1015),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNV+KEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVEKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDE+MLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDEKMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVA+LL
Sbjct  399  NVIIEELPSNVAELL  413



>ref|XP_002438954.1| hypothetical protein SORBIDRAFT_10g028940 [Sorghum bicolor]
 gb|EER90321.1| hypothetical protein SORBIDRAFT_10g028940 [Sorghum bicolor]
Length=414

 Score =   395 bits (1014),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KE+WKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>sp|Q40468.1|IF415_TOBAC RecName: Full=Eukaryotic initiation factor 4A-15; Short=eIF-4A-15; 
AltName: Full=ATP-dependent RNA helicase eIF4A-15 [Nicotiana 
tabacum]
 emb|CAA55739.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_010501104.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=369

 Score =   393 bits (1010),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  175  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  234

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  235  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  294

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  295  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  354

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  355  NVVVEELPSNVADLL  369



>emb|CAC43286.1| translation initiation factor eIF-4A1 [Arabidopsis thaliana]
Length=369

 Score =   393 bits (1010),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  175  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  234

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  235  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  294

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  295  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  354

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  355  NVVVEELPSNVADLL  369



>ref|XP_011046150.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Populus euphratica]
 ref|XP_011046151.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Populus euphratica]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMN PVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNTPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD+RMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTSDDDRMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVLIEELPSNVADLL  413



>sp|P41381.1|IF4A8_TOBAC RecName: Full=Eukaryotic initiation factor 4A-8; Short=eIF-4A-8; 
AltName: Full=ATP-dependent RNA helicase eIF4A-8 [Nicotiana 
tabacum]
 emb|CAA55639.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
 emb|CAA55640.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRTRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVIIEELPSNVADLL  413



>ref|NP_001242064.1| uncharacterized protein LOC100786735 [Glycine max]
 gb|ACU18275.1| unknown [Glycine max]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNV+KEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVEKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDE+MLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDEKMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVA+LL
Sbjct  399  NVIIEELPSNVAELL  413



>ref|XP_010915249.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Elaeis guineensis]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMN+PVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNRPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_009764703.1| PREDICTED: eukaryotic initiation factor 4A-15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009764704.1| PREDICTED: eukaryotic initiation factor 4A-15 isoform X1 [Nicotiana 
sylvestris]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>sp|P41382.1|IF410_TOBAC RecName: Full=Eukaryotic initiation factor 4A-10; Short=eIF-4A-10; 
AltName: Full=ATP-dependent RNA helicase eIF4A-10 [Nicotiana 
tabacum]
 emb|CAA55642.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
 emb|CAA55641.1| translation initiation factor (eIF-4A) [Nicotiana tabacum]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRD++TLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDDVTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_006369263.1| hypothetical protein POPTR_0001s20480g [Populus trichocarpa]
 ref|XP_006369264.1| translation initiation factor 4A family protein [Populus trichocarpa]
 gb|ABK93256.1| unknown [Populus trichocarpa]
 gb|ERP65832.1| hypothetical protein POPTR_0001s20480g [Populus trichocarpa]
 gb|ERP65833.1| translation initiation factor 4A family protein [Populus trichocarpa]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD+RMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTSDDDRMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  399  NVVVEELPSNVADLL  413



>ref|XP_003522265.1| PREDICTED: eukaryotic initiation factor 4A-11 [Glycine max]
 gb|KHN29706.1| Eukaryotic initiation factor 4A-11 [Glycine soja]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF VNVDKE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFFVNVDKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTGDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV IEELPANVADL+
Sbjct  399  NVQIEELPANVADLI  413



>emb|CDY08220.1| BnaA05g13990D [Brassica napus]
Length=412

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_011081667.1| PREDICTED: eukaryotic initiation factor 4A-2 [Sesamum indicum]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDD+RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRMLVDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_008462340.1| PREDICTED: eukaryotic initiation factor 4A-11 [Cucumis melo]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVD+E+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDREDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTD MRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDNMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTNDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_009764706.1| PREDICTED: eukaryotic initiation factor 4A-6 isoform X2 [Nicotiana 
sylvestris]
Length=380

 Score =   393 bits (1010),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  186  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  245

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  246  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  305

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQ+FY
Sbjct  306  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLSDIQRFY  365

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  366  NVVIEELPANVADLL  380



>ref|XP_010062659.1| PREDICTED: eukaryotic initiation factor 4A-14-like [Eucalyptus 
grandis]
 gb|KCW69788.1| hypothetical protein EUGRSUZ_F03152 [Eucalyptus grandis]
Length=412

 Score =   394 bits (1013),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKL+TLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLDTLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFV +DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVNRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_009597977.1| PREDICTED: eukaryotic initiation factor 4A-15 [Nicotiana tomentosiformis]
Length=413

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_008801403.1| PREDICTED: eukaryotic initiation factor 4A-15 [Phoenix dactylifera]
 ref|XP_008801404.1| PREDICTED: eukaryotic initiation factor 4A-15 [Phoenix dactylifera]
Length=413

 Score =   394 bits (1013),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV++EEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEREEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>gb|KJB34989.1| hypothetical protein B456_006G095400 [Gossypium raimondii]
 gb|KJB34990.1| hypothetical protein B456_006G095400 [Gossypium raimondii]
Length=413

 Score =   394 bits (1013),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRD+IMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDVIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTVDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_010929386.1| PREDICTED: eukaryotic initiation factor 4A-2 [Elaeis guineensis]
Length=413

 Score =   394 bits (1013),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV++EEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEREEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_009604756.1| PREDICTED: eukaryotic initiation factor 4A-7 [Nicotiana tomentosiformis]
 ref|XP_009604757.1| PREDICTED: eukaryotic initiation factor 4A-7 [Nicotiana tomentosiformis]
 ref|XP_009604759.1| PREDICTED: eukaryotic initiation factor 4A-7 isoform X2 [Nicotiana 
tomentosiformis]
Length=413

 Score =   394 bits (1013),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFV KDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVIKDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>gb|EYU29345.1| hypothetical protein MIMGU_mgv1a007246mg [Erythranthe guttata]
Length=413

 Score =   394 bits (1013),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM KPVRILVKRDELTLEGIKQF+VNVDKE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMAKPVRILVKRDELTLEGIKQFYVNVDKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELPANVADLL
Sbjct  399  NVVVEELPANVADLL  413



>ref|XP_010534921.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=412

 Score =   394 bits (1013),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_008782542.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
 ref|XP_008782543.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
Length=413

 Score =   394 bits (1013),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQN RDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNARDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>gb|KDP40743.1| hypothetical protein JCGZ_24742 [Jatropha curcas]
Length=413

 Score =   394 bits (1012),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGR GRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRGGRFGRKGVAINFVTRDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_008798133.1| PREDICTED: eukaryotic initiation factor 4A-14 [Phoenix dactylifera]
 ref|XP_008798134.1| PREDICTED: eukaryotic initiation factor 4A-14 [Phoenix dactylifera]
Length=413

 Score =   394 bits (1012),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_003526019.1| PREDICTED: eukaryotic initiation factor 4A-11 [Glycine max]
 gb|KHN32198.1| Eukaryotic initiation factor 4A-11 [Glycine soja]
Length=413

 Score =   394 bits (1012),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 190/195 (97%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF VNVDKE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFFVNVDKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTGDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV IEELPANVADL+
Sbjct  399  NVQIEELPANVADLI  413



>ref|NP_001058481.1| Os06g0701100 [Oryza sativa Japonica Group]
 sp|P35683.2|IF4A1_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-1; Short=eIF-4A-1; 
AltName: Full=ATP-dependent RNA helicase eIF4A-1; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 4 [Oryza sativa 
Japonica Group]
 dbj|BAD54014.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAD53769.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAF20395.1| Os06g0701100 [Oryza sativa Japonica Group]
 gb|EAZ38180.1| hypothetical protein OsJ_22532 [Oryza sativa Japonica Group]
 dbj|BAG94357.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99594.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   394 bits (1012),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>ref|XP_010929385.1| PREDICTED: eukaryotic initiation factor 4A-15 [Elaeis guineensis]
Length=413

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VN+++EEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNIEREEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>gb|AAN74635.1| DEAD box RNA helicase [Pisum sativum]
 gb|AAR97917.1| DEAD box RNA helicase [Pisum sativum]
Length=413

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLGDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVA+LL
Sbjct  399  NVLIEELPSNVAELL  413



>ref|NP_001104874.1| translation initiation factor [Zea mays]
 gb|AAB64289.1| translation initiation factor [Zea mays]
Length=414

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDER++FDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERIVFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVLIEELPANVADLL  414



>ref|XP_006656443.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X1 
[Oryza brachyantha]
 ref|XP_006656444.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X2 
[Oryza brachyantha]
Length=414

 Score =   394 bits (1011),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>ref|XP_011038130.1| PREDICTED: eukaryotic initiation factor 4A-15 [Populus euphratica]
Length=413

 Score =   394 bits (1011),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>ref|XP_004951905.1| PREDICTED: eukaryotic initiation factor 4A-like [Setaria italica]
Length=410

 Score =   394 bits (1011),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KE+WKL+TLCDLYETLA
Sbjct  216  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDWKLDTLCDLYETLA  275

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  276  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  335

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  336  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  395

Query  274  NVMIEELPANVADLL  230
            NV +EELPANVADLL
Sbjct  396  NVTVEELPANVADLL  410



>dbj|BAJ96964.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   394 bits (1011),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT++DERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTREDERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>ref|XP_002324737.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
 gb|ABK92554.1| unknown [Populus trichocarpa]
 gb|EEF03302.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
Length=413

 Score =   394 bits (1011),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>ref|NP_001189885.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 gb|AEE75441.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=407

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  213  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  272

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  273  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  332

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  333  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  392

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  393  NVVVEELPSNVADLL  407



>dbj|BAJ89461.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT12089.1| Eukaryotic initiation factor 4A [Aegilops tauschii]
Length=414

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT++DERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTREDERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>ref|NP_001078148.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 gb|AEE75440.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=402

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  208  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  267

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  268  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  327

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  328  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  387

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  388  NVVVEELPSNVADLL  402



>ref|XP_010501441.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
 ref|XP_010465264.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
 ref|XP_010487172.1| PREDICTED: eukaryotic initiation factor 4A-1 [Camelina sativa]
Length=412

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_003563508.1| PREDICTED: eukaryotic initiation factor 4A [Brachypodium distachyon]
 ref|XP_010227424.1| PREDICTED: eukaryotic initiation factor 4A [Brachypodium distachyon]
Length=414

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT++DERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTREDERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>ref|XP_007154632.1| hypothetical protein PHAVU_003G134800g [Phaseolus vulgaris]
 gb|ESW26626.1| hypothetical protein PHAVU_003G134800g [Phaseolus vulgaris]
Length=413

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDD++MLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDKMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVA+LL
Sbjct  399  NVVVEELPSNVAELL  413



>ref|XP_004966111.1| PREDICTED: eukaryotic initiation factor 4A-3-like [Setaria italica]
Length=414

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KE+WKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>gb|EMS68416.1| Eukaryotic initiation factor 4A-1 [Triticum urartu]
 gb|EMT30822.1| Eukaryotic initiation factor 4A-1 [Aegilops tauschii]
Length=414

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT++DERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTREDERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>ref|XP_006307670.1| hypothetical protein CARUB_v10009297mg [Capsella rubella]
 gb|EOA40568.1| hypothetical protein CARUB_v10009297mg [Capsella rubella]
Length=412

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_009399791.1| PREDICTED: eukaryotic initiation factor 4A-8 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTVDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADL+
Sbjct  399  NVVIEELPSNVADLI  413



>ref|NP_566469.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
 sp|P41376.1|IF4A1_ARATH RecName: Full=Eukaryotic initiation factor 4A-1; Short=eIF-4A-1; 
AltName: Full=ATP-dependent RNA helicase eIF4A-1; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 4 [Arabidopsis thaliana]
 emb|CAA46188.1| eukaryotic translation initiation factor 4A-1 [Arabidopsis thaliana]
 dbj|BAB02322.1| eukaryotic translation initiation factor; RNA helicase [Arabidopsis 
thaliana]
 emb|CAC43288.1| translation initiation factor eIF-4A1 [Arabidopsis thaliana]
 gb|AAK93634.1| putative Eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAK96536.1| AT3g13920/MDC16_4 [Arabidopsis thaliana]
 gb|AAM14243.1| putative eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAM19972.1| AT3g13920/MDC16_4 [Arabidopsis thaliana]
 gb|AAM98124.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31802.1| putative eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AEE75438.1| translational initiation factor 4A-1 [Arabidopsis thaliana]
Length=412

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_004513437.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X1 
[Cicer arietinum]
 ref|XP_004513438.1| PREDICTED: eukaryotic initiation factor 4A-15-like isoform X2 
[Cicer arietinum]
Length=413

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLGDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVA+LL
Sbjct  399  NVIIEELPSNVAELL  413



>ref|NP_001151064.1| LOC100284697 [Zea mays]
 gb|ACF79496.1| unknown [Zea mays]
 gb|ACG41480.1| eukaryotic initiation factor 4A [Zea mays]
Length=410

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VN+DKE+WKL+TLCDLYETLA
Sbjct  216  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNIDKEDWKLDTLCDLYETLA  275

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  276  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  335

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  336  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  395

Query  274  NVMIEELPANVADLL  230
            NV +EELPANVADLL
Sbjct  396  NVTVEELPANVADLL  410



>ref|XP_006297793.1| hypothetical protein CARUB_v10013828mg [Capsella rubella]
 gb|EOA30691.1| hypothetical protein CARUB_v10013828mg [Capsella rubella]
Length=412

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>dbj|BAE98559.1| eukaryotic protein synthesis initiation factor 4A [Arabidopsis 
thaliana]
Length=412

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>gb|AAF19805.1| EIF4A protein [Brassica oleracea]
Length=354

 Score =   391 bits (1004),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  160  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  219

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  220  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  279

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T DDERML DIQKFY
Sbjct  280  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTTDDERMLSDIQKFY  339

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  340  NVVVEELPSNVADLL  354



>ref|XP_003574572.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brachypodium 
distachyon]
Length=414

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT++DERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTREDERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>gb|AFC88837.1| initiation factor 4A-3-like protein, partial [Miscanthus sinensis]
Length=377

 Score =   392 bits (1006),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKL+TLCDLYETLA
Sbjct  183  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLDTLCDLYETLA  242

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  243  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  302

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERML DIQ+FY
Sbjct  303  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLSDIQRFY  362

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  363  NVVIEELPANVADLL  377



>ref|XP_010542416.1| PREDICTED: eukaryotic initiation factor 4A-1 [Tarenaya hassleriana]
Length=412

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERML+DIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLYDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_010480021.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=412

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_009757031.1| PREDICTED: eukaryotic initiation factor 4A-9 [Nicotiana sylvestris]
Length=413

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGV+INFVT DDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVSINFVTSDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_010049453.1| PREDICTED: eukaryotic initiation factor 4A-15 [Eucalyptus grandis]
 gb|KCW82050.1| hypothetical protein EUGRSUZ_C03418 [Eucalyptus grandis]
Length=413

 Score =   393 bits (1009),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGR GRFGRKGVAINFVTKDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRGGRFGRKGVAINFVTKDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>sp|Q40471.1|IF4A9_TOBAC RecName: Full=Eukaryotic initiation factor 4A-9; Short=eIF-4A-9; 
AltName: Full=ATP-dependent RNA helicase eIF4A-9 [Nicotiana 
tabacum]
 emb|CAA55736.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   393 bits (1009),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGV+INFVT DDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVSINFVTSDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_009135344.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   393 bits (1009),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_009106914.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X1 
[Brassica rapa]
 ref|XP_009106915.1| PREDICTED: eukaryotic initiation factor 4A-1-like isoform X2 
[Brassica rapa]
Length=412

 Score =   393 bits (1009),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_002451536.1| hypothetical protein SORBIDRAFT_04g003390 [Sorghum bicolor]
 gb|EES04512.1| hypothetical protein SORBIDRAFT_04g003390 [Sorghum bicolor]
Length=410

 Score =   393 bits (1009),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KE+WKL+TLCDLYETLA
Sbjct  216  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDWKLDTLCDLYETLA  275

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  276  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  335

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  336  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  395

Query  274  NVMIEELPANVADLL  230
            NV IEELPANVADLL
Sbjct  396  NVTIEELPANVADLL  410



>ref|XP_010927213.1| PREDICTED: eukaryotic initiation factor 4A-2-like [Elaeis guineensis]
Length=413

 Score =   393 bits (1009),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VN+++EEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNIEREEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADL+
Sbjct  399  NVVIEELPSNVADLI  413



>ref|XP_010462344.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Camelina sativa]
Length=412

 Score =   393 bits (1009),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_010242273.1| PREDICTED: eukaryotic initiation factor 4A-11 [Nelumbo nucifera]
Length=413

 Score =   393 bits (1009),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMN+PVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNRPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRNRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>emb|CDY39079.1| BnaA01g29770D [Brassica napus]
Length=412

 Score =   393 bits (1009),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_006392695.1| hypothetical protein EUTSA_v10011528mg [Eutrema salsugineum]
 gb|ESQ29981.1| hypothetical protein EUTSA_v10011528mg [Eutrema salsugineum]
Length=412

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_010925445.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Elaeis guineensis]
Length=413

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQN RDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNARDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_009117360.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_009415521.1| PREDICTED: eukaryotic initiation factor 4A-15 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMN+PVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNRPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADL+
Sbjct  399  NVVIEELPSNVADLI  413



>emb|CDY02469.1| BnaA08g00760D [Brassica napus]
Length=412

 Score =   392 bits (1008),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>emb|CDY10607.1| BnaC03g70070D [Brassica napus]
Length=411

 Score =   392 bits (1008),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  217  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  276

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  277  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  336

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  337  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  396

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  397  NVVVEELPSNVADLL  411



>ref|XP_002891805.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68064.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   392 bits (1008),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFITRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_006407149.1| hypothetical protein EUTSA_v10020824mg [Eutrema salsugineum]
 gb|ESQ48602.1| hypothetical protein EUTSA_v10020824mg [Eutrema salsugineum]
Length=412

 Score =   392 bits (1008),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRD+IMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDVIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>emb|CDP03140.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   392 bits (1008),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFFVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_006597014.1| PREDICTED: uncharacterized protein LOC100786735 isoform X1 [Glycine 
max]
 ref|XP_006597015.1| PREDICTED: uncharacterized protein LOC100786735 isoform X2 [Glycine 
max]
 ref|XP_006597016.1| PREDICTED: uncharacterized protein LOC100786735 isoform X3 [Glycine 
max]
Length=457

 Score =   394 bits (1011),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNV+KEEWKL+TLCDLYETLA
Sbjct  263  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVEKEEWKLDTLCDLYETLA  322

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  323  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  382

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDE+MLFDIQKFY
Sbjct  383  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDEKMLFDIQKFY  442

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVA+LL
Sbjct  443  NVIIEELPSNVAELL  457



>ref|XP_002884997.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61256.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   392 bits (1007),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTHDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_011019413.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Populus euphratica]
 ref|XP_011019414.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Populus euphratica]
Length=413

 Score =   392 bits (1007),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>ref|XP_007136846.1| hypothetical protein PHAVU_009G079100g [Phaseolus vulgaris]
 gb|ESW08840.1| hypothetical protein PHAVU_009G079100g [Phaseolus vulgaris]
Length=413

 Score =   392 bits (1007),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFFVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRNRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD+RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTSDDDRMLLDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NVM+EELPANVADL+
Sbjct  399  NVMVEELPANVADLI  413



>ref|NP_001045878.1| Os02g0146600 [Oryza sativa Japonica Group]
 sp|Q6Z2Z4.1|IF4A3_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-3; Short=eIF-4A-3; 
AltName: Full=ATP-dependent RNA helicase eIF4A-3; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 23; AltName: Full=eIF4A-2 
[Oryza sativa Japonica Group]
 dbj|BAD13081.1| putative translational initiation factor eIF-4A [Oryza sativa 
Japonica Group]
 dbj|BAF07792.1| Os02g0146600 [Oryza sativa Japonica Group]
 gb|EAY84464.1| hypothetical protein OsI_05839 [Oryza sativa Indica Group]
 dbj|BAG93556.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56296.1| hypothetical protein OsJ_05367 [Oryza sativa Japonica Group]
 gb|AGT42311.1| eucaryotic initiation factor [Oryza sativa Japonica Group]
Length=414

 Score =   392 bits (1007),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KE+WKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  399

Query  274  NVMIEELPANVADLL  230
            NV IEELPANVADLL
Sbjct  400  NVTIEELPANVADLL  414



>ref|XP_002308545.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
 gb|EEE92068.1| translation initiation factor eIF-4A family protein [Populus 
trichocarpa]
Length=413

 Score =   392 bits (1007),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>ref|XP_003595233.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|ABN09109.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES65484.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   392 bits (1007),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDERMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVA+LL
Sbjct  399  NVLIEELPSNVAELL  413



>dbj|BAJ85348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   392 bits (1007),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMR+FRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMRQFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT++DERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTREDERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>gb|AIZ68204.1| eukaryotic initiation factor 4A-14 [Ornithogalum saundersiae]
Length=413

 Score =   392 bits (1007),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT++DERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTREDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            +V+IEELP+NVADLL
Sbjct  399  DVVIEELPSNVADLL  413



>ref|XP_009334736.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X5 
[Pyrus x bretschneideri]
Length=407

 Score =   392 bits (1006),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKF+NKPVRILVKRDELTLEGIKQFHVNV+KE+WKLETLCDLYETLA
Sbjct  213  FSATMPPEALDITRKFLNKPVRILVKRDELTLEGIKQFHVNVEKEDWKLETLCDLYETLA  272

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  273  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  332

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDD+R L+DIQKFY
Sbjct  333  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRTLYDIQKFY  392

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  393  NVVIEELPANVADLL  407



>ref|XP_010536184.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Tarenaya hassleriana]
Length=412

 Score =   392 bits (1006),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKL+TLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLDTLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTD+MR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDQMRARDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERML DIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLADIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADL+
Sbjct  398  NVVIEELPANVADLI  412



>ref|XP_009334735.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X4 
[Pyrus x bretschneideri]
Length=412

 Score =   392 bits (1006),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKF+NKPVRILVKRDELTLEGIKQFHVNV+KE+WKLETLCDLYETLA
Sbjct  218  FSATMPPEALDITRKFLNKPVRILVKRDELTLEGIKQFHVNVEKEDWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDD+R L+DIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRTLYDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  398  NVVIEELPANVADLL  412



>gb|AAL91176.1| eukaryotic translation initiation factor [Arabidopsis thaliana]
Length=412

 Score =   392 bits (1006),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELT+EGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTVEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_009334734.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X3 
[Pyrus x bretschneideri]
Length=413

 Score =   392 bits (1006),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKF+NKPVRILVKRDELTLEGIKQFHVNV+KE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFLNKPVRILVKRDELTLEGIKQFHVNVEKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDD+R L+DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRTLYDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_009334732.1| PREDICTED: eukaryotic initiation factor 4A-6-like isoform X1 
[Pyrus x bretschneideri]
Length=414

 Score =   392 bits (1006),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKF+NKPVRILVKRDELTLEGIKQFHVNV+KE+WKLETLCDLYETLA
Sbjct  220  FSATMPPEALDITRKFLNKPVRILVKRDELTLEGIKQFHVNVEKEDWKLETLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDD+R L+DIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRTLYDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>gb|ACJ84921.1| unknown [Medicago truncatula]
 gb|AFK40621.1| unknown [Medicago truncatula]
Length=413

 Score =   392 bits (1006),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSV+FVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVVFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDERMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVA+LL
Sbjct  399  NVLIEELPSNVAELL  413



>ref|XP_009107078.1| PREDICTED: eukaryotic initiation factor 4A-1 [Brassica rapa]
Length=412

 Score =   392 bits (1006),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMRE RSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREVRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_009334733.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X2 
[Pyrus x bretschneideri]
Length=413

 Score =   392 bits (1006),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKF+NKPVRILVKRDELTLEGIKQFHVNV+KE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFLNKPVRILVKRDELTLEGIKQFHVNVEKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDD+R L+DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDRTLYDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_006390626.1| hypothetical protein EUTSA_v10018626mg [Eutrema salsugineum]
 gb|ESQ27912.1| hypothetical protein EUTSA_v10018626mg [Eutrema salsugineum]
Length=414

 Score =   391 bits (1005),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T DDERML DIQKFY
Sbjct  340  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTTDDERMLSDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  400  NVVVEELPSNVADLL  414



>gb|KHN17683.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDE+MLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDEKMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVA+LL
Sbjct  399  NVQVEELPSNVAELL  413



>ref|XP_009127949.1| PREDICTED: eukaryotic initiation factor 4A-3 isoform X2 [Brassica 
rapa]
Length=411

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  217  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  276

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  277  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  336

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T DDERML DIQKFY
Sbjct  337  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTTDDERMLSDIQKFY  396

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  397  NVVVEELPSNVADLL  411



>ref|XP_009127948.1| PREDICTED: eukaryotic initiation factor 4A-3 isoform X1 [Brassica 
rapa]
Length=414

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T DDERML DIQKFY
Sbjct  340  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTTDDERMLSDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  400  NVVVEELPSNVADLL  414



>ref|XP_008798130.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
 ref|XP_008798131.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
 ref|XP_008798132.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Phoenix dactylifera]
Length=413

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMN+PVRILVKRDELTLEGIKQF+VNV++EEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNRPVRILVKRDELTLEGIKQFYVNVEREEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWL DKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLADKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_007138709.1| hypothetical protein PHAVU_009G230600g [Phaseolus vulgaris]
 gb|ESW10703.1| hypothetical protein PHAVU_009G230600g [Phaseolus vulgaris]
Length=413

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDD++MLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDDKMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVA+LL
Sbjct  399  NVVVEELPSNVAELL  413



>ref|XP_006646878.1| PREDICTED: eukaryotic initiation factor 4A-3-like isoform X1 
[Oryza brachyantha]
 ref|XP_006646879.1| PREDICTED: eukaryotic initiation factor 4A-3-like isoform X2 
[Oryza brachyantha]
Length=414

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KE+WKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  399

Query  274  NVMIEELPANVADLL  230
            NV +EELPANVADLL
Sbjct  400  NVTVEELPANVADLL  414



>ref|XP_010927212.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Elaeis guineensis]
Length=413

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMN PVRILVKRDELTLEGIKQF+VN+++EEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNNPVRILVKRDELTLEGIKQFYVNIEREEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>gb|AFK46989.1| unknown [Lotus japonicus]
Length=229

 Score =   384 bits (987),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
             SATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  35   LSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  94

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  95   ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  154

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENY HRIGRSGRFGRKGVAINFVT DD RMLFDIQKFY
Sbjct  155  LARGIDVQQVSLVINYDLPTQPENYFHRIGRSGRFGRKGVAINFVTLDDSRMLFDIQKFY  214

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  215  NVTVEELPSNVADLL  229



>ref|XP_011079970.1| PREDICTED: eukaryotic initiation factor 4A-8 [Sesamum indicum]
Length=413

 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGV+INF+TKDDERML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVSINFLTKDDERMLHDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>gb|AAM63951.1| Eukaryotic initiation factor 4A, putative [Arabidopsis thaliana]
Length=412

 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRK DWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKXDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_009385793.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEIT KFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITHKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADL+
Sbjct  399  NVVIEELPSNVADLI  413



>sp|P41378.1|IF4A_WHEAT RecName: Full=Eukaryotic initiation factor 4A; Short=eIF-4A; 
AltName: Full=ATP-dependent RNA helicase eIF4A [Triticum aestivum]
Length=414

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENY HRIGRSGRFGRKGVAINFVT++DERMLFDIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYQHRIGRSGRFGRKGVAINFVTREDERMLFDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  400  NVVIEELPANVADLL  414



>ref|XP_008793233.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
 ref|XP_008793234.1| PREDICTED: eukaryotic initiation factor 4A-15-like [Phoenix dactylifera]
Length=413

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT++DERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTREDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  399  NVLVEELPSNVADLL  413



>gb|KJB54655.1| hypothetical protein B456_009G043400 [Gossypium raimondii]
 gb|KJB54656.1| hypothetical protein B456_009G043400 [Gossypium raimondii]
Length=412

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQN RDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNARDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDERML+DIQ+FY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDERMLYDIQRFY  397

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADL+
Sbjct  398  NVVIEELPSNVADLI  412



>gb|ABK93239.1| unknown [Populus trichocarpa]
Length=413

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGI+VQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERML DIQ+FY
Sbjct  339  LARGINVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>ref|XP_006453066.1| hypothetical protein CICLE_v10008460mg [Citrus clementina]
 gb|ESR66306.1| hypothetical protein CICLE_v10008460mg [Citrus clementina]
 gb|KDO73515.1| hypothetical protein CISIN_1g0150931mg [Citrus sinensis]
Length=413

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTD+MRSRDHTVSATHGDMDQN+RDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDQMRSRDHTVSATHGDMDQNSRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DD+RML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDDRMLADIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADL+
Sbjct  399  NVVIEELPANVADLI  413



>ref|XP_010688701.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KE+WKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVNKEDWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTD+MR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDQMRARDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDE+MLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTADDEKMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADL+
Sbjct  399  NVVIEELPANVADLI  413



>ref|XP_006853908.1| hypothetical protein AMTR_s00036p00181640 [Amborella trichopoda]
 gb|ERN15375.1| hypothetical protein AMTR_s00036p00181640 [Amborella trichopoda]
Length=412

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV++EEWKL+TLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEREEWKLDTLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRD+IMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDVIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERML DIQ+FY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLLDIQRFY  397

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  398  NVVIEELPSNVADLL  412



>ref|XP_006474427.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Citrus sinensis]
Length=413

 Score =   390 bits (1003),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTD+MRSRDHTVSATHGDMDQN+RDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDQMRSRDHTVSATHGDMDQNSRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DD+RML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDDRMLTDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADL+
Sbjct  399  NVVIEELPANVADLI  413



>emb|CDY49861.1| BnaA02g16100D [Brassica napus]
Length=427

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  233  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  292

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  293  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  352

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T DDERML DIQKFY
Sbjct  353  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTTDDERMLSDIQKFY  412

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  413  NVVVEELPSNVADLL  427



>ref|XP_006302320.1| hypothetical protein CARUB_v10020373mg [Capsella rubella]
 gb|EOA35218.1| hypothetical protein CARUB_v10020373mg [Capsella rubella]
Length=414

 Score =   390 bits (1002),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T DDERM+ DIQKFY
Sbjct  340  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTTDDERMMSDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  400  NVVVEELPSNVADLL  414



>sp|Q40470.1|IF4A7_TOBAC RecName: Full=Eukaryotic initiation factor 4A-7; Short=eIF-4A-7; 
AltName: Full=ATP-dependent RNA helicase eIF4A-7 [Nicotiana 
tabacum]
 emb|CAA55738.1| unnamed protein product [Nicotiana tabacum]
Length=413

 Score =   390 bits (1002),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRD++TLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDDVTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRTRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFV KDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVIKDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_009146433.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=412

 Score =   390 bits (1001),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KE+WK ETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKPETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_010669372.1| PREDICTED: eukaryotic initiation factor 4A-9 [Beta vulgaris subsp. 
vulgaris]
Length=413

 Score =   390 bits (1001),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTD+MR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDQMRARDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT  D+RMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTSTDDRMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV IEELPANVADL+
Sbjct  399  NVTIEELPANVADLI  413



>ref|XP_010416036.1| PREDICTED: eukaryotic initiation factor 4A-3 [Camelina sativa]
 ref|XP_010428171.1| PREDICTED: eukaryotic initiation factor 4A-3 [Camelina sativa]
 ref|XP_010471304.1| PREDICTED: eukaryotic initiation factor 4A-3 [Camelina sativa]
Length=414

 Score =   390 bits (1001),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T +DERML DIQKFY
Sbjct  340  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTTEDERMLSDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  400  NVVVEELPSNVADLL  414



>gb|AAR23806.1| initiation factor eIF4A-15 [Helianthus annuus]
Length=413

 Score =   390 bits (1001),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DDE+ML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTLDDEKMLGDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADL+
Sbjct  399  NVVVEELPSNVADLI  413



>sp|Q41741.1|IF4A_MAIZE RecName: Full=Eukaryotic initiation factor 4A; Short=eIF-4A; 
AltName: Full=ATP-dependent RNA helicase eIF4A [Zea mays]
 gb|AAA82736.1| translation initiation factor eIF-4A [Zea mays]
Length=410

 Score =   389 bits (1000),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VN+DKE+WKL+TLCDLYETLA
Sbjct  216  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNIDKEDWKLDTLCDLYETLA  275

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  276  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  335

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDER++FD+Q+FY
Sbjct  336  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERIVFDVQRFY  395

Query  274  NVMIEELPANVADLL  230
            NV +EELPANVADLL
Sbjct  396  NVTVEELPANVADLL  410



>emb|CDO97887.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   390 bits (1001),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTD+MR RDHTVSATHGDMDQNTRDIIMREFRSGSSR+LITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDQMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRILITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT++DE+MLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTREDEKMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP NVADLL
Sbjct  399  NVVVEELPQNVADLL  413



>gb|ACU21478.1| unknown [Glycine max]
Length=413

 Score =   389 bits (1000),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTADDSRMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>ref|XP_003627168.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|AET01644.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   389 bits (999),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGV+INFVT +D RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVSINFVTGEDARMLADIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV IEELP+NVADLL
Sbjct  399  NVTIEELPSNVADLL  413



>ref|XP_007135520.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 ref|XP_007135521.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 gb|ESW07514.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
 gb|ESW07515.1| hypothetical protein PHAVU_010G136300g [Phaseolus vulgaris]
Length=413

 Score =   389 bits (999),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDSRMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>ref|XP_003531602.1| PREDICTED: eukaryotic initiation factor 4A-10 [Glycine max]
 gb|KHN11260.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   389 bits (999),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDSRMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>ref|XP_007012324.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
 gb|EOY29943.1| Eukaryotic translation initiation factor 4A1 [Theobroma cacao]
Length=413

 Score =   389 bits (999),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTD++RSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDQLRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DD+RML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDDRMLTDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADL+
Sbjct  399  NVVIEELPANVADLI  413



>ref|XP_011072546.1| PREDICTED: eukaryotic initiation factor 4A-8-like [Sesamum indicum]
Length=412

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF+T+DDE+ML DIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFLTRDDEKMLHDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  398  NVIIEELPSNVADLL  412



>gb|EPS63850.1| hypothetical protein M569_10933 [Genlisea aurea]
Length=413

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQF+V++ KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFYVDIAKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTD+MR RDHTVSATHGDMDQNTRD+IMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDRMRGRDHTVSATHGDMDQNTRDVIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>dbj|BAH20352.1| AT1G54270 [Arabidopsis thaliana]
Length=328

 Score =   385 bits (990),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  134  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  193

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDK+RSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  194  ITQSVIFVNTRRKVDWLTDKVRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  253

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT DD+RMLFDIQKFY
Sbjct  254  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTLDDQRMLFDIQKFY  313

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  314  NVVVEELPSNVADLL  328



>gb|KHN06630.1| Eukaryotic initiation factor 4A-15 [Glycine soja]
Length=413

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV++E+WKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEREDWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDE+MLFDIQKFY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDEKMLFDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVA+LL
Sbjct  399  NVQVEELPSNVAELL  413



>ref|XP_004510408.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Cicer arietinum]
Length=413

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTMDDTRMLADIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV IEELP+NVADLL
Sbjct  399  NVSIEELPSNVADLL  413



>ref|XP_002888890.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65149.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=414

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T +DERML DIQ+FY
Sbjct  340  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTTEDERMLADIQRFY  399

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  400  NVVVEELPSNVADLL  414



>ref|NP_001185220.1| eukaryotic initiation factor 4A-2 [Arabidopsis thaliana]
 gb|AEE33074.1| translation initiation factor 4A-2 [Arabidopsis thaliana]
Length=407

 Score =   388 bits (997),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  213  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  272

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  273  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  332

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT DD+RMLFDIQKFY
Sbjct  333  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTLDDQRMLFDIQKFY  392

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  393  NVVVEELPSNVADLL  407



>ref|XP_003597562.1| Eukaryotic initiation factor 4A [Medicago truncatula]
 gb|AES67813.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   388 bits (997),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT +D RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTLEDARMLADIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  399  NVIVEELPSNVADLL  413



>gb|KEH39505.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=397

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  203  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  262

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  263  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  322

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT +D RML DIQKFY
Sbjct  323  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTLEDARMLADIQKFY  382

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  383  NVIVEELPSNVADLL  397



>ref|NP_177417.1| eukaryotic initiation factor 4A-3 [Arabidopsis thaliana]
 sp|Q9CAI7.1|IF4A3_ARATH RecName: Full=Eukaryotic initiation factor 4A-3; Short=eIF-4A-3; 
AltName: Full=ATP-dependent RNA helicase eIF4A-3; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 23 [Arabidopsis 
thaliana]
 gb|AAG51861.1|AC010926_24 putative Eukaryotic initiation factor 4A; 30924-32477 [Arabidopsis 
thaliana]
 gb|AAL31217.1| At1g72730/F28P22_8 [Arabidopsis thaliana]
 gb|AAM65719.1| putative Eukaryotic initiation factor 4A [Arabidopsis thaliana]
 gb|AAM98330.1| At1g72730/F28P22_8 [Arabidopsis thaliana]
 gb|AEE35365.1| translation initiation factor 4A-3 [Arabidopsis thaliana]
Length=414

 Score =   388 bits (997),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T +DERM+ DIQ+FY
Sbjct  340  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTSEDERMMADIQRFY  399

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  400  NVVVEELPSNVADLL  414



>ref|XP_008242400.1| PREDICTED: eukaryotic initiation factor 4A-2 [Prunus mume]
Length=806

 Score =   400 bits (1029),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  612  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  671

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  672  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  731

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  732  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  791

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  792  NVLVEELPSNVADLL  806



>ref|NP_175829.1| eukaryotic initiation factor 4A-2 [Arabidopsis thaliana]
 sp|P41377.1|IF4A2_ARATH RecName: Full=Eukaryotic initiation factor 4A-2; Short=eIF-4A-2; 
AltName: Full=ATP-dependent RNA helicase eIF4A-2; AltName: 
Full=DEAD-box ATP-dependent RNA helicase 19 [Arabidopsis 
thaliana]
 gb|AAD25605.1|AC005287_7 Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AAK62368.1|AF386923_1 Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AAL16231.1|AF428462_1 At1g54270/F20D21_52 [Arabidopsis thaliana]
 emb|CAA46189.1| eukaryotic translation initiation factor 4A-2 [Arabidopsis thaliana]
 gb|AAM65512.1| eukaryotic translation initiation factor 4A, putative [Arabidopsis 
thaliana]
 gb|AAP37863.1| At1g54270 [Arabidopsis thaliana]
 dbj|BAE98493.1| Eukaryotic Initiation Factor 4A-2 [Arabidopsis thaliana]
 gb|AEE33073.1| translation initiation factor 4A-2 [Arabidopsis thaliana]
Length=412

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT DD+RMLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTLDDQRMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  398  NVVVEELPSNVADLL  412



>ref|XP_006583001.1| PREDICTED: eukaryotic initiation factor 4A-10 [Glycine max]
Length=413

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGV+INFVT DD RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVSINFVTTDDARMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>emb|CAA09211.1| RNA helicase [Arabidopsis thaliana]
Length=441

 Score =   389 bits (998),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  247  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  306

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  307  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  366

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T +DERM+ DIQ+FY
Sbjct  367  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTSEDERMMADIQRFY  426

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  427  NVVVEELPSNVADLL  441



>gb|KHN39326.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   387 bits (995),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGV+INFVT DD RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVSINFVTMDDARMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>dbj|BAA02152.1| eukaryotic initiation factor 4A [Oryza sativa Japonica Group]
 dbj|BAB21260.1| eukaryotic initiation factor 4A [Oryza sativa]
Length=413

 Score =   387 bits (994),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 187/195 (96%), Positives = 193/195 (99%), Gaps = 1/195 (1%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTR KVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTR-KVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_009105938.1| PREDICTED: eukaryotic initiation factor 4A-3 [Brassica rapa]
Length=414

 Score =   387 bits (994),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+T DDERM+ DIQKFY
Sbjct  340  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTTDDERMMSDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            NV++EELP NVADLL
Sbjct  400  NVVVEELPNNVADLL  414



>gb|KHN32709.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   387 bits (993),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTLDDARMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>ref|XP_007150491.1| hypothetical protein PHAVU_005G157100g [Phaseolus vulgaris]
 gb|ESW22485.1| hypothetical protein PHAVU_005G157100g [Phaseolus vulgaris]
Length=413

 Score =   387 bits (993),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMN+PVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNRPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTFDDSRMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>ref|XP_003543580.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Glycine max]
 ref|XP_003546753.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X1 
[Glycine max]
 ref|XP_006597198.1| PREDICTED: eukaryotic initiation factor 4A-10-like isoform X2 
[Glycine max]
Length=413

 Score =   386 bits (992),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTLDDARMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>gb|EYU21355.1| hypothetical protein MIMGU_mgv1a0072631mg [Erythranthe guttata]
Length=413

 Score =   386 bits (992),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF+ ++DE+ML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFLVREDEKMLQDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>gb|AFK40852.1| unknown [Lotus japonicus]
Length=413

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/195 (95%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARG+DVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD RML DIQKFY
Sbjct  339  LARGVDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTLDDSRMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>gb|KHN30068.1| Eukaryotic initiation factor 4A-10 [Glycine soja]
Length=413

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRS DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD RML DIQKFY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTLDDARMLSDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  399  NVTVEELPSNVADLL  413



>gb|ABR18348.1| unknown [Picea sitchensis]
 gb|ACN39814.1| unknown [Picea sitchensis]
 gb|ACN40764.1| unknown [Picea sitchensis]
Length=413

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV+KE+WKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRARDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLQDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  399  NVVVEELPSNVADLL  413



>ref|XP_001758216.1| predicted protein [Physcomitrella patens]
 gb|EDQ77038.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPV+ILVKRDELTLEGIKQF+VNVD+EEWKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVKILVKRDELTLEGIKQFYVNVDREEWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIF+NTRRKVDWLTDKMR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFINTRRKVDWLTDKMRARDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DD+RML DIQKFY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDDRMLQDIQKFY  399

Query  274  NVMIEELPANVADLL  230
            N +IEELP+NVADLL
Sbjct  400  NTVIEELPSNVADLL  414



>ref|XP_004486853.1| PREDICTED: eukaryotic initiation factor 4A-10-like [Cicer arietinum]
Length=412

 Score =   386 bits (991),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 189/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR  DHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFVNTRRKVDWLTDKMRGNDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD RML DIQKFY
Sbjct  338  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTLDDARMLSDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            NV +EELP+NVADLL
Sbjct  398  NVTVEELPSNVADLL  412



>gb|AFK44355.1| unknown [Medicago truncatula]
Length=286

 Score =   381 bits (979),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  92   FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  151

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  152  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  211

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTK+DE ML DIQKFY
Sbjct  212  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKEDEGMLRDIQKFY  271

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVA+L 
Sbjct  272  NVLVEELPSNVAELF  286



>ref|XP_001783934.1| predicted protein [Physcomitrella patens]
 gb|EDQ51244.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   386 bits (991),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPV+ILVKRDELTLEGIKQF+VNVD+EEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVKILVKRDELTLEGIKQFYVNVDREEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIF+NTRRKVDWLTDKMR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFINTRRKVDWLTDKMRARDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTK+DERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKEDERMLQDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            N +IEELP+NVADLL
Sbjct  399  NTVIEELPSNVADLL  413



>gb|AAY33860.1| eukaryotic initiation factor 4A [Cenchrus americanus]
Length=414

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KE+WKL+TLCDLYETLA
Sbjct  220  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDWKLDTLCDLYETLA  279

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  280  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  339

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DD+RM FDIQ+FY
Sbjct  340  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDDRMQFDIQRFY  399

Query  274  NVMIEELPANVADLL  230
            +V+IEELP NVADLL
Sbjct  400  SVVIEELPTNVADLL  414



>ref|XP_009361722.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=868

 Score =   400 bits (1027),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/195 (98%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  674  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  733

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  734  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  793

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY
Sbjct  794  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  853

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  854  NVVVEELPSNVADLL  868



>ref|XP_001765568.1| predicted protein [Physcomitrella patens]
 gb|EDQ69618.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPV+ILVKRDELTLEGIKQF+VNVD+EEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVKILVKRDELTLEGIKQFYVNVDREEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIF+NTRRKVDWLTDKMR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFINTRRKVDWLTDKMRARDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTK+DERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKEDERMLQDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            N ++EELP+NVADLL
Sbjct  399  NTVVEELPSNVADLL  413



>gb|ACJ84369.1| unknown [Medicago truncatula]
Length=242

 Score =   378 bits (971),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  48   FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  107

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  108  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  167

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQV LVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTK+DE ML DIQKFY
Sbjct  168  LARGIDVQQVFLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKEDEGMLRDIQKFY  227

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVA+L 
Sbjct  228  NVLVEELPSNVAELF  242



>gb|EYU45869.1| hypothetical protein MIMGU_mgv1a007331mg [Erythranthe guttata]
Length=410

 Score =   385 bits (988),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KE+WKLETLCDLYETLA
Sbjct  216  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLA  275

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  276  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  335

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGV+INF+T +DE+ML DIQKFY
Sbjct  336  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVSINFLTTEDEKMLGDIQKFY  395

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  396  NVVIEELPSNVADLL  410



>ref|XP_001771324.1| predicted protein [Physcomitrella patens]
 gb|EDQ63884.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   384 bits (987),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPV+ILVKRDELTLEGIKQF+VNVD+EEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVKILVKRDELTLEGIKQFYVNVDREEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIF+NTRRKVDWLTDKMR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFINTRRKVDWLTDKMRARDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DD+RML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDDRMLQDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            N +IEELP+NVADLL
Sbjct  399  NTVIEELPSNVADLL  413



>gb|KEH32495.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=413

 Score =   384 bits (987),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTK+DE ML DIQKFY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKEDEGMLRDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVA+LL
Sbjct  399  NVLVEELPSNVAELL  413



>ref|XP_009403035.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   384 bits (987),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGI+QF+VNV+KEEWKL+TLCDLYE L 
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIRQFYVNVEKEEWKLDTLCDLYEALT  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVL+TTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLVTTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVS+VINYDLPTQPENYLHRIGRSGRFGRKG AINFVT+DDERMLFDIQ+FY
Sbjct  339  LARGIDVQQVSMVINYDLPTQPENYLHRIGRSGRFGRKGSAINFVTRDDERMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADL+
Sbjct  399  NVVIEELPSNVADLI  413



>ref|XP_001691452.1| eukaryotic initiation factor 4A-like protein [Chlamydomonas reinhardtii]
 gb|EDP05185.1| eukaryotic initiation factor 4A-like protein [Chlamydomonas reinhardtii]
Length=413

 Score =   384 bits (986),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSAT+PPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKL+TLCDLYETLA
Sbjct  219  FSATLPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIF NTRRKVDWLTDKMR RDHTVSATHGDMDQNTRD+IMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFANTRRKVDWLTDKMRERDHTVSATHGDMDQNTRDVIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLQDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            N +IEELP+NVADL+
Sbjct  399  NTVIEELPSNVADLI  413



>ref|XP_002514133.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF48087.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=764

 Score =   395 bits (1016),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 188/195 (96%), Positives = 194/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPV+ILVKRDELTLEGIKQFHVNV+KEEWKLETLCDLYETLA
Sbjct  570  FSATMPPEALEITRKFMNKPVKILVKRDELTLEGIKQFHVNVEKEEWKLETLCDLYETLA  629

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  630  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  689

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGR GRFGRKGVAINFVT+DDERMLFDIQKFY
Sbjct  690  LARGIDVQQVSLVINYDLPTQPENYLHRIGRGGRFGRKGVAINFVTRDDERMLFDIQKFY  749

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  750  NVVVEELPSNVADLL  764



>gb|KEH32494.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=430

 Score =   384 bits (987),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  236  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  295

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  296  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  355

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVTK+DE ML DIQKFY
Sbjct  356  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKEDEGMLRDIQKFY  415

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVA+LL
Sbjct  416  NVLVEELPSNVAELL  430



>gb|AAN74636.1| DEAD box RNA helicase [Pisum sativum]
Length=413

 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKL+TLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFV K+DE ML DIQKFY
Sbjct  339  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVNKEDEAMLQDIQKFY  398

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVA+LL
Sbjct  399  NVLVEELPSNVAELL  413



>ref|XP_010656491.1| PREDICTED: uncharacterized protein LOC100244028 [Vitis vinifera]
Length=827

 Score =   395 bits (1015),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/195 (97%), Positives = 195/195 (100%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKEEWKLETLCDLYETLA
Sbjct  633  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEEWKLETLCDLYETLA  692

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  693  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  752

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  753  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  812

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  813  NVVIEELPSNVADLL  827



>ref|XP_009381599.1| PREDICTED: eukaryotic initiation factor 4A-9-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 180/195 (92%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGI QF+VNV+KEEWKLETLCD+YETL 
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGINQFYVNVEKEEWKLETLCDIYETLT  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRD+IMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDVIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVS+VINYDLPTQPENYLHRIGRSGRFGRKG AINFVT DD+RMLFDIQ+FY
Sbjct  339  LARGIDVQQVSMVINYDLPTQPENYLHRIGRSGRFGRKGNAINFVTSDDDRMLFDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+I+ELP+NVADL+
Sbjct  399  NVVIQELPSNVADLI  413



>ref|XP_006858971.1| hypothetical protein AMTR_s00068p00116790 [Amborella trichopoda]
 gb|ERN20438.1| hypothetical protein AMTR_s00068p00116790 [Amborella trichopoda]
Length=286

 Score =   377 bits (968),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV++E++KL+TLCDLYETLA
Sbjct  92   FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVNREDFKLDTLCDLYETLA  151

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDK+RSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  152  ITQSVIFVNTRRKVDWLTDKLRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  211

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT +DERML DIQ+FY
Sbjct  212  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTGEDERMLTDIQRFY  271

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  272  NVVVEELPSNVADLL  286



>ref|XP_002982302.1| hypothetical protein SELMODRAFT_228839 [Selaginella moellendorffii]
 gb|EFJ16547.1| hypothetical protein SELMODRAFT_228839 [Selaginella moellendorffii]
Length=412

 Score =   381 bits (979),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 180/195 (92%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGIKQF+VNV++E+WKL+TLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEREDWKLDTLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIF NTRRKVDWLTDK+RSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFCNTRRKVDWLTDKLRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+TKDDE+MLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFLTKDDEKMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            N +IEELP+NVADL+
Sbjct  398  NTVIEELPSNVADLI  412



>gb|EAZ02256.1| hypothetical protein OsI_24355 [Oryza sativa Indica Group]
Length=426

 Score =   380 bits (976),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 190/195 (97%), Gaps = 4/195 (2%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLE    F+VNV+KEEWKL+TLCDLYETLA
Sbjct  236  FSATMPPEALEITRKFMNKPVRILVKRDELTLE----FYVNVEKEEWKLDTLCDLYETLA  291

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMR RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  292  ITQSVIFVNTRRKVDWLTDKMRGRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  351

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT+DDERMLFDIQ+FY
Sbjct  352  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQRFY  411

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  412  NVVIEELPANVADLL  426



>gb|EPS65096.1| hypothetical protein M569_09681 [Genlisea aurea]
Length=413

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 180/195 (92%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEAL+ITRKFMNKPVRILVKRDELTLEGIKQF+V++ +E++KL+TLCDLYETLA
Sbjct  219  FSATMPPEALDITRKFMNKPVRILVKRDELTLEGIKQFYVDIGREDYKLDTLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRD+IMREFRSGSSRVLITTDL
Sbjct  279  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDVIMREFRSGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF+TKDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFMTKDDERMLADIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELP+NVADLL
Sbjct  399  NVVIEELPSNVADLL  413



>ref|XP_006357714.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic initiation factor 
4A-9-like [Solanum tuberosum]
Length=413

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 183/195 (94%), Positives = 190/195 (97%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNV+KEEWKLETLCDLYETLA
Sbjct  219  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLA  278

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            IT SVIFVNTRRKVD LTD+M+SRDHTVSATHGDMDQNTRDIIM EFR+GSSRVLITTDL
Sbjct  279  ITXSVIFVNTRRKVDLLTDQMQSRDHTVSATHGDMDQNTRDIIMCEFRTGSSRVLITTDL  338

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF TKDDERML DIQ+FY
Sbjct  339  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFATKDDERMLSDIQRFY  398

Query  274  NVMIEELPANVADLL  230
            NV+IEELPANVADLL
Sbjct  399  NVVIEELPANVADLL  413



>ref|XP_002966232.1| hypothetical protein SELMODRAFT_143895 [Selaginella moellendorffii]
 gb|EFJ32259.1| hypothetical protein SELMODRAFT_143895 [Selaginella moellendorffii]
Length=412

 Score =   379 bits (974),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/195 (92%), Positives = 192/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+ PVRILVKRDELTLEGIKQF+VNV++E+WKL+TLCDLYETLA
Sbjct  218  FSATMPPEALEITRKFMSNPVRILVKRDELTLEGIKQFYVNVEREDWKLDTLCDLYETLA  277

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIF NTRRKVDWLTDK+RSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  278  ITQSVIFCNTRRKVDWLTDKLRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  337

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQPENYLHRIGRSGRFGRKGVAINF+TKDDE+MLFDIQKFY
Sbjct  338  LARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFLTKDDEKMLFDIQKFY  397

Query  274  NVMIEELPANVADLL  230
            N +IEELP+NVADL+
Sbjct  398  NTVIEELPSNVADLI  412



>emb|CDY32586.1| BnaC03g15540D [Brassica napus]
Length=378

 Score =   378 bits (970),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGI+QF+V+VDKEEWK ETLCDLYETLA
Sbjct  184  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIRQFYVDVDKEEWKFETLCDLYETLA  243

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLT+KMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  244  ITQSVIFVNTRRKVDWLTEKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  303

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQP NYLHRIGRSGRFGRKG AINFVT+DDE+ML DIQKFY
Sbjct  304  LARGIDVQQVSLVINFDLPTQPANYLHRIGRSGRFGRKGAAINFVTRDDEKMLADIQKFY  363

Query  274  NVMIEELPANVADLL  230
            N+++EELP+N+ADLL
Sbjct  364  NMVVEELPSNLADLL  378



>gb|ABR16834.1| unknown [Picea sitchensis]
Length=286

 Score =   374 bits (961),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMN PVRILVKRDELTLEGIKQF+VNV++E+WKL+TLCDLYETLA
Sbjct  92   FSATMPPEALEITRKFMNNPVRILVKRDELTLEGIKQFYVNVEREDWKLDTLCDLYETLA  151

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIF+NTRRKVD LTD+MR+RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  152  ITQSVIFINTRRKVDMLTDQMRARDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  211

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINF+TKDDERML DIQ+FY
Sbjct  212  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFITKDDERMLQDIQRFY  271

Query  274  NVMIEELPANVADLL  230
            NV++EELP NVADL+
Sbjct  272  NVVVEELPNNVADLI  286



>ref|XP_011470735.1| PREDICTED: eukaryotic initiation factor 4A-9 [Fragaria vesca 
subsp. vesca]
Length=801

 Score =   391 bits (1004),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 193/195 (99%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQF+VNVDKE+WKL+TLCDLYETLA
Sbjct  607  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVDKEDWKLDTLCDLYETLA  666

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQN RDIIMREFRSGSSRVLITTDL
Sbjct  667  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNNRDIIMREFRSGSSRVLITTDL  726

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVT DD+RMLFDIQKFY
Sbjct  727  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTTDDQRMLFDIQKFY  786

Query  274  NVMIEELPANVADLL  230
            NV++EELP+NVADLL
Sbjct  787  NVVVEELPSNVADLL  801



>ref|XP_009132534.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
 ref|XP_009132536.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
 ref|XP_009132537.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
 ref|XP_009132538.1| PREDICTED: eukaryotic initiation factor 4A-1-like [Brassica rapa]
Length=410

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 191/195 (98%), Gaps = 0/195 (0%)
 Frame = -2

Query  814  FSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFHVNVDKEEWKLETLCDLYETLA  635
            FSATMPPEALEITRKFM+KPVRILVKRDELTLEGI+QF+V+VDKEEWK ETLCDLYETLA
Sbjct  216  FSATMPPEALEITRKFMSKPVRILVKRDELTLEGIRQFYVDVDKEEWKFETLCDLYETLA  275

Query  634  ITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  455
            ITQSVIFVNTRRKVDWLT+KMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL
Sbjct  276  ITQSVIFVNTRRKVDWLTEKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDL  335

Query  454  LARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFDIQKFY  275
            LARGIDVQQVSLVIN+DLPTQP NYLHRIGRSGRFGRKG AINFVT+DDE+ML DIQKFY
Sbjct  336  LARGIDVQQVSLVINFDLPTQPANYLHRIGRSGRFGRKGAAINFVTRDDEKMLADIQKFY  395

Query  274  NVMIEELPANVADLL  230
            N+++EELP+N+ADLL
Sbjct  396  NMVVEELPSNLADLL  410



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1646677518220