BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF039A17

Length=816
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009791554.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    170   6e-45   Nicotiana sylvestris
ref|XP_009629393.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    170   9e-45   
ref|XP_010326299.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    164   9e-43   
ref|XP_006356777.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    159   6e-41   Solanum tuberosum [potatoes]
gb|KDP26382.1|  hypothetical protein JCGZ_17540                         135   2e-32   Jatropha curcas
ref|XP_011089094.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    132   9e-32   Sesamum indicum [beniseed]
ref|XP_011089091.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    132   9e-32   Sesamum indicum [beniseed]
gb|EYU39230.1|  hypothetical protein MIMGU_mgv1a025356mg                132   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_006479274.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    131   5e-31   Citrus sinensis [apfelsine]
ref|XP_006479275.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    131   5e-31   Citrus sinensis [apfelsine]
gb|KDO65935.1|  hypothetical protein CISIN_1g007451mg                   131   5e-31   Citrus sinensis [apfelsine]
ref|XP_007049770.1|  Sec14p-like phosphatidylinositol transfer fa...    130   7e-31   
ref|XP_007201785.1|  hypothetical protein PRUPE_ppa004700mg             129   2e-30   
ref|XP_006443597.1|  hypothetical protein CICLE_v10019387mg             129   3e-30   
emb|CDP03879.1|  unnamed protein product                                128   4e-30   Coffea canephora [robusta coffee]
ref|XP_008235472.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    127   2e-29   Prunus mume [ume]
ref|XP_008235473.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    127   2e-29   Prunus mume [ume]
ref|XP_010652519.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    127   2e-29   
ref|XP_002271106.2|  PREDICTED: phosphatidylinositol/phosphatidyl...    126   2e-29   
ref|XP_010652518.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    127   2e-29   Vitis vinifera
ref|XP_010652520.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    126   2e-29   
ref|XP_002521087.1|  transporter, putative                              124   1e-28   
gb|KJB10165.1|  hypothetical protein B456_001G187000                    123   2e-28   Gossypium raimondii
gb|KJB10166.1|  hypothetical protein B456_001G187000                    123   3e-28   Gossypium raimondii
gb|KJB10163.1|  hypothetical protein B456_001G187000                    123   3e-28   Gossypium raimondii
gb|KJB10158.1|  hypothetical protein B456_001G187000                    123   3e-28   Gossypium raimondii
ref|XP_010532892.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    120   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_011024669.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    120   6e-27   Populus euphratica
ref|XP_011089683.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    118   1e-26   
ref|XP_010274040.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    118   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010069651.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    117   2e-26   Eucalyptus grandis [rose gum]
ref|XP_011089682.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    118   4e-26   
ref|XP_010069649.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    117   6e-26   Eucalyptus grandis [rose gum]
ref|XP_002301787.2|  hypothetical protein POPTR_0002s24450g             115   6e-26   
gb|KJB42486.1|  hypothetical protein B456_007G154800                    116   8e-26   Gossypium raimondii
ref|XP_011458184.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    116   8e-26   Fragaria vesca subsp. vesca
ref|XP_004290208.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    116   8e-26   Fragaria vesca subsp. vesca
gb|KJB42481.1|  hypothetical protein B456_007G154800                    116   9e-26   Gossypium raimondii
ref|XP_008458007.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    114   5e-25   Cucumis melo [Oriental melon]
gb|KHF99135.1|  sec14                                                   114   5e-25   Gossypium arboreum [tree cotton]
ref|XP_010527238.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    114   5e-25   Tarenaya hassleriana [spider flower]
ref|XP_010527235.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    114   5e-25   Tarenaya hassleriana [spider flower]
gb|KHF99134.1|  sec14                                                   114   6e-25   Gossypium arboreum [tree cotton]
ref|XP_010909338.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    113   8e-25   Elaeis guineensis
ref|XP_006602514.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    104   3e-24   
ref|XP_008382613.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    112   3e-24   
ref|XP_009334924.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    112   4e-24   Pyrus x bretschneideri [bai li]
ref|XP_008372477.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    111   7e-24   
ref|XP_010685012.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    110   7e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010685011.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    110   7e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008372476.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    111   7e-24   
ref|XP_004514272.1|  PREDICTED: SEC14 cytosolic factor-like isofo...    110   9e-24   Cicer arietinum [garbanzo]
ref|XP_004170020.1|  PREDICTED: SEC14 cytosolic factor-like             108   1e-23   
ref|XP_004514271.1|  PREDICTED: SEC14 cytosolic factor-like isofo...    110   1e-23   Cicer arietinum [garbanzo]
gb|KJB10161.1|  hypothetical protein B456_001G187000                    109   2e-23   Gossypium raimondii
gb|KGN44595.1|  hypothetical protein Csa_7G339670                       108   3e-23   Cucumis sativus [cucumbers]
ref|XP_004139710.1|  PREDICTED: SEC14 cytosolic factor-like             108   3e-23   
emb|CDY52084.1|  BnaCnng21850D                                          108   6e-23   Brassica napus [oilseed rape]
ref|XP_009102455.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    107   8e-23   Brassica rapa
emb|CDX77382.1|  BnaA07g05200D                                          107   9e-23   
ref|XP_009102454.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    107   9e-23   Brassica rapa
ref|XP_006602516.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    106   3e-22   
ref|XP_006602515.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    106   3e-22   
ref|XP_007140607.1|  hypothetical protein PHAVU_008G126500g             106   3e-22   Phaseolus vulgaris [French bean]
ref|XP_009371669.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    106   3e-22   Pyrus x bretschneideri [bai li]
ref|XP_006586246.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    105   4e-22   
gb|KHN30510.1|  Sec14 cytosolic factor                                  105   4e-22   Glycine soja [wild soybean]
gb|KJB42484.1|  hypothetical protein B456_007G154800                    105   5e-22   Gossypium raimondii
gb|KEH22719.1|  Sec14p-like phosphatidylinositol transfer family ...    104   5e-22   Medicago truncatula
gb|KJB42479.1|  hypothetical protein B456_007G154800                    105   7e-22   Gossypium raimondii
ref|XP_010466921.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    103   8e-22   Camelina sativa [gold-of-pleasure]
gb|KEH22715.1|  Sec14p-like phosphatidylinositol transfer family ...    104   1e-21   Medicago truncatula
gb|KEH22717.1|  Sec14p-like phosphatidylinositol transfer family ...    104   1e-21   Medicago truncatula
ref|XP_006299363.1|  hypothetical protein CARUB_v10015522mg             104   1e-21   Capsella rubella
ref|XP_010466920.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    104   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010466919.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    103   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_008778054.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    101   5e-21   
gb|KHF98890.1|  Sec14 cytosolic factor                                  102   5e-21   Gossypium arboreum [tree cotton]
ref|NP_189128.2|  Sec14p-like phosphatidylinositol transfer famil...    102   9e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488600.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    101   1e-20   
ref|XP_010488597.1|  PREDICTED: phosphatidylinositol/phosphatidyl...    101   1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010110066.1|  hypothetical protein L484_003046                 97.8    3e-19   
ref|XP_002883566.1|  hypothetical protein ARALYDRAFT_480002           97.4    3e-19   
ref|XP_006418684.1|  hypothetical protein EUTSA_v10002458mg           95.1    2e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010928204.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  92.0    2e-17   Elaeis guineensis
ref|XP_010928201.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  92.0    2e-17   Elaeis guineensis
ref|XP_006840163.1|  hypothetical protein AMTR_s00089p00079320        92.0    2e-17   
dbj|BAB02894.1|  phosphatidylinositol/phosphatidylcholine transfe...  90.9    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106836.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  90.5    6e-17   Brassica rapa
ref|XP_010913311.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  90.5    6e-17   
ref|XP_009106835.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  90.5    6e-17   Brassica rapa
ref|XP_008796544.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  90.1    7e-17   
ref|XP_008796540.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  90.1    1e-16   
emb|CDY10540.1|  BnaC03g70740D                                        89.4    2e-16   Brassica napus [oilseed rape]
gb|KEH22718.1|  Sec14p-like phosphatidylinositol transfer family ...  88.6    3e-16   Medicago truncatula
gb|KEH22716.1|  Sec14p-like phosphatidylinositol transfer family ...  88.6    3e-16   Medicago truncatula
ref|XP_010552329.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  88.6    3e-16   Tarenaya hassleriana [spider flower]
ref|XP_009415954.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  87.8    5e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415562.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  86.7    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415563.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  86.7    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009147486.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  86.3    1e-15   Brassica rapa
ref|XP_009415564.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  86.7    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009415561.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  86.7    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794691.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  86.3    2e-15   Phoenix dactylifera
ref|XP_008794692.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  86.3    2e-15   Phoenix dactylifera
ref|XP_008794690.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  86.3    2e-15   Phoenix dactylifera
ref|XP_008794693.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  86.3    2e-15   Phoenix dactylifera
ref|XP_006392611.1|  hypothetical protein EUTSA_v10011321mg           86.3    2e-15   
emb|CDY50018.1|  BnaA06g00190D                                        85.9    2e-15   Brassica napus [oilseed rape]
ref|XP_010914011.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  85.9    2e-15   Elaeis guineensis
ref|XP_010914005.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  85.9    2e-15   Elaeis guineensis
ref|XP_010914012.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  85.5    2e-15   Elaeis guineensis
ref|XP_008384630.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  85.5    3e-15   
ref|XP_009346685.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  85.5    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_008384631.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  85.5    3e-15   
ref|XP_008353890.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  85.5    3e-15   
ref|NP_001168110.1|  uncharacterized protein LOC100381849             80.9    5e-15   
ref|XP_009379116.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  84.3    7e-15   Pyrus x bretschneideri [bai li]
ref|XP_006857582.1|  hypothetical protein AMTR_s00061p00081010        79.3    7e-15   
gb|KCW68333.1|  hypothetical protein EUGRSUZ_F01995                   84.3    8e-15   Eucalyptus grandis [rose gum]
ref|XP_006474768.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  84.0    8e-15   Citrus sinensis [apfelsine]
gb|KDO73983.1|  hypothetical protein CISIN_1g007116mg                 84.0    9e-15   Citrus sinensis [apfelsine]
ref|XP_008796543.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  84.0    1e-14   Phoenix dactylifera
ref|XP_009391899.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  84.0    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007020322.1|  Sec14p-like phosphatidylinositol transfer fa...  83.6    1e-14   
emb|CDY51073.1|  BnaC06g07500D                                        83.2    1e-14   Brassica napus [oilseed rape]
ref|XP_010534824.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  83.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_008805533.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  83.6    1e-14   Phoenix dactylifera
ref|XP_008805530.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  83.6    1e-14   Phoenix dactylifera
ref|XP_010534825.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  83.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_008219183.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  83.2    1e-14   Prunus mume [ume]
ref|XP_004294878.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  82.8    2e-14   Fragaria vesca subsp. vesca
ref|XP_010252910.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  82.8    2e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010236016.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  82.8    2e-14   Brachypodium distachyon [annual false brome]
ref|XP_010236015.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  82.8    2e-14   Brachypodium distachyon [annual false brome]
ref|XP_002468412.1|  hypothetical protein SORBIDRAFT_01g045510        82.4    3e-14   
gb|KHN01503.1|  Sec14 cytosolic factor                                82.8    3e-14   Glycine soja [wild soybean]
ref|XP_009390614.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  82.4    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009620229.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  82.4    3e-14   Nicotiana tomentosiformis
ref|XP_009793720.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  82.0    3e-14   Nicotiana sylvestris
ref|XP_009793719.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  82.0    4e-14   Nicotiana sylvestris
ref|XP_004953732.1|  PREDICTED: uncharacterized protein LOC101764...  82.0    4e-14   
ref|XP_004953731.1|  PREDICTED: uncharacterized protein LOC101764...  82.0    4e-14   
ref|XP_010061396.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  81.6    5e-14   Eucalyptus grandis [rose gum]
ref|XP_010061395.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  81.6    5e-14   
ref|XP_004156352.1|  PREDICTED: uncharacterized protein LOC101229964  81.6    6e-14   
ref|XP_004139763.1|  PREDICTED: uncharacterized protein LOC101217583  81.6    6e-14   Cucumis sativus [cucumbers]
ref|XP_006452761.1|  hypothetical protein CICLE_v10010160mg           81.6    6e-14   
ref|XP_008219175.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  81.6    6e-14   Prunus mume [ume]
ref|XP_008447798.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  81.3    6e-14   Cucumis melo [Oriental melon]
gb|KJB81514.1|  hypothetical protein B456_013G148400                  81.3    7e-14   Gossypium raimondii
ref|NP_001047963.1|  Os02g0721800                                     81.3    8e-14   
gb|KHF99754.1|  SEC14 cytosolic factor                                80.9    8e-14   Gossypium arboreum [tree cotton]
gb|KJB81518.1|  hypothetical protein B456_013G148400                  81.3    8e-14   Gossypium raimondii
ref|XP_008643964.1|  PREDICTED: uncharacterized protein LOC100381...  80.9    8e-14   
gb|KJB81516.1|  hypothetical protein B456_013G148400                  80.9    8e-14   Gossypium raimondii
ref|XP_008643963.1|  PREDICTED: uncharacterized protein LOC100381...  80.9    8e-14   Zea mays [maize]
ref|XP_006647810.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  80.9    8e-14   Oryza brachyantha
gb|KHN20565.1|  SEC14 cytosolic factor                                80.9    9e-14   Glycine soja [wild soybean]
ref|XP_004973243.1|  PREDICTED: uncharacterized protein LOC101786...  80.9    9e-14   Setaria italica
ref|XP_010481194.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  77.8    9e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003526390.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  80.9    1e-13   Glycine max [soybeans]
ref|XP_004973242.1|  PREDICTED: uncharacterized protein LOC101786...  80.9    1e-13   Setaria italica
ref|XP_002531776.1|  transporter, putative                            80.9    1e-13   
ref|XP_007208038.1|  hypothetical protein PRUPE_ppa002925mg           80.9    1e-13   Prunus persica
ref|NP_001061591.1|  Os08g0341700                                     80.9    1e-13   
ref|XP_002268040.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  80.5    1e-13   Vitis vinifera
gb|EEC83416.1|  hypothetical protein OsI_28876                        80.5    1e-13   Oryza sativa Indica Group [Indian rice]
gb|EEE68525.1|  hypothetical protein OsJ_26967                        80.1    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007148649.1|  hypothetical protein PHAVU_005G003600g           80.1    2e-13   Phaseolus vulgaris [French bean]
ref|XP_002894519.1|  SEC14 cytosolic factor family protein            80.1    2e-13   
gb|KJB42480.1|  hypothetical protein B456_007G154800                  79.7    2e-13   Gossypium raimondii
gb|EMS55272.1|  Sec14 cytosolic factor                                79.7    2e-13   Triticum urartu
gb|KJB42483.1|  hypothetical protein B456_007G154800                  79.3    2e-13   Gossypium raimondii
ref|XP_006659343.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  79.7    2e-13   Oryza brachyantha
ref|XP_002452636.1|  hypothetical protein SORBIDRAFT_04g029580        79.3    3e-13   Sorghum bicolor [broomcorn]
ref|XP_010501188.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  79.3    3e-13   
ref|XP_004244003.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  79.0    3e-13   Solanum lycopersicum
gb|AAF79506.1|AC002328_14  F20N2.11                                   79.0    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009390610.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  79.0    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010480110.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  79.0    4e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010462424.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  79.0    4e-13   Camelina sativa [gold-of-pleasure]
ref|NP_849815.1|  Sec14p-like phosphatidylinositol transfer famil...  79.0    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010462425.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  79.0    4e-13   Camelina sativa [gold-of-pleasure]
ref|NP_175965.2|  Sec14p-like phosphatidylinositol transfer famil...  78.6    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001131503.1|  uncharacterized protein LOC100192840             77.0    5e-13   
ref|XP_006346082.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  78.2    7e-13   Solanum tuberosum [potatoes]
gb|KDP36319.1|  hypothetical protein JCGZ_09534                       78.2    8e-13   Jatropha curcas
ref|XP_009399525.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  78.2    8e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395896.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  77.8    8e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT15866.1|  hypothetical protein F775_32793                       77.8    9e-13   
ref|XP_009395894.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  77.8    9e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395892.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  77.8    9e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE57707.1|  hypothetical protein OsJ_08188                        77.8    9e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009405089.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  77.4    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407911.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  77.4    1e-12   
ref|XP_009407913.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  77.4    1e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407912.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  77.4    1e-12   
gb|EEC73905.1|  hypothetical protein OsI_08738                        77.8    1e-12   Oryza sativa Indica Group [Indian rice]
gb|KJB10160.1|  hypothetical protein B456_001G187000                  77.4    1e-12   Gossypium raimondii
gb|EYU33746.1|  hypothetical protein MIMGU_mgv1a002979mg              77.4    1e-12   Erythranthe guttata [common monkey flower]
ref|XP_011000369.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  77.0    1e-12   Populus euphratica
ref|XP_006307003.1|  hypothetical protein CARUB_v10008581mg           77.0    1e-12   Capsella rubella
ref|XP_011000368.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  77.0    2e-12   Populus euphratica
ref|XP_008676497.1|  PREDICTED: uncharacterized protein LOC100192...  77.0    2e-12   Zea mays [maize]
gb|EYU27505.1|  hypothetical protein MIMGU_mgv1a003158mg              76.6    2e-12   Erythranthe guttata [common monkey flower]
ref|XP_008676494.1|  PREDICTED: uncharacterized protein LOC100192...  77.0    2e-12   
ref|XP_010092396.1|  hypothetical protein L484_023775                 77.0    2e-12   
gb|AFW61940.1|  putative CRAL/TRIO domain containing, Sec14p-like...  76.6    2e-12   
dbj|BAK04393.1|  predicted protein                                    76.3    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003573800.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  76.3    3e-12   Brachypodium distachyon [annual false brome]
dbj|BAJ96309.1|  predicted protein                                    76.3    3e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010234637.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  76.3    3e-12   Brachypodium distachyon [annual false brome]
gb|EMS45796.1|  hypothetical protein TRIUR3_25550                     75.9    4e-12   Triticum urartu
ref|XP_006378002.1|  SEC14 cytosolic factor family protein            75.9    4e-12   
ref|XP_006599218.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  75.9    4e-12   Glycine max [soybeans]
gb|KHN10116.1|  Sec14 cytosolic factor                                75.5    5e-12   Glycine soja [wild soybean]
gb|KEH20296.1|  Sec14p-like phosphatidylinositol transfer family ...  74.7    9e-12   Medicago truncatula
emb|CDP13647.1|  unnamed protein product                              74.7    9e-12   Coffea canephora [robusta coffee]
ref|XP_006659538.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  73.9    2e-11   Oryza brachyantha
gb|EMS66418.1|  hypothetical protein TRIUR3_29583                     72.8    5e-11   Triticum urartu
ref|XP_011097694.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  72.0    7e-11   Sesamum indicum [beniseed]
gb|EMT12573.1|  hypothetical protein F775_09187                       71.2    1e-10   
ref|XP_006352563.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  71.2    1e-10   Solanum tuberosum [potatoes]
ref|XP_006352564.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  71.2    1e-10   
ref|XP_006352565.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  71.2    1e-10   
gb|KJB81517.1|  hypothetical protein B456_013G148400                  71.2    1e-10   Gossypium raimondii
ref|XP_003598312.1|  SEC14 cytosolic factor                           70.9    2e-10   
ref|XP_006392610.1|  hypothetical protein EUTSA_v10011321mg           70.5    2e-10   
gb|EEC83813.1|  hypothetical protein OsI_29745                        69.7    3e-10   Oryza sativa Indica Group [Indian rice]
gb|EEE68935.1|  hypothetical protein OsJ_27809                        69.7    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062139.1|  Os08g0497300                                     69.7    4e-10   
dbj|BAJ98447.1|  predicted protein                                    69.3    5e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010327215.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.9    7e-10   
ref|XP_010327218.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.9    7e-10   Solanum lycopersicum
ref|XP_006660747.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  68.9    8e-10   
emb|CAJ75628.1|  SEC14 cytosolic factor (secretion factor 14) fam...  64.7    2e-09   Brachypodium sylvaticum
ref|XP_004962618.1|  PREDICTED: SEC14 cytosolic factor-like           65.9    7e-09   Setaria italica
ref|XP_011095638.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  65.5    9e-09   Sesamum indicum [beniseed]
gb|EAZ45138.1|  hypothetical protein OsJ_29776                        65.5    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84766.1|  hypothetical protein OsI_31788                        65.5    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_011095639.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  65.5    1e-08   Sesamum indicum [beniseed]
ref|NP_001063492.1|  Os09g0481100                                     65.1    1e-08   
ref|XP_007156281.1|  hypothetical protein PHAVU_003G273400g           65.1    1e-08   Phaseolus vulgaris [French bean]
ref|XP_010235277.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  63.5    4e-08   Brachypodium distachyon [annual false brome]
ref|XP_010235275.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  63.5    4e-08   Brachypodium distachyon [annual false brome]
ref|XP_002299075.2|  hypothetical protein POPTR_0001s47530g           63.5    4e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010536782.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  63.5    5e-08   Tarenaya hassleriana [spider flower]
ref|XP_010536783.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  63.2    5e-08   Tarenaya hassleriana [spider flower]
ref|XP_004973803.1|  PREDICTED: uncharacterized protein LOC101785...  63.2    7e-08   Setaria italica
ref|NP_001151490.1|  LOC100285123                                     62.8    9e-08   
ref|XP_002445947.1|  hypothetical protein SORBIDRAFT_07g028560        62.4    1e-07   Sorghum bicolor [broomcorn]
ref|NP_001146170.1|  uncharacterized protein LOC100279739             62.4    1e-07   Zea mays [maize]
ref|XP_008672836.1|  PREDICTED: uncharacterized protein LOC100279...  62.4    1e-07   Zea mays [maize]
ref|XP_002460425.1|  hypothetical protein SORBIDRAFT_02g027880        62.0    1e-07   Sorghum bicolor [broomcorn]
ref|XP_011039869.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  62.0    1e-07   Populus euphratica
ref|XP_008668115.1|  PREDICTED: LOC100285123 isoform X1               62.0    2e-07   
gb|ABR17997.1|  unknown                                               62.0    2e-07   Picea sitchensis
gb|AFW61941.1|  putative CRAL/TRIO domain containing, Sec14p-like...  60.5    5e-07   
ref|XP_004957140.1|  PREDICTED: SEC14-like protein 3-like             60.5    6e-07   Setaria italica
ref|XP_008677111.1|  PREDICTED: putative CRAL/TRIO domain contain...  59.7    8e-07   Zea mays [maize]
ref|XP_008677110.1|  PREDICTED: putative CRAL/TRIO domain contain...  59.7    8e-07   Zea mays [maize]
gb|AFW65156.1|  putative CRAL/TRIO domain containing, Sec14p-like...  59.7    8e-07   
ref|XP_008677109.1|  PREDICTED: putative CRAL/TRIO domain contain...  59.7    9e-07   Zea mays [maize]
ref|XP_010244809.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  59.7    9e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008677108.1|  PREDICTED: putative CRAL/TRIO domain contain...  59.7    1e-06   Zea mays [maize]
ref|XP_010244807.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  59.7    1e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010244808.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  59.7    1e-06   Nelumbo nucifera [Indian lotus]
gb|AFW65157.1|  putative CRAL/TRIO domain containing, Sec14p-like...  59.7    1e-06   
ref|XP_008460966.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  59.3    1e-06   Cucumis melo [Oriental melon]
ref|XP_004953728.1|  PREDICTED: uncharacterized protein LOC101764...  58.5    2e-06   
ref|XP_004953730.1|  PREDICTED: uncharacterized protein LOC101764...  58.5    2e-06   
ref|XP_002512943.1|  phosphatidylinositol transporter, putative       58.5    2e-06   Ricinus communis
gb|EMT02120.1|  hypothetical protein F775_21797                       57.8    4e-06   
ref|XP_006401370.1|  hypothetical protein EUTSA_v10015685mg           57.8    4e-06   
ref|XP_011039871.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  57.4    6e-06   Populus euphratica
ref|XP_010450723.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  57.0    8e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010922737.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.8    2e-05   Elaeis guineensis
ref|XP_010068556.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.8    2e-05   
ref|XP_010922752.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.8    2e-05   
ref|XP_010443256.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.8    2e-05   
ref|XP_010110037.1|  Sec14 cytosolic factor                           55.8    2e-05   
gb|KCW63963.1|  hypothetical protein EUGRSUZ_G01643                   55.8    2e-05   
ref|XP_006281580.1|  hypothetical protein CARUB_v10027692mg           55.8    2e-05   
ref|XP_010443259.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.8    2e-05   
ref|XP_010443258.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.8    2e-05   
gb|KJB47528.1|  hypothetical protein B456_008G030400                  55.8    2e-05   
ref|XP_010443261.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.8    2e-05   
gb|KJB47523.1|  hypothetical protein B456_008G030400                  55.8    2e-05   
ref|XP_008811091.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.5    2e-05   
ref|XP_004169138.1|  PREDICTED: uncharacterized LOC101208172          55.1    3e-05   
gb|KCW63964.1|  hypothetical protein EUGRSUZ_G01643                   54.7    3e-05   
ref|XP_010548310.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.1    3e-05   
ref|XP_010548313.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  55.1    3e-05   
ref|XP_010526772.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  54.7    4e-05   
ref|XP_004148831.1|  PREDICTED: uncharacterized protein LOC101208172  55.1    4e-05   
gb|KHG03196.1|  Sec14 cytosolic factor                                54.7    4e-05   
ref|XP_003527164.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  54.7    4e-05   
gb|KHN20049.1|  Sec14 cytosolic factor                                54.7    4e-05   
ref|XP_002864438.1|  predicted protein                                54.3    5e-05   
ref|XP_006365289.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  54.3    5e-05   
dbj|BAE98820.1|  hypothetical protein                                 54.3    5e-05   
ref|XP_009600124.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  54.3    5e-05   
ref|NP_200427.3|  sec14p-like phosphatidylinositol transfer-like ...  54.3    5e-05   
ref|XP_006487243.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  54.3    5e-05   
ref|XP_011088434.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.9    8e-05   
ref|XP_002283681.2|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.9    8e-05   
ref|XP_010645229.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.9    8e-05   
ref|XP_010690840.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.9    8e-05   
gb|KDP41761.1|  hypothetical protein JCGZ_26779                       53.5    9e-05   
gb|KFK27197.1|  hypothetical protein AALP_AA8G348100                  53.5    1e-04   
ref|XP_004500794.1|  PREDICTED: uncharacterized protein LOC101488984  53.5    1e-04   
ref|XP_011025854.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.1    1e-04   
ref|XP_011025853.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.1    1e-04   
ref|XP_006581198.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.1    1e-04   
gb|KFK27196.1|  hypothetical protein AALP_AA8G348100                  53.1    1e-04   
gb|KDO47887.1|  hypothetical protein CISIN_1g006449mg                 53.1    1e-04   
gb|KDO47885.1|  hypothetical protein CISIN_1g006449mg                 53.1    1e-04   
ref|XP_006435044.1|  hypothetical protein CICLE_v10000827mg           53.1    1e-04   
ref|XP_009765680.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  53.1    1e-04   
gb|KDO47892.1|  hypothetical protein CISIN_1g006449mg                 53.1    1e-04   
ref|XP_002310267.2|  phosphatidylinositol transfer-like protein II    53.1    1e-04   
ref|XP_006423355.1|  hypothetical protein CICLE_v10028023mg           53.1    1e-04   
ref|XP_006423354.1|  hypothetical protein CICLE_v10028023mg           53.1    1e-04   
gb|KDO47890.1|  hypothetical protein CISIN_1g006449mg                 53.1    1e-04   
gb|KDO47891.1|  hypothetical protein CISIN_1g006449mg                 53.1    2e-04   
gb|KDO47896.1|  hypothetical protein CISIN_1g006449mg                 52.8    2e-04   
ref|XP_006423353.1|  hypothetical protein CICLE_v10028023mg           52.8    2e-04   
ref|XP_010327557.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.8    2e-04   
ref|XP_011457708.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.8    2e-04   
ref|XP_004289639.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.8    2e-04   
ref|XP_011457707.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.8    2e-04   
ref|XP_011457706.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.8    2e-04   
ref|XP_009418458.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.8    2e-04   
dbj|BAB09298.1|  unnamed protein product                              52.4    2e-04   
ref|XP_010936680.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.4    2e-04   
ref|XP_010936679.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.4    2e-04   
ref|XP_004291849.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.4    2e-04   
ref|XP_007042117.1|  Sec14p-like phosphatidylinositol transfer fa...  52.4    3e-04   
emb|CDY17397.1|  BnaA10g10310D                                        52.0    3e-04   
ref|XP_009120130.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.0    3e-04   
gb|KDO84631.1|  hypothetical protein CISIN_1g006989mg                 52.0    3e-04   
ref|XP_006473545.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.0    3e-04   
ref|XP_009781459.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  51.6    4e-04   
ref|XP_009781458.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  52.0    4e-04   
gb|EYU42601.1|  hypothetical protein MIMGU_mgv1a003028mg              52.0    4e-04   
ref|XP_007135956.1|  hypothetical protein PHAVU_009G006000g           51.6    4e-04   
ref|XP_006383162.1|  hypothetical protein POPTR_0005s12160g           51.6    4e-04   
ref|XP_003522898.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  51.6    4e-04   
ref|XP_007135957.1|  hypothetical protein PHAVU_009G006000g           51.6    5e-04   
gb|EYU42604.1|  hypothetical protein MIMGU_mgv1a005833mg              51.2    6e-04   
gb|KDO47897.1|  hypothetical protein CISIN_1g008520mg                 51.2    6e-04   
ref|XP_002866832.1|  hypothetical protein ARALYDRAFT_912374           51.2    6e-04   
gb|EYU37816.1|  hypothetical protein MIMGU_mgv1a003774mg              51.2    6e-04   
gb|KDP25703.1|  hypothetical protein JCGZ_24004                       50.8    7e-04   
gb|KJB79148.1|  hypothetical protein B456_013G035300                  50.8    7e-04   
ref|XP_006487242.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  50.8    7e-04   
gb|KJB79151.1|  hypothetical protein B456_013G035300                  50.8    8e-04   
ref|XP_003603968.1|  Sec14 cytosolic factor                           50.8    8e-04   
ref|XP_006411719.1|  hypothetical protein EUTSA_v10024693mg           50.8    9e-04   
gb|AAK63247.1|AF367433_1  phosphatidylinositol transfer-like prot...  50.8    9e-04   
ref|XP_006423352.1|  hypothetical protein CICLE_v10030083mg           50.8    9e-04   
ref|XP_011028447.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  50.4    9e-04   
gb|KJB79152.1|  hypothetical protein B456_013G035300                  50.4    9e-04   
ref|XP_009416960.1|  PREDICTED: phosphatidylinositol/phosphatidyl...  50.4    0.001   



>ref|XP_009791554.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 [Nicotiana sylvestris]
Length=594

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 106/140 (76%), Gaps = 3/140 (2%)
 Frame = -1

Query  783  YTFFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEK  604
            Y  FR  +G + V+NN      + QRL++   S  EQ +SSPKK DLLHPCC+RLQ LE+
Sbjct  458  YFLFRG-VGRLFVKNNDANRFGSGQRLVSA--SSAEQIVSSPKKEDLLHPCCQRLQHLEE  514

Query  603  AVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKE  424
             VA+LL KPT+IPPEKD MLLDSM+RIK IE+DLQRT+KALLATASQQVELAESLE LKE
Sbjct  515  VVADLLKKPTKIPPEKDLMLLDSMDRIKFIEYDLQRTKKALLATASQQVELAESLESLKE  574

Query  423  DTLKGTKSCWLRTKSTPCRT  364
            +  K T SCWLR K +  RT
Sbjct  575  NKFKATNSCWLRGKPSQYRT  594



>ref|XP_009629393.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 [Nicotiana tomentosiformis]
 ref|XP_009629463.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 [Nicotiana tomentosiformis]
 ref|XP_009629526.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 [Nicotiana tomentosiformis]
Length=594

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 105/140 (75%), Gaps = 3/140 (2%)
 Frame = -1

Query  783  YTFFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEK  604
            Y  FR  +G + V+NN      N QR ++   S  EQ +SSPKK DLLHPCC+RLQ LE+
Sbjct  458  YFLFRG-VGRLFVKNNDANRFGNGQRSVSA--SSAEQIVSSPKKEDLLHPCCQRLQHLEE  514

Query  603  AVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKE  424
             VA+LL KPT+IPPEKD MLLDSM+RIK IE+DLQRT+KALLATASQQVELAESLE LKE
Sbjct  515  VVADLLKKPTKIPPEKDLMLLDSMDRIKFIEYDLQRTKKALLATASQQVELAESLESLKE  574

Query  423  DTLKGTKSCWLRTKSTPCRT  364
            +  K T SCWLR K +  RT
Sbjct  575  NKFKATNSCWLRGKPSQYRT  594



>ref|XP_010326299.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 [Solanum lycopersicum]
Length=593

 Score =   164 bits (415),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 106/138 (77%), Gaps = 2/138 (1%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAV  598
            F  + +G + V+N+    S N +  ++ + S  EQN+SSPKK DLLHPCC+RLQ LE  V
Sbjct  458  FLFHGVGRLFVKNSDANRSRNGR--VSVNASSVEQNVSSPKKEDLLHPCCQRLQHLENVV  515

Query  597  AELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDT  418
            A+LL KPT+IPPEK+HMLLDSM+RIK IE+DLQRT+KALLATASQQVELAES+E LKE+ 
Sbjct  516  ADLLKKPTKIPPEKEHMLLDSMDRIKFIEYDLQRTKKALLATASQQVELAESMESLKENK  575

Query  417  LKGTKSCWLRTKSTPCRT  364
            LK T SCW R + +  +T
Sbjct  576  LKVTNSCWRRGRPSQYKT  593



>ref|XP_006356777.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Solanum tuberosum]
 ref|XP_006356778.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X2 [Solanum tuberosum]
Length=593

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 105/139 (76%), Gaps = 4/139 (3%)
 Frame = -1

Query  777  FFRNRIGGVCVRN-NLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKA  601
            F  + +G + V+N + NR  +     ++ + S  EQN+SSPKK DLLHPCC+RLQ LE  
Sbjct  458  FLFHGVGRLFVKNSDANRLRNGR---VSVNASSAEQNVSSPKKEDLLHPCCQRLQHLENV  514

Query  600  VAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKED  421
            VA+LL KPT+IPPEK+ MLLDSM+RIK IE+DLQRT+KALLATASQQVELAES+E LKE+
Sbjct  515  VADLLKKPTKIPPEKELMLLDSMDRIKFIEYDLQRTKKALLATASQQVELAESMESLKEN  574

Query  420  TLKGTKSCWLRTKSTPCRT  364
             LK T SCW R + +  +T
Sbjct  575  KLKVTNSCWRRGRPSQYKT  593



>gb|KDP26382.1| hypothetical protein JCGZ_17540 [Jatropha curcas]
Length=597

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -1

Query  765  RIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELL  586
            R+G V       R   ++  L   D + QEQ+I    K +++HPC +RLQ LE  V EL+
Sbjct  463  RMGRVFTSRRTERPLPSQPNLPLADSTSQEQHIPRETKEEIVHPCFQRLQNLEAMVNELV  522

Query  585  NKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGT  406
            NKPT+IPPEK+ MLL+S++RI+SIE+DLQ+T+KALLATAS+QVELAESLE LKE  L G 
Sbjct  523  NKPTKIPPEKEDMLLESLSRIRSIEYDLQKTKKALLATASKQVELAESLENLKESALAGV  582

Query  405  KSCWLR  388
             SCW R
Sbjct  583  NSCWPR  588



>ref|XP_011089094.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X2 [Sesamum indicum]
Length=567

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -1

Query  711  QRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSM  532
            +R   P+ + QE++ +     +LLHPCC++LQ LEK V ELL KP +IPPEKD +LL+S+
Sbjct  461  RRTDFPNSNSQEEHYTRANTEELLHPCCQKLQHLEKLVTELLKKPAKIPPEKDDILLESL  520

Query  531  NRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCW  394
            NRIKSIEHDLQ+T+KALLATAS+QVEL ES+E LK   LKG+ SCW
Sbjct  521  NRIKSIEHDLQKTKKALLATASKQVELCESMETLKGINLKGSNSCW  566



>ref|XP_011089091.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X1 [Sesamum indicum]
 ref|XP_011089092.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X1 [Sesamum indicum]
 ref|XP_011089093.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X1 [Sesamum indicum]
Length=574

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -1

Query  711  QRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSM  532
            +R   P+ + QE++ +     +LLHPCC++LQ LEK V ELL KP +IPPEKD +LL+S+
Sbjct  468  RRTDFPNSNSQEEHYTRANTEELLHPCCQKLQHLEKLVTELLKKPAKIPPEKDDILLESL  527

Query  531  NRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCW  394
            NRIKSIEHDLQ+T+KALLATAS+QVEL ES+E LK   LKG+ SCW
Sbjct  528  NRIKSIEHDLQKTKKALLATASKQVELCESMETLKGINLKGSNSCW  573



>gb|EYU39230.1| hypothetical protein MIMGU_mgv1a025356mg [Erythranthe guttata]
Length=454

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 87/109 (80%), Gaps = 2/109 (2%)
 Frame = -1

Query  687  SPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEH  508
            SP EQ   S  + +LLHPCC++LQ LE  V EL  KP +IPPEKD +LL+SM+RIKSIE+
Sbjct  347  SPDEQKTRSNTE-ELLHPCCKKLQHLEDLVTELCKKPAKIPPEKDDILLESMSRIKSIEY  405

Query  507  DLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLR-TKSTPCRT  364
            DLQ+T+KALLATAS+QVEL+ESL+ LKE  LK ++SCWLR +KS P RT
Sbjct  406  DLQKTKKALLATASKQVELSESLDTLKEIKLKASRSCWLRSSKSLPRRT  454



>ref|XP_006479274.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Citrus sinensis]
Length=604

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  762  IGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLN  583
            + G+ V  +  +  +N+ +   P  S QEQ+IS   +    HPC ERLQ+LE+ V +L+N
Sbjct  469  LKGLFVAQHSCKKLENQTKSPLPCTSSQEQSISQAVENQSFHPCWERLQRLEELVTDLVN  528

Query  582  KPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTK  403
            KP  IPPEK+ MLL+S++RIKSIEHDLQRT+KALLATAS+QVELAESLE LKE+++    
Sbjct  529  KPKRIPPEKEDMLLESLSRIKSIEHDLQRTKKALLATASKQVELAESLEQLKENSIPVAS  588

Query  402  SCWLRTK  382
            +CW R +
Sbjct  589  ACWPRNR  595



>ref|XP_006479275.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X2 [Citrus sinensis]
Length=603

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  762  IGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLN  583
            + G+ V  +  +  +N+ +   P  S QEQ+IS   +    HPC ERLQ+LE+ V +L+N
Sbjct  468  LKGLFVAQHSCKKLENQTKSPLPCTSSQEQSISQAVENQSFHPCWERLQRLEELVTDLVN  527

Query  582  KPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTK  403
            KP  IPPEK+ MLL+S++RIKSIEHDLQRT+KALLATAS+QVELAESLE LKE+++    
Sbjct  528  KPKRIPPEKEDMLLESLSRIKSIEHDLQRTKKALLATASKQVELAESLEQLKENSIPVAS  587

Query  402  SCWLRTK  382
            +CW R +
Sbjct  588  ACWPRNR  594



>gb|KDO65935.1| hypothetical protein CISIN_1g007451mg [Citrus sinensis]
Length=603

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = -1

Query  762  IGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLN  583
            + G+ V  +  +  +N+ +   P  S QEQ+IS   +    HPC ERLQ+LE+ V +L+N
Sbjct  468  LKGLFVAQHSCKKLENQTKSPLPCTSSQEQSISQAVENQSFHPCWERLQRLEELVTDLVN  527

Query  582  KPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTK  403
            KP  IPPEK+ MLL+S++RIKSIEHDLQRT+KALLATAS+QVELAESLE LKE+++    
Sbjct  528  KPKRIPPEKEDMLLESLSRIKSIEHDLQRTKKALLATASKQVELAESLEQLKENSIPVAS  587

Query  402  SCWLRTK  382
            +CW R +
Sbjct  588  ACWPRNR  594



>ref|XP_007049770.1| Sec14p-like phosphatidylinositol transfer family protein [Theobroma 
cacao]
 gb|EOX93927.1| Sec14p-like phosphatidylinositol transfer family protein [Theobroma 
cacao]
Length=602

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D LHPC +RLQ LE  V EL NKPT+IPPEK+ MLL+S+NRIKSIE DLQRT+KALLATA
Sbjct  507  DSLHPCWQRLQHLETLVTELYNKPTKIPPEKEDMLLESLNRIKSIEQDLQRTKKALLATA  566

Query  468  SQQVELAESLELLKEDTLKGTKSCWLR  388
            S+QVELAESLE LKE+ L GT SCW R
Sbjct  567  SKQVELAESLEHLKENNLPGTYSCWRR  593



>ref|XP_007201785.1| hypothetical protein PRUPE_ppa004700mg [Prunus persica]
 gb|EMJ02984.1| hypothetical protein PRUPE_ppa004700mg [Prunus persica]
Length=495

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = -1

Query  753  VCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPT  574
               R+  NR   + + L+  + S QEQ+IS   +VD   P  +RLQQLE  V EL+NKPT
Sbjct  367  FAARHEENRLKSSCEPLLLANSSSQEQHISQGIEVD---PLWQRLQQLEGLVTELINKPT  423

Query  573  EIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCW  394
            +IPPEK+ ML +S++RIKSIE+DLQ+T+KALLATAS+QVELAESLE LKED+  G+ SCW
Sbjct  424  KIPPEKEDMLHESLSRIKSIEYDLQKTKKALLATASKQVELAESLESLKEDSSTGSNSCW  483

Query  393  LRTKS  379
             R+ S
Sbjct  484  PRSCS  488



>ref|XP_006443597.1| hypothetical protein CICLE_v10019387mg [Citrus clementina]
 gb|ESR56837.1| hypothetical protein CICLE_v10019387mg [Citrus clementina]
Length=601

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 92/128 (72%), Gaps = 3/128 (2%)
 Frame = -1

Query  762  IGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLN  583
            + G+ V  +  +  +N+ +   P  S QEQ+IS   +    HPC ERLQ+LE+ V +L+N
Sbjct  468  LKGLFVAQHSCKKLENQTKSPLPCTSSQEQSISQAVENQSFHPCWERLQRLEELVTDLVN  527

Query  582  KPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTK  403
            KP  IPPEK+ MLL+S++RIKSIEHDLQRT+KALLATAS+QVELAESLE LKE+++   K
Sbjct  528  KPKRIPPEKEDMLLESLSRIKSIEHDLQRTKKALLATASKQVELAESLEQLKENSIPAMK  587

Query  402  ---SCWLR  388
               SCW R
Sbjct  588  KRSSCWER  595



>emb|CDP03879.1| unnamed protein product [Coffea canephora]
Length=598

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D L PC +RLQ LE  V ELLNKPT+IPP+K+ +LL+SMNRIKSIE+DLQ+T+KALLA
Sbjct  496  KNDDLDPCWQRLQHLESVVNELLNKPTKIPPDKEDILLESMNRIKSIEYDLQKTKKALLA  555

Query  474  TASQQVELAESLELLKEDTLKGTKSCWLRTKSTPCR  367
            TAS+QVELAESLE L+E +++ T SCWLR+  +  R
Sbjct  556  TASKQVELAESLESLRESSIRATSSCWLRSSKSLSR  591



>ref|XP_008235472.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X1 [Prunus mume]
Length=605

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = -1

Query  753  VCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPT  574
               R+  N    + + L+  + S QEQ+IS   +VD   P  +RLQQLE  V EL+NKPT
Sbjct  477  FAARHEENHLKSSCEPLLLANSSSQEQHISQGIEVD---PLWQRLQQLEGLVTELINKPT  533

Query  573  EIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCW  394
            +IPPEK+ ML +S++RIKSIE+DLQ+T+KALLATAS+QVELAESLE LKED+  G+ SCW
Sbjct  534  KIPPEKEDMLHESLSRIKSIEYDLQKTKKALLATASKQVELAESLESLKEDSSTGSNSCW  593

Query  393  LRT  385
             R+
Sbjct  594  PRS  596



>ref|XP_008235473.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X2 [Prunus mume]
Length=602

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = -1

Query  753  VCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPT  574
               R+  N    + + L+  + S QEQ+IS   +VD   P  +RLQQLE  V EL+NKPT
Sbjct  474  FAARHEENHLKSSCEPLLLANSSSQEQHISQGIEVD---PLWQRLQQLEGLVTELINKPT  530

Query  573  EIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCW  394
            +IPPEK+ ML +S++RIKSIE+DLQ+T+KALLATAS+QVELAESLE LKED+  G+ SCW
Sbjct  531  KIPPEKEDMLHESLSRIKSIEYDLQKTKKALLATASKQVELAESLESLKEDSSTGSNSCW  590

Query  393  LRT  385
             R+
Sbjct  591  PRS  593



>ref|XP_010652519.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X2 [Vitis vinifera]
Length=604

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -1

Query  690  ISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIE  511
            +  QEQ+     + D LHPC +RLQ LE +V EL  KPT IPPEK+ M+ +S++RIKSIE
Sbjct  495  VHSQEQHTLCGIEEDQLHPCLQRLQNLEASVTELFKKPTRIPPEKEDMIHESLSRIKSIE  554

Query  510  HDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLR  388
            +DLQ+T+K LLATAS+QVELAESLE LKE+  KGT SCWLR
Sbjct  555  YDLQKTKKVLLATASKQVELAESLESLKENNSKGTNSCWLR  595



>ref|XP_002271106.2| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X3 [Vitis vinifera]
Length=597

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -1

Query  690  ISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIE  511
            +  QEQ+     + D LHPC +RLQ LE +V EL  KPT IPPEK+ M+ +S++RIKSIE
Sbjct  488  VHSQEQHTLCGIEEDQLHPCLQRLQNLEASVTELFKKPTRIPPEKEDMIHESLSRIKSIE  547

Query  510  HDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLR  388
            +DLQ+T+K LLATAS+QVELAESLE LKE+  KGT SCWLR
Sbjct  548  YDLQKTKKVLLATASKQVELAESLESLKENNSKGTNSCWLR  588



>ref|XP_010652518.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X1 [Vitis vinifera]
 emb|CBI37336.3| unnamed protein product [Vitis vinifera]
Length=611

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -1

Query  690  ISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIE  511
            +  QEQ+     + D LHPC +RLQ LE +V EL  KPT IPPEK+ M+ +S++RIKSIE
Sbjct  502  VHSQEQHTLCGIEEDQLHPCLQRLQNLEASVTELFKKPTRIPPEKEDMIHESLSRIKSIE  561

Query  510  HDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLR  388
            +DLQ+T+K LLATAS+QVELAESLE LKE+  KGT SCWLR
Sbjct  562  YDLQKTKKVLLATASKQVELAESLESLKENNSKGTNSCWLR  602



>ref|XP_010652520.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X4 [Vitis vinifera]
Length=590

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = -1

Query  690  ISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIE  511
            +  QEQ+     + D LHPC +RLQ LE +V EL  KPT IPPEK+ M+ +S++RIKSIE
Sbjct  481  VHSQEQHTLCGIEEDQLHPCLQRLQNLEASVTELFKKPTRIPPEKEDMIHESLSRIKSIE  540

Query  510  HDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLR  388
            +DLQ+T+K LLATAS+QVELAESLE LKE+  KGT SCWLR
Sbjct  541  YDLQKTKKVLLATASKQVELAESLESLKENNSKGTNSCWLR  581



>ref|XP_002521087.1| transporter, putative [Ricinus communis]
 gb|EEF41238.1| transporter, putative [Ricinus communis]
Length=598

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = -1

Query  762  IGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLN  583
            +G      +  R   N+   +  D S Q Q +    K + L PC +RLQ LE  V EL+N
Sbjct  465  MGRFLAAQHSERQLPNQLSPVLADSSSQGQCVREEVKEESLQPCWQRLQHLETMVNELVN  524

Query  582  KPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTK  403
            KPT+IPPEK+ MLL+S++RIK IEHDLQ+T+KALLATAS+QVELA+SLE LKE  L G  
Sbjct  525  KPTKIPPEKEDMLLESLSRIKCIEHDLQKTKKALLATASKQVELAKSLENLKETALAGVN  584

Query  402  SCWLR  388
            SCW R
Sbjct  585  SCWPR  589



>gb|KJB10165.1| hypothetical protein B456_001G187000 [Gossypium raimondii]
Length=557

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V +L NKP  IPPEK+ MLL+S++RIKSIE DLQRT+KALLATAS+
Sbjct  464  LHPCWQRLQSLESLVTDLCNKPINIPPEKEDMLLESLSRIKSIEQDLQRTKKALLATASK  523

Query  462  QVELAESLELLKEDTLKGTKSCWLR  388
            QVELAESLE LKE +L GT SCW R
Sbjct  524  QVELAESLEHLKETSLAGTYSCWRR  548



>gb|KJB10166.1| hypothetical protein B456_001G187000 [Gossypium raimondii]
Length=610

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V +L NKP  IPPEK+ MLL+S++RIKSIE DLQRT+KALLATAS+
Sbjct  517  LHPCWQRLQSLESLVTDLCNKPINIPPEKEDMLLESLSRIKSIEQDLQRTKKALLATASK  576

Query  462  QVELAESLELLKEDTLKGTKSCWLR  388
            QVELAESLE LKE +L GT SCW R
Sbjct  577  QVELAESLEHLKETSLAGTYSCWRR  601



>gb|KJB10163.1| hypothetical protein B456_001G187000 [Gossypium raimondii]
Length=599

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V +L NKP  IPPEK+ MLL+S++RIKSIE DLQRT+KALLATAS+
Sbjct  506  LHPCWQRLQSLESLVTDLCNKPINIPPEKEDMLLESLSRIKSIEQDLQRTKKALLATASK  565

Query  462  QVELAESLELLKEDTLKGTKSCWLR  388
            QVELAESLE LKE +L GT SCW R
Sbjct  566  QVELAESLEHLKETSLAGTYSCWRR  590



>gb|KJB10158.1| hypothetical protein B456_001G187000 [Gossypium raimondii]
 gb|KJB10159.1| hypothetical protein B456_001G187000 [Gossypium raimondii]
 gb|KJB10162.1| hypothetical protein B456_001G187000 [Gossypium raimondii]
 gb|KJB10164.1| hypothetical protein B456_001G187000 [Gossypium raimondii]
 gb|KJB10167.1| hypothetical protein B456_001G187000 [Gossypium raimondii]
Length=603

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V +L NKP  IPPEK+ MLL+S++RIKSIE DLQRT+KALLATAS+
Sbjct  510  LHPCWQRLQSLESLVTDLCNKPINIPPEKEDMLLESLSRIKSIEQDLQRTKKALLATASK  569

Query  462  QVELAESLELLKEDTLKGTKSCWLR  388
            QVELAESLE LKE +L GT SCW R
Sbjct  570  QVELAESLEHLKETSLAGTYSCWRR  594



>ref|XP_010532892.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like [Tarenaya hassleriana]
Length=586

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D LHPC +RLQ LE  V +LLNKPT IPPEKD MLLDS++RIKSIE DLQ+T++AL+ TA
Sbjct  491  DSLHPCMQRLQDLETVVTDLLNKPTRIPPEKDDMLLDSLDRIKSIEQDLQKTKQALILTA  550

Query  468  SQQVELAESLELLKEDTLKGTKSCWLRT  385
            S+Q+ELAE+LE LK     GT SCW R+
Sbjct  551  SKQIELAETLESLKFSNSTGTSSCWRRS  578



>ref|XP_011024669.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 [Populus euphratica]
Length=620

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = -1

Query  717  NEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLD  538
            N++  +  D S Q Q +    K + LHPC +RLQ LE  V EL +KPT IPPEK+ MLL+
Sbjct  501  NQRDSLLEDSSSQVQGVLQEIKEEPLHPCWQRLQNLETMVNELGSKPTRIPPEKEDMLLE  560

Query  537  SMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKG-TKSCWLR  388
            S++RIKSIEHDLQ+T++ALLATAS+QVELAESLE LK ++L G   SCW R
Sbjct  561  SLSRIKSIEHDLQKTKRALLATASRQVELAESLESLKGNSLAGAANSCWPR  611



>ref|XP_011089683.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X2 [Sesamum indicum]
Length=551

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 87/130 (67%), Gaps = 10/130 (8%)
 Frame = -1

Query  738  NLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPE  559
            N+    +N +R    + + QE+N   P   +LLHPC ++LQ LE +V ELL KP +IPPE
Sbjct  363  NMETIPENHRRNQVANSNSQEKNAVQPNTKELLHPCYQKLQHLENSVTELLKKPAKIPPE  422

Query  558  KDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKE----------DTLKG  409
            K+ ++ +S+NRIKSIE+DLQ+T+KALLAT S+Q EL+ESLE+LKE          + L+G
Sbjct  423  KEEIIFESLNRIKSIEYDLQKTKKALLATTSKQEELSESLEILKEINIKARTTVVNYLRG  482

Query  408  TKSCWLRTKS  379
              + WL+  S
Sbjct  483  YPAWWLKMLS  492



>ref|XP_010274040.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 [Nelumbo nucifera]
Length=605

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = -1

Query  687  SPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEH  508
            S Q+++ S      L++PC +RLQ+LE  V EL NKP  IPPEKD +L++S+NRIKSIEH
Sbjct  497  SSQDEHTSPAAGEGLIYPCLQRLQRLEALVTELTNKPVTIPPEKDVILIESLNRIKSIEH  556

Query  507  DLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCW  394
            DLQ+T+KAL ATAS+QVELAESLE LKE  L    SCW
Sbjct  557  DLQKTKKALHATASKQVELAESLENLKEPRLNKRNSCW  594



>ref|XP_010069651.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X3 [Eucalyptus grandis]
 ref|XP_010069652.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X3 [Eucalyptus grandis]
Length=591

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V EL NK  +IPPEKD MLL+SM+RIKSIE+DLQ+T++AL+ATASQ
Sbjct  499  LHPCWQRLQNLEMMVTELSNKHAKIPPEKDDMLLESMSRIKSIEYDLQKTKRALIATASQ  558

Query  462  QVELAESLELLKEDTLKGTKSCWLRTKS  379
            QVELA+S E L++ + +GT +CW R +S
Sbjct  559  QVELAQSFENLRDRSAQGTNTCWPRYRS  586



>ref|XP_011089682.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Sesamum indicum]
Length=668

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 87/130 (67%), Gaps = 10/130 (8%)
 Frame = -1

Query  738  NLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPE  559
            N+    +N +R    + + QE+N   P   +LLHPC ++LQ LE +V ELL KP +IPPE
Sbjct  480  NMETIPENHRRNQVANSNSQEKNAVQPNTKELLHPCYQKLQHLENSVTELLKKPAKIPPE  539

Query  558  KDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKE----------DTLKG  409
            K+ ++ +S+NRIKSIE+DLQ+T+KALLAT S+Q EL+ESLE+LKE          + L+G
Sbjct  540  KEEIIFESLNRIKSIEYDLQKTKKALLATTSKQEELSESLEILKEINIKARTTVVNYLRG  599

Query  408  TKSCWLRTKS  379
              + WL+  S
Sbjct  600  YPAWWLKMLS  609



>ref|XP_010069649.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X1 [Eucalyptus grandis]
 ref|XP_010069650.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X2 [Eucalyptus grandis]
Length=668

 Score =   117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V EL NK  +IPPEKD MLL+SM+RIKSIE+DLQ+T++AL+ATASQ
Sbjct  576  LHPCWQRLQNLEMMVTELSNKHAKIPPEKDDMLLESMSRIKSIEYDLQKTKRALIATASQ  635

Query  462  QVELAESLELLKEDTLKGTKSCWLRTKS  379
            QVELA+S E L++ + +GT +CW R +S
Sbjct  636  QVELAQSFENLRDRSAQGTNTCWPRYRS  663



>ref|XP_002301787.2| hypothetical protein POPTR_0002s24450g [Populus trichocarpa]
 gb|EEE81060.2| hypothetical protein POPTR_0002s24450g [Populus trichocarpa]
Length=417

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 83/128 (65%), Gaps = 12/128 (9%)
 Frame = -1

Query  753  VCVRNNLNRTSDNEQRLIAP------------DISPQEQNISSPKKVDLLHPCCERLQQL  610
            +C  ++ + T  N    I P            D S Q Q +S   K + LHPC +RLQ L
Sbjct  280  ICSADSCSDTRPNASDFIQPLPLSDERDSLLEDSSSQVQGVSQEIKEEPLHPCWQRLQNL  339

Query  609  EKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELL  430
            E  V EL +KPT IPPEK+ MLL+S++RIK IEHDLQ+T+KALLATAS+QVELAESLE L
Sbjct  340  ETMVNELGSKPTRIPPEKEDMLLESLSRIKCIEHDLQKTKKALLATASRQVELAESLESL  399

Query  429  KEDTLKGT  406
            K ++L  T
Sbjct  400  KGNSLAHT  407



>gb|KJB42486.1| hypothetical protein B456_007G154800 [Gossypium raimondii]
Length=565

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -1

Query  678  EQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQ  499
            E  I +  + DLL PC +RLQ LE  V +L NKP  IPPEK+ MLL+S+NRIKS+E DLQ
Sbjct  460  ENGILTEAEEDLLRPCWQRLQNLETMVTKLYNKPANIPPEKEDMLLESLNRIKSMEQDLQ  519

Query  498  RTRKALLATASQQVELAESLELLKEDTLKGTKSCWLR  388
            RT+KAL  TAS+QVELAE LE LKE  L G  SCW R
Sbjct  520  RTKKALFTTASKQVELAELLEHLKECNLAGKFSCWGR  556



>ref|XP_011458184.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X1 [Fragaria vesca subsp. vesca]
Length=602

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 5/107 (5%)
 Frame = -1

Query  687  SPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEH  508
            S QEQ I+   +VD   P  +RL+QLE  V EL NKPT+IP EK+ ML +S++RIKSIE+
Sbjct  496  SSQEQQIAQETEVD---PLWQRLKQLEGLVTELTNKPTKIPQEKEDMLCESLSRIKSIEY  552

Query  507  DLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRTKSTPCR  367
            DLQ+T+KALLATAS+QVELAESLE LKE+   G  SCW R +S  CR
Sbjct  553  DLQKTKKALLATASKQVELAESLESLKENNSTGAISCWPRPRS--CR  597



>ref|XP_004290208.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X2 [Fragaria vesca subsp. vesca]
Length=601

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 5/107 (5%)
 Frame = -1

Query  687  SPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEH  508
            S QEQ I+   +VD   P  +RL+QLE  V EL NKPT+IP EK+ ML +S++RIKSIE+
Sbjct  495  SSQEQQIAQETEVD---PLWQRLKQLEGLVTELTNKPTKIPQEKEDMLCESLSRIKSIEY  551

Query  507  DLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRTKSTPCR  367
            DLQ+T+KALLATAS+QVELAESLE LKE+   G  SCW R +S  CR
Sbjct  552  DLQKTKKALLATASKQVELAESLESLKENNSTGAISCWPRPRS--CR  596



>gb|KJB42481.1| hypothetical protein B456_007G154800 [Gossypium raimondii]
 gb|KJB42482.1| hypothetical protein B456_007G154800 [Gossypium raimondii]
 gb|KJB42485.1| hypothetical protein B456_007G154800 [Gossypium raimondii]
Length=599

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = -1

Query  678  EQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQ  499
            E  I +  + DLL PC +RLQ LE  V +L NKP  IPPEK+ MLL+S+NRIKS+E DLQ
Sbjct  494  ENGILTEAEEDLLRPCWQRLQNLETMVTKLYNKPANIPPEKEDMLLESLNRIKSMEQDLQ  553

Query  498  RTRKALLATASQQVELAESLELLKEDTLKGTKSCWLR  388
            RT+KAL  TAS+QVELAE LE LKE  L G  SCW R
Sbjct  554  RTKKALFTTASKQVELAELLEHLKECNLAGKFSCWGR  590



>ref|XP_008458007.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X1 [Cucumis melo]
Length=593

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 82/117 (70%), Gaps = 0/117 (0%)
 Frame = -1

Query  729  RTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDH  550
            R ++N+QR  + D   ++       K   + P  +RLQ LE  V EL NKP++IP EK+ 
Sbjct  471  RHTENQQREASSDHHLEDSGTREESKESAVDPLWKRLQNLEVMVTELTNKPSKIPLEKED  530

Query  549  MLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRTKS  379
            ML +S+NRIKSIE+DLQ+T++ALLATAS+QVELAES+E +KE+ L G  SCW R ++
Sbjct  531  MLHESLNRIKSIEYDLQKTKRALLATASKQVELAESMESIKENNLVGANSCWPRNRN  587



>gb|KHF99135.1| sec14 [Gossypium arboreum]
Length=607

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V +L NKPT IPPEK+ MLL+S++RIKSIE DLQRT+KALLATAS+
Sbjct  431  LHPCWQRLQNLESLVTDLCNKPTNIPPEKEDMLLESLSRIKSIEQDLQRTKKALLATASK  490

Query  462  QVELAESLELLKEDTLKGTK  403
            QVELAESLE LKE +L  TK
Sbjct  491  QVELAESLEHLKETSLAETK  510



>ref|XP_010527238.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X2 [Tarenaya hassleriana]
Length=577

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 84/136 (62%), Gaps = 16/136 (12%)
 Frame = -1

Query  774  FRNRIGGVCV-----RNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQL  610
            F   I  +C+     R  +NR  +N+ R   P + P  Q  S       LHPC +RL+ L
Sbjct  444  FFQFISCICIVFRILRRVVNRRQENQLR---PQLPPHVQGES-------LHPCLQRLRDL  493

Query  609  EKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELL  430
            E  V EL+NKP  IPPEK++M+ DS++RIKSIE DLQ+TRK LL TAS+Q+ELAESLE L
Sbjct  494  ETVVTELVNKPARIPPEKENMIRDSLDRIKSIEQDLQKTRKVLLLTASKQIELAESLESL  553

Query  429  K-EDTLKGTKSCWLRT  385
            K      G  SCW R+
Sbjct  554  KVSSNSSGMTSCWRRS  569



>ref|XP_010527235.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010527236.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Tarenaya hassleriana]
Length=580

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 84/136 (62%), Gaps = 16/136 (12%)
 Frame = -1

Query  774  FRNRIGGVCV-----RNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQL  610
            F   I  +C+     R  +NR  +N+ R   P + P  Q  S       LHPC +RL+ L
Sbjct  447  FFQFISCICIVFRILRRVVNRRQENQLR---PQLPPHVQGES-------LHPCLQRLRDL  496

Query  609  EKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELL  430
            E  V EL+NKP  IPPEK++M+ DS++RIKSIE DLQ+TRK LL TAS+Q+ELAESLE L
Sbjct  497  ETVVTELVNKPARIPPEKENMIRDSLDRIKSIEQDLQKTRKVLLLTASKQIELAESLESL  556

Query  429  K-EDTLKGTKSCWLRT  385
            K      G  SCW R+
Sbjct  557  KVSSNSSGMTSCWRRS  572



>gb|KHF99134.1| sec14 [Gossypium arboreum]
Length=667

 Score =   114 bits (286),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 78/114 (68%), Gaps = 15/114 (13%)
 Frame = -1

Query  699  APDISPQEQNIS---------------SPKKVDLLHPCCERLQQLEKAVAELLNKPTEIP  565
            A D +PQ  N+S               +  K + LHPC +RLQ LE  V +L NKPT IP
Sbjct  457  AQDSNPQVGNLSNHEVAGSGSLGNGTLTEAKEESLHPCWQRLQNLESLVTDLCNKPTNIP  516

Query  564  PEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTK  403
            PEK+ MLL+S++RIKSIE DLQRT+KALLATAS+QVELAESLE LKE +L  TK
Sbjct  517  PEKEDMLLESLSRIKSIEQDLQRTKKALLATASKQVELAESLEHLKETSLAETK  570



>ref|XP_010909338.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like [Elaeis guineensis]
Length=555

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = -1

Query  717  NEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLD  538
            +  R+ + + +P +   S   K D + PC ERLQ+LE+ VAEL  KPT+IPPEKD M+L+
Sbjct  438  DHHRMDSANANPTDHLASHDAKQDSILPCLERLQRLEELVAELNTKPTKIPPEKDIMILE  497

Query  537  SMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLR-TKSTPCRT  364
            S+NRIKSIE+DLQ+T++AL AT+S+QVELAE LE LKE +L    SCW + +KS   RT
Sbjct  498  SLNRIKSIEYDLQKTKEALNATSSRQVELAELLENLKESSLH-RNSCWFKDSKSLQQRT  555



>ref|XP_006602514.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like [Glycine max]
Length=98

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  639  HPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQ  460
             P  +R+Q LE  V E+ NKP  IPPEK+ +L +S++RIK IE+DLQ+T+KALLATAS+Q
Sbjct  7    EPLWQRIQNLEAVVTEMANKPNTIPPEKEDILQESLSRIKCIEYDLQKTKKALLATASKQ  66

Query  459  VELAESLELLKEDTLKGTKSCWLRTKS  379
            VELAESLE LKE    G  SCW + +S
Sbjct  67   VELAESLESLKESKFDGRNSCWPKNRS  93



>ref|XP_008382613.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Malus domestica]
 ref|XP_008348982.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Malus domestica]
Length=602

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            + P  +RLQQLE  V  L+NKP +IP EK+ ML +S++RIKSIE+DLQ+T+KAL ATAS+
Sbjct  508  VDPLWQRLQQLEVLVTNLINKPIKIPQEKEDMLHESLSRIKSIEYDLQKTKKALFATASK  567

Query  462  QVELAESLELLKEDTLKGTKSCWLRTKS  379
            QVELAESLE  KED+L G+ SCW R+ S
Sbjct  568  QVELAESLESFKEDSLTGSNSCWPRSYS  595



>ref|XP_009334924.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like [Pyrus x bretschneideri]
Length=602

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = -1

Query  717  NEQRLIAPDISPQEQNISSPKKVDL----LHPCCERLQQLEKAVAELLNKPTEIPPEKDH  550
            +E RL  P  SP  +N SS ++       + P  +RLQQLE  V  L++KP +IP EK+ 
Sbjct  479  SESRLKTPCKSPPLENSSSQEQQYSQGTDVDPLWQRLQQLEVLVTNLISKPIKIPQEKED  538

Query  549  MLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRTKS  379
            ML +S++RIKSIE+DLQ+T+KAL ATAS+QVELAESLE LKED+L G+ SCW R+ S
Sbjct  539  MLHESLSRIKSIEYDLQKTKKALFATASKQVELAESLESLKEDSLAGSNSCWPRSYS  595



>ref|XP_008372477.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X2 [Malus domestica]
Length=602

 Score =   111 bits (277),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = -1

Query  696  PDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKS  517
            P  +P  Q   + + +D+  P  +RLQQLE  V  L NKPT+IP EK+ ML +S+NRIKS
Sbjct  491  PVENPSSQEQQNSQGIDV-GPLWQRLQQLEGLVTNLTNKPTKIPQEKEDMLHESLNRIKS  549

Query  516  IEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRT  385
            IE+DLQ+T+KAL ATAS+QVEL++SL+ LK+D+L G+ SCW R+
Sbjct  550  IEYDLQKTKKALFATASKQVELSKSLKSLKDDSLTGSNSCWPRS  593



>ref|XP_010685012.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=598

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  657  KKVD--LLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKA  484
            +K+D  +L+PC +RLQ LE+ V +L+NKP+ IPP+K+  +++S+NRIK+IE DLQ+T+KA
Sbjct  497  QKIDDSMLNPCWQRLQHLEQLVTDLINKPSRIPPDKEDTIVESLNRIKAIEQDLQKTKKA  556

Query  483  LLATASQQVELAESLELLKEDTLKGTKSCWLR  388
            L ATAS+QVELA SLE LKE  + G  +CW R
Sbjct  557  LFATASKQVELAASLESLKESNMHGQTTCWRR  588



>ref|XP_010685011.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=599

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 73/92 (79%), Gaps = 2/92 (2%)
 Frame = -1

Query  657  KKVD--LLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKA  484
            +K+D  +L+PC +RLQ LE+ V +L+NKP+ IPP+K+  +++S+NRIK+IE DLQ+T+KA
Sbjct  498  QKIDDSMLNPCWQRLQHLEQLVTDLINKPSRIPPDKEDTIVESLNRIKAIEQDLQKTKKA  557

Query  483  LLATASQQVELAESLELLKEDTLKGTKSCWLR  388
            L ATAS+QVELA SLE LKE  + G  +CW R
Sbjct  558  LFATASKQVELAASLESLKESNMHGQTTCWRR  589



>ref|XP_008372476.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Malus domestica]
Length=624

 Score =   111 bits (277),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = -1

Query  696  PDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKS  517
            P  +P  Q   + + +D+  P  +RLQQLE  V  L NKPT+IP EK+ ML +S+NRIKS
Sbjct  513  PVENPSSQEQQNSQGIDV-GPLWQRLQQLEGLVTNLTNKPTKIPQEKEDMLHESLNRIKS  571

Query  516  IEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRT  385
            IE+DLQ+T+KAL ATAS+QVEL++SL+ LK+D+L G+ SCW R+
Sbjct  572  IEYDLQKTKKALFATASKQVELSKSLKSLKDDSLTGSNSCWPRS  615



>ref|XP_004514272.1| PREDICTED: SEC14 cytosolic factor-like isoform X2 [Cicer arietinum]
Length=562

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = -1

Query  681  QEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDL  502
            QE+ I+S  K     P  +RL+ LE  V E+ NKP  IPPEK+ +L +S++RIKSIE+DL
Sbjct  460  QEKIITSAIK----EPIWQRLRDLEAVVTEMTNKPRTIPPEKEDILRESLSRIKSIEYDL  515

Query  501  QRTRKALLATASQQVELAESLELLKEDTLKGTKSCW  394
            Q+TRKALLATAS+QVELAESLE LKE+   GT SCW
Sbjct  516  QKTRKALLATASRQVELAESLENLKENKFDGTNSCW  551



>ref|XP_004170020.1| PREDICTED: SEC14 cytosolic factor-like, partial [Cucumis sativus]
Length=430

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  RTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDH  550
            R ++N+QR  + +   ++       K   + P  +RL  LE  V EL NKP++IP EK+ 
Sbjct  308  RHTENQQREASSENHLEDSGTREESKESAVDPLWKRLLNLEVMVTELTNKPSKIPLEKED  367

Query  549  MLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRTKST  376
            ML +S+NRIKSIE+DLQ+T++ALL TAS+QVELAES+E +KE+ L G  SCW R + T
Sbjct  368  MLHESLNRIKSIEYDLQKTKRALLVTASKQVELAESMESIKENNLVGANSCWPRNRKT  425



>ref|XP_004514271.1| PREDICTED: SEC14 cytosolic factor-like isoform X1 [Cicer arietinum]
Length=598

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = -1

Query  681  QEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDL  502
            QE+ I+S  K     P  +RL+ LE  V E+ NKP  IPPEK+ +L +S++RIKSIE+DL
Sbjct  496  QEKIITSAIK----EPIWQRLRDLEAVVTEMTNKPRTIPPEKEDILRESLSRIKSIEYDL  551

Query  501  QRTRKALLATASQQVELAESLELLKEDTLKGTKSCW  394
            Q+TRKALLATAS+QVELAESLE LKE+   GT SCW
Sbjct  552  QKTRKALLATASRQVELAESLENLKENKFDGTNSCW  587



>gb|KJB10161.1| hypothetical protein B456_001G187000 [Gossypium raimondii]
Length=620

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V +L NKP  IPPEK+ MLL+S++RIKSIE DLQRT+KALLATAS+
Sbjct  510  LHPCWQRLQSLESLVTDLCNKPINIPPEKEDMLLESLSRIKSIEQDLQRTKKALLATASK  569

Query  462  QVELAESLELLKEDTL  415
            QVELAESLE LKE +L
Sbjct  570  QVELAESLEHLKETSL  585



>gb|KGN44595.1| hypothetical protein Csa_7G339670 [Cucumis sativus]
Length=559

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  RTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDH  550
            R ++N+QR  + +   ++       K   + P  +RL  LE  V EL NKP++IP EK+ 
Sbjct  437  RHTENQQREASSENHLEDSGTREESKESAVDPLWKRLLNLEVMVTELTNKPSKIPLEKED  496

Query  549  MLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRTKST  376
            ML +S+NRIKSIE+DLQ+T++ALL TAS+QVELAES+E +KE+ L G  SCW R + T
Sbjct  497  MLHESLNRIKSIEYDLQKTKRALLVTASKQVELAESMESIKENNLVGANSCWPRNRKT  554



>ref|XP_004139710.1| PREDICTED: SEC14 cytosolic factor-like [Cucumis sativus]
Length=563

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = -1

Query  729  RTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDH  550
            R ++N+QR  + +   ++       K   + P  +RL  LE  V EL NKP++IP EK+ 
Sbjct  441  RHTENQQREASSENHLEDSGTREESKESAVDPLWKRLLNLEVMVTELTNKPSKIPLEKED  500

Query  549  MLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRTKST  376
            ML +S+NRIKSIE+DLQ+T++ALL TAS+QVELAES+E +KE+ L G  SCW R + T
Sbjct  501  MLHESLNRIKSIEYDLQKTKRALLVTASKQVELAESMESIKENNLVGANSCWPRNRKT  558



>emb|CDY52084.1| BnaCnng21850D [Brassica napus]
Length=587

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V  L +KPT IP EK+ +L DS++RIK IE DLQ+T+KALL TAS+
Sbjct  495  LHPCWQRLQNLESMVTVLFDKPTNIPQEKEDILRDSLDRIKGIEQDLQKTKKALLLTASK  554

Query  462  QVELAESLELLKEDTLKGTKSCWLR  388
            Q+ELAES E LKE T  G +SCW R
Sbjct  555  QLELAESFESLKESTSMGMRSCWPR  579



>ref|XP_009102455.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X2 [Brassica rapa]
Length=579

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V  L +KPT IP EK+ +L DS++RIK IE DLQ+T+KALL TAS+
Sbjct  487  LHPCWQRLQNLESMVTVLFDKPTNIPQEKEDILRDSLDRIKGIEQDLQKTKKALLLTASK  546

Query  462  QVELAESLELLKEDTLKGTKSCWLR  388
            Q+ELAES E LKE T  G +SCW R
Sbjct  547  QLELAESFESLKESTSMGMRSCWPR  571



>emb|CDX77382.1| BnaA07g05200D [Brassica napus]
Length=619

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V  L +KPT IP EK+ +L DS++RIK IE DLQ+T+KALL TAS+
Sbjct  527  LHPCWQRLQNLESMVTVLFDKPTNIPQEKEDILRDSLDRIKGIEQDLQKTKKALLLTASK  586

Query  462  QVELAESLELLKEDTLKGTKSCWLR  388
            Q+ELAES E LKE T  G +SCW R
Sbjct  587  QLELAESFESLKESTSMGMRSCWPR  611



>ref|XP_009102454.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X1 [Brassica rapa]
Length=587

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            LHPC +RLQ LE  V  L +KPT IP EK+ +L DS++RIK IE DLQ+T+KALL TAS+
Sbjct  495  LHPCWQRLQNLESMVTVLFDKPTNIPQEKEDILRDSLDRIKGIEQDLQKTKKALLLTASK  554

Query  462  QVELAESLELLKEDTLKGTKSCWLR  388
            Q+ELAES E LKE T  G +SCW R
Sbjct  555  QLELAESFESLKESTSMGMRSCWPR  579



>ref|XP_006602516.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X2 [Glycine max]
Length=564

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 73/101 (72%), Gaps = 4/101 (4%)
 Frame = -1

Query  681  QEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDL  502
            QEQ I+   K     P  +RLQ LE  V+E+ NKP  IPPEK+ +L +S++RIK IE+DL
Sbjct  463  QEQLITPAIK----EPLWQRLQNLEAVVSEMANKPKTIPPEKEDILQESLSRIKCIEYDL  518

Query  501  QRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRTKS  379
            Q+T+KALLATAS+QVELA+SLE LK+    GT SCW + +S
Sbjct  519  QKTKKALLATASKQVELAKSLESLKDSKFDGTNSCWPKNRS  559



>ref|XP_006602515.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Glycine max]
Length=594

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 73/101 (72%), Gaps = 4/101 (4%)
 Frame = -1

Query  681  QEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDL  502
            QEQ I+   K     P  +RLQ LE  V+E+ NKP  IPPEK+ +L +S++RIK IE+DL
Sbjct  493  QEQLITPAIK----EPLWQRLQNLEAVVSEMANKPKTIPPEKEDILQESLSRIKCIEYDL  548

Query  501  QRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRTKS  379
            Q+T+KALLATAS+QVELA+SLE LK+    GT SCW + +S
Sbjct  549  QKTKKALLATASKQVELAKSLESLKDSKFDGTNSCWPKNRS  589



>ref|XP_007140607.1| hypothetical protein PHAVU_008G126500g [Phaseolus vulgaris]
 gb|ESW12601.1| hypothetical protein PHAVU_008G126500g [Phaseolus vulgaris]
Length=592

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  636  PCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQV  457
            P  +RLQ LE  V E+ NKP  IPPEK+ +L +S++RIK IE+DLQ+T+KALLATAS+QV
Sbjct  502  PLWQRLQNLEAVVTEMANKPKTIPPEKEDILQESLSRIKCIEYDLQKTKKALLATASKQV  561

Query  456  ELAESLELLKEDTLKGTKSCWLRTKS  379
            ELAESLE LKE    G+ SCW + +S
Sbjct  562  ELAESLENLKEGRFDGSNSCWPKNRS  587



>ref|XP_009371669.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like [Pyrus x bretschneideri]
Length=603

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            + P  +RLQQLE  V  L+NKPT+IP EK+ ML +S++RIKSIE DLQ+T+ AL AT S+
Sbjct  509  VGPLWQRLQQLEGLVTNLINKPTKIPQEKEDMLHESLSRIKSIECDLQKTKIALFATTSK  568

Query  462  QVELAESLELLKEDTLKGTKSCWLRTKS  379
            QVELAESLE LK+D+L G+ SCW R+ S
Sbjct  569  QVELAESLESLKDDSLTGSNSCWPRSCS  596



>ref|XP_006586246.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like [Glycine max]
Length=594

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 79/120 (66%), Gaps = 6/120 (5%)
 Frame = -1

Query  729  RTSDNEQRLIAPDISPQ---EQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPE  559
            R+ DN+ R      S Q   E+ + +P    +  P  +R+Q LE  V E+ NKP  IPPE
Sbjct  473  RSVDNQPRSHEKTKSAQSNSEEQLMTPA---IKEPLWQRIQNLEAVVTEMANKPNTIPPE  529

Query  558  KDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRTKS  379
            K+ +L +S++RIK IE+DLQ+T+KALLATAS+QVELAESLE LKE    G  SCW + +S
Sbjct  530  KEDILQESLSRIKCIEYDLQKTKKALLATASKQVELAESLESLKESKFDGRNSCWPKNRS  589



>gb|KHN30510.1| Sec14 cytosolic factor [Glycine soja]
Length=594

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = -1

Query  681  QEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDL  502
            QEQ I+   K     P  +RLQ LE  V E+ NKP  IPPEK+ +L +S++RIK IE+DL
Sbjct  493  QEQLITPAIK----EPLWQRLQNLEAVVTEMANKPKTIPPEKEDILQESLSRIKCIEYDL  548

Query  501  QRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLRTKS  379
            Q+T+KALLATAS+QVELA+SLE LK+    GT SCW + +S
Sbjct  549  QKTKKALLATASKQVELAKSLESLKDSKFDGTNSCWPKNRS  589



>gb|KJB42484.1| hypothetical protein B456_007G154800 [Gossypium raimondii]
Length=608

 Score =   105 bits (263),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  678  EQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQ  499
            E  I +  + DLL PC +RLQ LE  V +L NKP  IPPEK+ MLL+S+NRIKS+E DLQ
Sbjct  494  ENGILTEAEEDLLRPCWQRLQNLETMVTKLYNKPANIPPEKEDMLLESLNRIKSMEQDLQ  553

Query  498  RTRKALLATASQQVELAESLELLKE  424
            RT+KAL  TAS+QVELAE LE LKE
Sbjct  554  RTKKALFTTASKQVELAELLEHLKE  578



>gb|KEH22719.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=480

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 1/95 (1%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D+  P  +RL+ LE  V E+ NKP  IP EK+ +L +S++RIK IE DLQ+TRKALLATA
Sbjct  386  DIKEPIWQRLRDLEAVVTEMANKPRTIPREKEDILQESLSRIKGIEFDLQKTRKALLATA  445

Query  468  SQQVELAESLELLKEDTLKGTKSCWLR-TKSTPCR  367
            S+Q ELAESLE LK++   GTKSCW + +K  P R
Sbjct  446  SKQAELAESLESLKDNKFDGTKSCWPKNSKYAPGR  480



>gb|KJB42479.1| hypothetical protein B456_007G154800 [Gossypium raimondii]
Length=608

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  678  EQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQ  499
            E  I +  + DLL PC +RLQ LE  V +L NKP  IPPEK+ MLL+S+NRIKS+E DLQ
Sbjct  494  ENGILTEAEEDLLRPCWQRLQNLETMVTKLYNKPANIPPEKEDMLLESLNRIKSMEQDLQ  553

Query  498  RTRKALLATASQQVELAESLELLKE  424
            RT+KAL  TAS+QVELAE LE LKE
Sbjct  554  RTKKALFTTASKQVELAELLEHLKE  578



>ref|XP_010466921.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X3 [Camelina sativa]
Length=480

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 88/139 (63%), Gaps = 12/139 (9%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNL-----NRTSDNEQRLIAPDI--SPQEQNISSPK--KVDLLHPCCE  625
            F    +GG+C+   +     N+  +N+ R   P++  S  +Q++  P+    + +HPC  
Sbjct  336  FILQLLGGLCLMFRILGRLVNKQPENQLR---PEVRVSVPQQHVPPPQVQGRESVHPCWL  392

Query  624  RLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAE  445
            RLQ LE  V  L +KP+ IP EK+ +L DS++RIKSIE DLQ+T+KAL  TAS+Q+ELAE
Sbjct  393  RLQNLETMVTVLCDKPSSIPQEKEDILRDSLDRIKSIEQDLQKTKKALFLTASKQIELAE  452

Query  444  SLELLKEDTLKGTKSCWLR  388
             LE LKE +  G +SCW R
Sbjct  453  CLENLKESSSTGMRSCWPR  471



>gb|KEH22715.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=605

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 86/142 (61%), Gaps = 10/142 (7%)
 Frame = -1

Query  783  YTFFRNRIGGVCVR--NNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQL  610
            Y  F        VR  NN  R+    Q + +  + P    +++P   D+  P  +RL+ L
Sbjct  471  YVVFAALGNFFVVRSVNNQPRSHQKIQHVESSSLEP----LTTP---DIKEPIWQRLRDL  523

Query  609  EKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELL  430
            E  V E+ NKP  IP EK+ +L +S++RIK IE DLQ+TRKALLATAS+Q ELAESLE L
Sbjct  524  EAVVTEMANKPRTIPREKEDILQESLSRIKGIEFDLQKTRKALLATASKQAELAESLESL  583

Query  429  KEDTLKGTKSCWLR-TKSTPCR  367
            K++   GTKSCW + +K  P R
Sbjct  584  KDNKFDGTKSCWPKNSKYAPGR  605



>gb|KEH22717.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=619

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 86/142 (61%), Gaps = 10/142 (7%)
 Frame = -1

Query  783  YTFFRNRIGGVCVR--NNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQL  610
            Y  F        VR  NN  R+    Q + +  + P    +++P   D+  P  +RL+ L
Sbjct  485  YVVFAALGNFFVVRSVNNQPRSHQKIQHVESSSLEP----LTTP---DIKEPIWQRLRDL  537

Query  609  EKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELL  430
            E  V E+ NKP  IP EK+ +L +S++RIK IE DLQ+TRKALLATAS+Q ELAESLE L
Sbjct  538  EAVVTEMANKPRTIPREKEDILQESLSRIKGIEFDLQKTRKALLATASKQAELAESLESL  597

Query  429  KEDTLKGTKSCWLR-TKSTPCR  367
            K++   GTKSCW + +K  P R
Sbjct  598  KDNKFDGTKSCWPKNSKYAPGR  619



>ref|XP_006299363.1| hypothetical protein CARUB_v10015522mg [Capsella rubella]
 gb|EOA32261.1| hypothetical protein CARUB_v10015522mg [Capsella rubella]
Length=581

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 89/139 (64%), Gaps = 12/139 (9%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNL-----NRTSDNEQRLIAPD--ISPQEQNISSPK--KVDLLHPCCE  625
            F    +G +C+   +     N+  +N+ R   P+  +S  +Q++S+P+    + +HPC  
Sbjct  437  FIFQLLGSLCLMFRILGRLVNKQPENQLR---PELRVSVPQQHVSTPQVQGRESVHPCWL  493

Query  624  RLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAE  445
            RLQ LE  V  L +KP+ IP EK+ +L DS++RIKSIE DLQ+T+KAL  TAS+Q+ELAE
Sbjct  494  RLQNLETMVTVLCDKPSSIPQEKEDILRDSLDRIKSIEQDLQKTKKALFLTASKQIELAE  553

Query  444  SLELLKEDTLKGTKSCWLR  388
             LE LKE +  G +SCW R
Sbjct  554  CLENLKESSSTGMRSCWPR  572



>ref|XP_010466920.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X2 [Camelina sativa]
Length=581

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 88/139 (63%), Gaps = 12/139 (9%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNL-----NRTSDNEQRLIAPDI--SPQEQNISSPK--KVDLLHPCCE  625
            F    +GG+C+   +     N+  +N+ R   P++  S  +Q++  P+    + +HPC  
Sbjct  437  FILQLLGGLCLMFRILGRLVNKQPENQLR---PEVRVSVPQQHVPPPQVQGRESVHPCWL  493

Query  624  RLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAE  445
            RLQ LE  V  L +KP+ IP EK+ +L DS++RIKSIE DLQ+T+KAL  TAS+Q+ELAE
Sbjct  494  RLQNLETMVTVLCDKPSSIPQEKEDILRDSLDRIKSIEQDLQKTKKALFLTASKQIELAE  553

Query  444  SLELLKEDTLKGTKSCWLR  388
             LE LKE +  G +SCW R
Sbjct  554  CLENLKESSSTGMRSCWPR  572



>ref|XP_010466919.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9 isoform X1 [Camelina sativa]
Length=583

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 88/139 (63%), Gaps = 12/139 (9%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNL-----NRTSDNEQRLIAPDI--SPQEQNISSPK--KVDLLHPCCE  625
            F    +GG+C+   +     N+  +N+ R   P++  S  +Q++  P+    + +HPC  
Sbjct  439  FILQLLGGLCLMFRILGRLVNKQPENQLR---PEVRVSVPQQHVPPPQVQGRESVHPCWL  495

Query  624  RLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAE  445
            RLQ LE  V  L +KP+ IP EK+ +L DS++RIKSIE DLQ+T+KAL  TAS+Q+ELAE
Sbjct  496  RLQNLETMVTVLCDKPSSIPQEKEDILRDSLDRIKSIEQDLQKTKKALFLTASKQIELAE  555

Query  444  SLELLKEDTLKGTKSCWLR  388
             LE LKE +  G +SCW R
Sbjct  556  CLENLKESSSTGMRSCWPR  574



>ref|XP_008778054.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like [Phoenix dactylifera]
Length=473

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = -1

Query  717  NEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLD  538
            +  R+ + + +P     S   K D +  C ERLQ+LE+ V EL  KP +IPPEK+ M+L+
Sbjct  356  DHHRMDSANANPTNHLASLDAKRDAVLSCLERLQRLEELVVELNTKPKKIPPEKETMILE  415

Query  537  SMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLR  388
            S+NRIKSIE+DLQ+T+ AL AT+ +QVELAESLE LKE +L    SCW +
Sbjct  416  SLNRIKSIEYDLQKTKDALNATSLRQVELAESLENLKETSLH-RNSCWFK  464



>gb|KHF98890.1| Sec14 cytosolic factor [Gossypium arboreum]
 gb|KHG26649.1| Sec14 cytosolic factor [Gossypium arboreum]
Length=575

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -1

Query  678  EQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQ  499
            E  I +  + DLL PC +RLQ LE  V +L NKP  IPPEK+ +LL+S+NRIKS+E DLQ
Sbjct  461  ENGILTEAEEDLLRPCWQRLQNLETMVTKLYNKPANIPPEKEDILLESLNRIKSMEQDLQ  520

Query  498  RTRKALLATASQQVELAESLELLKEDTL  415
            RT+KAL  TAS+QV+LAE LE LKE  L
Sbjct  521  RTKKALFTTASKQVKLAELLEDLKESNL  548



>ref|NP_189128.2| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 sp|F4J7S8.1|SFH9_ARATH RecName: Full=Phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9; AltName: Full=Protein SEC FOURTEEN HOMOLOGS 
9; Short=AtSFH9 [Arabidopsis thaliana]
 gb|AEE76952.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=579

 Score =   102 bits (253),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 84/137 (61%), Gaps = 14/137 (10%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNL-----NRTSDNEQRLIAPD--ISPQEQNISSPKKVDLLHPCCERL  619
            F    +G +C+   +     N+  +N+ R   P+  +S  +Q +  P+    +HPC  RL
Sbjct  441  FILQLLGSLCLMFRILGRLVNKQPENQLR---PELSVSVSQQQVPPPQ----VHPCWLRL  493

Query  618  QQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESL  439
            Q LE  V  L +KP+ IP EK+ +L DS++RIKSIE DLQ+T+KAL  TAS+Q+ELAE  
Sbjct  494  QNLETMVTVLCDKPSSIPQEKEDILRDSLDRIKSIEQDLQKTKKALFLTASKQIELAECF  553

Query  438  ELLKEDTLKGTKSCWLR  388
            E LKE +  G +SCW R
Sbjct  554  ENLKESSSTGMRSCWPR  570



>ref|XP_010488600.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X2 [Camelina sativa]
Length=559

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 87/139 (63%), Gaps = 12/139 (9%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNL-----NRTSDNEQRLIAPDI--SPQEQNISSPK--KVDLLHPCCE  625
            F    +G +C+   +     N+  +N+ R   P++  S  +Q++  P+    + +HPC  
Sbjct  415  FILQLLGSLCLMFRILGRLVNKQPENQLR---PEVRVSVPQQHVPPPQVQGRESVHPCWL  471

Query  624  RLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAE  445
            RLQ LE  V  L +KP+ IP EK+ +L DS++RIKSIE DLQ+T+KAL  TAS+Q+ELAE
Sbjct  472  RLQNLETMVTVLCDKPSSIPQEKEDILRDSLDRIKSIEQDLQKTKKALFLTASKQIELAE  531

Query  444  SLELLKEDTLKGTKSCWLR  388
             LE LKE +  G +SCW R
Sbjct  532  CLENLKESSSTGMRSCWPR  550



>ref|XP_010488597.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Camelina sativa]
 ref|XP_010488598.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Camelina sativa]
 ref|XP_010488599.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like isoform X1 [Camelina sativa]
Length=583

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 87/139 (63%), Gaps = 12/139 (9%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNL-----NRTSDNEQRLIAPDI--SPQEQNISSPK--KVDLLHPCCE  625
            F    +G +C+   +     N+  +N+ R   P++  S  +Q++  P+    + +HPC  
Sbjct  439  FILQLLGSLCLMFRILGRLVNKQPENQLR---PEVRVSVPQQHVPPPQVQGRESVHPCWL  495

Query  624  RLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAE  445
            RLQ LE  V  L +KP+ IP EK+ +L DS++RIKSIE DLQ+T+KAL  TAS+Q+ELAE
Sbjct  496  RLQNLETMVTVLCDKPSSIPQEKEDILRDSLDRIKSIEQDLQKTKKALFLTASKQIELAE  555

Query  444  SLELLKEDTLKGTKSCWLR  388
             LE LKE +  G +SCW R
Sbjct  556  CLENLKESSSTGMRSCWPR  574



>ref|XP_010110066.1| hypothetical protein L484_003046 [Morus notabilis]
 gb|EXC25122.1| hypothetical protein L484_003046 [Morus notabilis]
Length=684

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = -1

Query  702  IAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRI  523
            IA   SP++   S+P+ +++  P  +RLQ LE  V EL NKPT IP EK+ ML +SM+RI
Sbjct  539  IADSSSPEQ---STPQALEI-DPLWQRLQHLETIVTELYNKPTRIPQEKEDMLHESMSRI  594

Query  522  KSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            +SIE+DLQ+T+KALLATAS+QVELAE LE LKE  L
Sbjct  595  RSIEYDLQKTKKALLATASKQVELAELLEGLKETAL  630



>ref|XP_002883566.1| hypothetical protein ARALYDRAFT_480002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59825.1| hypothetical protein ARALYDRAFT_480002 [Arabidopsis lyrata subsp. 
lyrata]
Length=583

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            +HPC  RLQ LE  V  L +KP+ IP +K+ +L DS++RIKSIE DLQ+T+ AL  TAS+
Sbjct  490  VHPCWLRLQNLETMVTVLCDKPSSIPQDKEDILRDSLDRIKSIEQDLQKTKTALFLTASK  549

Query  462  QVELAESLELLKEDTLKGTKSCWLR  388
            Q+ELAE LE LKE +  G +SCW R
Sbjct  550  QIELAECLENLKESSSTGMRSCWPR  574



>ref|XP_006418684.1| hypothetical protein EUTSA_v10002458mg [Eutrema salsugineum]
 gb|ESQ37120.1| hypothetical protein EUTSA_v10002458mg [Eutrema salsugineum]
Length=589

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 82/120 (68%), Gaps = 4/120 (3%)
 Frame = -1

Query  735  LNRTSDNEQRLIAPDISPQEQNIS-SPKKV---DLLHPCCERLQQLEKAVAELLNKPTEI  568
            +N+  +N+ R     +S  +Q++  +P  V   + LHPC  RLQ LE  V  L +KP  I
Sbjct  462  VNKQPENQLRPEELTVSVSQQHVPPTPPHVQGRESLHPCWLRLQNLETMVTVLFDKPRNI  521

Query  567  PPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSCWLR  388
            P EK+ +L DS++RIKSIEHDLQ+T+KALL TAS+Q+ELAESLE LKE +  G +SCW R
Sbjct  522  PQEKEDILRDSLDRIKSIEHDLQKTKKALLLTASKQIELAESLESLKESSSTGMRSCWPR  581



>ref|XP_010928204.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Elaeis guineensis]
 ref|XP_010928205.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Elaeis guineensis]
Length=656

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 75/127 (59%), Gaps = 6/127 (5%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAV  598
            FFR  I G      L     ++  ++ PD  P  +    P K D + PC ERLQ+LE   
Sbjct  536  FFR--IFGCRPERRLENIYPSDTLVLTPDNHPSVE----PVKEDHVSPCLERLQRLELMF  589

Query  597  AELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDT  418
             EL +KP EIP EK+  LLDS +RIKSIE DL++T+K L AT  +Q+E+AE LE ++E  
Sbjct  590  NELSSKPAEIPQEKERALLDSWDRIKSIEFDLEKTKKVLQATVVKQMEIAEMLEAVQESN  649

Query  417  LKGTKSC  397
            L+  K C
Sbjct  650  LRRRKFC  656



>ref|XP_010928201.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Elaeis guineensis]
Length=660

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 75/127 (59%), Gaps = 6/127 (5%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAV  598
            FFR  I G      L     ++  ++ PD  P  +    P K D + PC ERLQ+LE   
Sbjct  540  FFR--IFGCRPERRLENIYPSDTLVLTPDNHPSVE----PVKEDHVSPCLERLQRLELMF  593

Query  597  AELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDT  418
             EL +KP EIP EK+  LLDS +RIKSIE DL++T+K L AT  +Q+E+AE LE ++E  
Sbjct  594  NELSSKPAEIPQEKERALLDSWDRIKSIEFDLEKTKKVLQATVVKQMEIAEMLEAVQESN  653

Query  417  LKGTKSC  397
            L+  K C
Sbjct  654  LRRRKFC  660



>ref|XP_006840163.1| hypothetical protein AMTR_s00089p00079320 [Amborella trichopoda]
 gb|ERN01838.1| hypothetical protein AMTR_s00089p00079320 [Amborella trichopoda]
Length=685

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -1

Query  636  PCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQV  457
            PC ERLQ LE  V+EL  KP  +P EKD MLLDS++RIK IE+DL +T+KAL ATAS+Q+
Sbjct  547  PCLERLQSLEAVVSELCLKPLRLPQEKDDMLLDSLHRIKCIEYDLAKTKKALHATASKQM  606

Query  456  ELAESLELLKEDTLKGTKSCWL  391
            ++ ES+  LKE +++G   C L
Sbjct  607  DIVESITTLKETSVQGEIECSL  628



>dbj|BAB02894.1| phosphatidylinositol/phosphatidylcholine transfer protein-like 
[Arabidopsis thaliana]
Length=627

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 78/127 (61%), Gaps = 14/127 (11%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNL-----NRTSDNEQRLIAPD--ISPQEQNISSPKKVDLLHPCCERL  619
            F    +G +C+   +     N+  +N+ R   P+  +S  +Q +  P+    +HPC  RL
Sbjct  446  FILQLLGSLCLMFRILGRLVNKQPENQLR---PELSVSVSQQQVPPPQ----VHPCWLRL  498

Query  618  QQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESL  439
            Q LE  V  L +KP+ IP EK+ +L DS++RIKSIE DLQ+T+KAL  TAS+Q+ELAE  
Sbjct  499  QNLETMVTVLCDKPSSIPQEKEDILRDSLDRIKSIEQDLQKTKKALFLTASKQIELAECF  558

Query  438  ELLKEDT  418
            E LKE +
Sbjct  559  ENLKESS  565



>ref|XP_009106836.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Brassica rapa]
 emb|CDY42378.1| BnaA08g00360D [Brassica napus]
Length=643

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 69/103 (67%), Gaps = 7/103 (7%)
 Frame = -1

Query  702  IAPDISPQEQN----ISSPKKV---DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHML  544
            I P I  +++N    IS+P +    D + PC ER+Q+LEK   E+ NKP EIP EK+ ML
Sbjct  534  ITPSIPTEDENRSRLISAPTETTMKDKIRPCLERIQELEKVYEEMRNKPVEIPVEKERML  593

Query  543  LDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            +DS++RIKS+E DL +T++ L AT  +Q+E+ E LE L+E  L
Sbjct  594  MDSLDRIKSVEFDLVKTKRVLHATVVKQMEITEMLESLRESQL  636



>ref|XP_010913311.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Elaeis guineensis]
Length=611

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 68/102 (67%), Gaps = 1/102 (1%)
 Frame = -1

Query  699  APDI-SPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRI  523
            AP++ +P+        K +   PC ERLQ+LE    EL NKP EIP EK+ +LLDS +RI
Sbjct  510  APEVPAPESHPSVEVVKENNFGPCLERLQRLELMFNELSNKPAEIPQEKERVLLDSWDRI  569

Query  522  KSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSC  397
            KSIE DL++T+K L AT  +Q+E+AE LE+++E  L+  K C
Sbjct  570  KSIEFDLEKTKKVLQATVVKQMEIAEMLEVVQESNLRRRKFC  611



>ref|XP_009106835.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Brassica rapa]
Length=644

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 69/103 (67%), Gaps = 7/103 (7%)
 Frame = -1

Query  702  IAPDISPQEQN----ISSPKKV---DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHML  544
            I P I  +++N    IS+P +    D + PC ER+Q+LEK   E+ NKP EIP EK+ ML
Sbjct  535  ITPSIPTEDENRSRLISAPTETTMKDKIRPCLERIQELEKVYEEMRNKPVEIPVEKERML  594

Query  543  LDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            +DS++RIKS+E DL +T++ L AT  +Q+E+ E LE L+E  L
Sbjct  595  MDSLDRIKSVEFDLVKTKRVLHATVVKQMEITEMLESLRESQL  637



>ref|XP_008796544.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X3 [Phoenix dactylifera]
 ref|XP_008796545.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X3 [Phoenix dactylifera]
Length=515

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = -1

Query  705  LIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNR  526
            ++ PD  P  + +    K D + PC ERLQ+LE    EL +KP EIP EKD  LLDS +R
Sbjct  417  VLTPDNHPSVEAV----KEDHVSPCLERLQRLELMCNELSSKPAEIPQEKDRALLDSWDR  472

Query  525  IKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSC  397
            IKSIE DL +T+K L AT  +Q+E+AE LE ++E  L+  K C
Sbjct  473  IKSIEFDLGKTKKVLQATVVKQMEIAEMLEAVQESNLRRRKFC  515



>ref|XP_008796540.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Phoenix dactylifera]
 ref|XP_008796542.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Phoenix dactylifera]
Length=623

 Score = 90.1 bits (222),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = -1

Query  705  LIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNR  526
            ++ PD  P  + +    K D + PC ERLQ+LE    EL +KP EIP EKD  LLDS +R
Sbjct  525  VLTPDNHPSVEAV----KEDHVSPCLERLQRLELMCNELSSKPAEIPQEKDRALLDSWDR  580

Query  525  IKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSC  397
            IKSIE DL +T+K L AT  +Q+E+AE LE ++E  L+  K C
Sbjct  581  IKSIEFDLGKTKKVLQATVVKQMEIAEMLEAVQESNLRRRKFC  623



>emb|CDY10540.1| BnaC03g70740D [Brassica napus]
Length=643

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 69/103 (67%), Gaps = 7/103 (7%)
 Frame = -1

Query  702  IAPDISPQEQN----ISSPKKV---DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHML  544
            I P I  +++N    IS+P +    D + PC ER+Q+LEK   E+ NKP EIP EK+ ML
Sbjct  534  ITPSIPTEDENSSRLISAPTETTMKDKIRPCLERIQELEKVYEEMRNKPVEIPVEKERML  593

Query  543  LDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            +DS++RIKS+E DL +T++ L AT  +Q+E+ E LE L++  L
Sbjct  594  MDSLDRIKSVEFDLVKTKRVLHATVVKQMEITEMLESLRDSQL  636



>gb|KEH22718.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=591

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 79/132 (60%), Gaps = 11/132 (8%)
 Frame = -1

Query  783  YTFFRNRIGGVCVR--NNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQL  610
            Y  F        VR  NN  R+    Q + +  + P    +++P   D+  P  +RL+ L
Sbjct  463  YVVFAALGNFFVVRSVNNQPRSHQKIQHVESSSLEP----LTTP---DIKEPIWQRLRDL  515

Query  609  EKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELL  430
            E  V E+ NKP  IP EK+ +L +S++RIK IE DLQ+TRKALLATAS+Q ELAESLE L
Sbjct  516  EAVVTEMANKPRTIPREKEDILQESLSRIKGIEFDLQKTRKALLATASKQAELAESLESL  575

Query  429  KEDTLKGTKSCW  394
            K++  K   SC+
Sbjct  576  KDN--KFDVSCY  585



>gb|KEH22716.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=599

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 79/132 (60%), Gaps = 11/132 (8%)
 Frame = -1

Query  783  YTFFRNRIGGVCVR--NNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQL  610
            Y  F        VR  NN  R+    Q + +  + P    +++P   D+  P  +RL+ L
Sbjct  471  YVVFAALGNFFVVRSVNNQPRSHQKIQHVESSSLEP----LTTP---DIKEPIWQRLRDL  523

Query  609  EKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELL  430
            E  V E+ NKP  IP EK+ +L +S++RIK IE DLQ+TRKALLATAS+Q ELAESLE L
Sbjct  524  EAVVTEMANKPRTIPREKEDILQESLSRIKGIEFDLQKTRKALLATASKQAELAESLESL  583

Query  429  KEDTLKGTKSCW  394
            K++  K   SC+
Sbjct  584  KDN--KFDVSCY  593



>ref|XP_010552329.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Tarenaya hassleriana]
Length=612

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -1

Query  675  QNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQR  496
            Q  + P   D + PC ERLQ LEK   EL NKPT IP EKD ML+DS+ RIKS+E DL++
Sbjct  518  QTHTDPAVEDRIIPCMERLQSLEKEYEELRNKPTRIPVEKDRMLMDSLERIKSVEFDLEK  577

Query  495  TRKALLATASQQVELAESLELLKE  424
            T++ L AT  +Q+E+ E LE L+E
Sbjct  578  TKRVLHATVIKQIEVTEMLERLRE  601



>ref|XP_009415954.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like [Musa acuminata subsp. malaccensis]
Length=558

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -1

Query  627  ERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELA  448
            ERLQ+LE+ V E+  KPT IP EKD M+ +S+NRI+SIEHDLQ+T+  +  T+ +Q+EL 
Sbjct  466  ERLQKLEELVTEINRKPTRIPEEKDVMIRESLNRIQSIEHDLQKTKDVVKVTSQKQIELE  525

Query  447  ESLELLKEDTLKGTKSCWLR  388
            ESL++L+E T    KSCW +
Sbjct  526  ESLDILRE-TASQVKSCWFK  544



>ref|XP_009415562.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=637

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = -1

Query  699  APDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIK  520
            A D++  + + +   K D +  C ERLQ+LE  + EL NKP EIP EK+HM+LDSM+RIK
Sbjct  522  ALDLACNKNSTTEALKEDCVTSCMERLQKLELMLNELSNKPAEIPREKEHMILDSMDRIK  581

Query  519  SIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGT  406
             +E D+ +T K L AT  +Q+E+  +LE LK+  +K T
Sbjct  582  CVEFDIHKTNKVLQATLMKQMEIEATLEALKDSDIKET  619



>ref|XP_009415563.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X3 [Musa acuminata subsp. malaccensis]
Length=633

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = -1

Query  699  APDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIK  520
            A D++  + + +   K D +  C ERLQ+LE  + EL NKP EIP EK+HM+LDSM+RIK
Sbjct  518  ALDLACNKNSTTEALKEDCVTSCMERLQKLELMLNELSNKPAEIPREKEHMILDSMDRIK  577

Query  519  SIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGT  406
             +E D+ +T K L AT  +Q+E+  +LE LK+  +K T
Sbjct  578  CVEFDIHKTNKVLQATLMKQMEIEATLEALKDSDIKET  615



>ref|XP_009147486.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Brassica rapa]
 ref|XP_009147487.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Brassica rapa]
 ref|XP_009147488.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Brassica rapa]
Length=607

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC ER+Q+LE+   E+ NKP EIP EK+ ML+DS++RIKS+E DL++T++AL AT 
Sbjct  523  DRIGPCLERIQKLERKYEEIRNKPVEIPVEKERMLMDSLDRIKSVEFDLEKTKRALHATV  582

Query  468  SQQVELAESLELLKEDTL  415
             +Q+E+ E LE ++E  L
Sbjct  583  MKQMEITEMLESIRESQL  600



>ref|XP_009415564.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X4 [Musa acuminata subsp. malaccensis]
Length=632

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = -1

Query  699  APDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIK  520
            A D++  + + +   K D +  C ERLQ+LE  + EL NKP EIP EK+HM+LDSM+RIK
Sbjct  517  ALDLACNKNSTTEALKEDCVTSCMERLQKLELMLNELSNKPAEIPREKEHMILDSMDRIK  576

Query  519  SIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGT  406
             +E D+ +T K L AT  +Q+E+  +LE LK+  +K T
Sbjct  577  CVEFDIHKTNKVLQATLMKQMEIEATLEALKDSDIKET  614



>ref|XP_009415561.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=638

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = -1

Query  699  APDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIK  520
            A D++  + + +   K D +  C ERLQ+LE  + EL NKP EIP EK+HM+LDSM+RIK
Sbjct  523  ALDLACNKNSTTEALKEDCVTSCMERLQKLELMLNELSNKPAEIPREKEHMILDSMDRIK  582

Query  519  SIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGT  406
             +E D+ +T K L AT  +Q+E+  +LE LK+  +K T
Sbjct  583  CVEFDIHKTNKVLQATLMKQMEIEATLEALKDSDIKET  620



>ref|XP_008794691.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Phoenix dactylifera]
Length=620

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            L PC ERLQ+LE    EL +KP+EIP +K+H+LL+S +RIKS+E DL+RT+K L AT  +
Sbjct  539  LSPCLERLQRLEIMFDELSSKPSEIPLDKEHVLLESWDRIKSVECDLERTKKVLQATLMK  598

Query  462  QVELAESLELLKEDTLKGTKSC  397
            Q+E+A+SLE ++E  L+  + C
Sbjct  599  QLEIADSLEAVQESNLRRRRFC  620



>ref|XP_008794692.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X3 [Phoenix dactylifera]
Length=619

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            L PC ERLQ+LE    EL +KP+EIP +K+H+LL+S +RIKS+E DL+RT+K L AT  +
Sbjct  538  LSPCLERLQRLEIMFDELSSKPSEIPLDKEHVLLESWDRIKSVECDLERTKKVLQATLMK  597

Query  462  QVELAESLELLKEDTLKGTKSC  397
            Q+E+A+SLE ++E  L+  + C
Sbjct  598  QLEIADSLEAVQESNLRRRRFC  619



>ref|XP_008794690.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Phoenix dactylifera]
Length=621

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            L PC ERLQ+LE    EL +KP+EIP +K+H+LL+S +RIKS+E DL+RT+K L AT  +
Sbjct  540  LSPCLERLQRLEIMFDELSSKPSEIPLDKEHVLLESWDRIKSVECDLERTKKVLQATLMK  599

Query  462  QVELAESLELLKEDTLKGTKSC  397
            Q+E+A+SLE ++E  L+  + C
Sbjct  600  QLEIADSLEAVQESNLRRRRFC  621



>ref|XP_008794693.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X4 [Phoenix dactylifera]
Length=618

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            L PC ERLQ+LE    EL +KP+EIP +K+H+LL+S +RIKS+E DL+RT+K L AT  +
Sbjct  537  LSPCLERLQRLEIMFDELSSKPSEIPLDKEHVLLESWDRIKSVECDLERTKKVLQATLMK  596

Query  462  QVELAESLELLKEDTLKGTKSC  397
            Q+E+A+SLE ++E  L+  + C
Sbjct  597  QLEIADSLEAVQESNLRRRRFC  618



>ref|XP_006392611.1| hypothetical protein EUTSA_v10011321mg [Eutrema salsugineum]
 gb|ESQ29897.1| hypothetical protein EUTSA_v10011321mg [Eutrema salsugineum]
Length=623

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 66/106 (62%), Gaps = 7/106 (7%)
 Frame = -1

Query  732  NRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKD  553
            N T DN +R + P  +            D + PC ER+Q+LEK   E+ NKP EIP EK+
Sbjct  518  NPTEDNNRRSLIPTSTELTMK-------DRILPCLERIQKLEKKYEEIRNKPVEIPVEKE  570

Query  552  HMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
             MLLDS++RIKS+E DL +T++ L AT  +Q+E+ E LE L+E  L
Sbjct  571  RMLLDSLDRIKSVEFDLVKTKRVLHATVMKQMEITEMLESLRESQL  616



>emb|CDY50018.1| BnaA06g00190D [Brassica napus]
Length=639

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC ER+Q+LE+   E+ NKP EIP EK+ ML+DS++RIKS+E DL++T++AL AT 
Sbjct  555  DRIGPCLERIQKLERKYEEIRNKPVEIPVEKERMLMDSLDRIKSVEFDLEKTKRALHATV  614

Query  468  SQQVELAESLELLKEDTL  415
             +Q+E+ E LE ++E  L
Sbjct  615  MKQMEITEMLESIRESQL  632



>ref|XP_010914011.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Elaeis guineensis]
Length=637

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            L PC ERLQ+LE    EL  KP EIP +K+H+LL+S +RIKS+E DL RT+K L AT  +
Sbjct  556  LSPCLERLQRLEMMFDELSCKPAEIPLDKEHLLLESWDRIKSVECDLDRTKKVLQATLMK  615

Query  462  QVELAESLELLKEDTLKGTKSC  397
            Q+E+AESLE ++E  L+  + C
Sbjct  616  QLEIAESLEAVQESNLRRRRFC  637



>ref|XP_010914005.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Elaeis guineensis]
 ref|XP_010914006.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Elaeis guineensis]
 ref|XP_010914007.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Elaeis guineensis]
 ref|XP_010914008.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Elaeis guineensis]
 ref|XP_010914009.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Elaeis guineensis]
 ref|XP_010914010.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Elaeis guineensis]
Length=638

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            L PC ERLQ+LE    EL  KP EIP +K+H+LL+S +RIKS+E DL RT+K L AT  +
Sbjct  557  LSPCLERLQRLEMMFDELSCKPAEIPLDKEHLLLESWDRIKSVECDLDRTKKVLQATLMK  616

Query  462  QVELAESLELLKEDTLKGTKSC  397
            Q+E+AESLE ++E  L+  + C
Sbjct  617  QLEIAESLEAVQESNLRRRRFC  638



>ref|XP_010914012.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X3 [Elaeis guineensis]
Length=619

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            L PC ERLQ+LE    EL  KP EIP +K+H+LL+S +RIKS+E DL RT+K L AT  +
Sbjct  538  LSPCLERLQRLEMMFDELSCKPAEIPLDKEHLLLESWDRIKSVECDLDRTKKVLQATLMK  597

Query  462  QVELAESLELLKEDTLKGTKSC  397
            Q+E+AESLE ++E  L+  + C
Sbjct  598  QLEIAESLEAVQESNLRRRRFC  619



>ref|XP_008384630.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Malus domestica]
Length=611

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 9/103 (9%)
 Frame = -1

Query  723  SDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHML  544
            S+    L +P++  QE         D + PC +RLQQLEK   EL NKP  IP EK+ ML
Sbjct  511  SNTNSHLPSPEVVSQE---------DYVQPCLQRLQQLEKVCEELNNKPASIPLEKERML  561

Query  543  LDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            +DS+ RIKS+E+DL++T++ L A A +Q+E+A  LE L+E   
Sbjct  562  MDSLERIKSVEYDLEQTKRVLHAAAVKQLEIARLLESLQESKF  604



>ref|XP_009346685.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Pyrus x bretschneideri]
Length=611

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 66/103 (64%), Gaps = 9/103 (9%)
 Frame = -1

Query  723  SDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHML  544
            S+    L +P++  QE         D + PC +RLQQLEKA  EL NKP  IP EK+ ML
Sbjct  511  SNTNSHLPSPEVVSQE---------DYVQPCLQRLQQLEKACEELNNKPALIPLEKERML  561

Query  543  LDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            +DS+ RIKS+E+DL++T++ L A A +Q+E+A  LE L+E   
Sbjct  562  MDSLERIKSVEYDLEQTKRVLHAAAVKQLEIARLLENLQESKF  604



>ref|XP_008384631.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Malus domestica]
Length=590

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 65/103 (63%), Gaps = 9/103 (9%)
 Frame = -1

Query  723  SDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHML  544
            S+    L +P++  QE         D + PC +RLQQLEK   EL NKP  IP EK+ ML
Sbjct  490  SNTNSHLPSPEVVSQE---------DYVQPCLQRLQQLEKVCEELNNKPASIPLEKERML  540

Query  543  LDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            +DS+ RIKS+E+DL++T++ L A A +Q+E+A  LE L+E   
Sbjct  541  MDSLERIKSVEYDLEQTKRVLHAAAVKQLEIARLLESLQESKF  583



>ref|XP_008353890.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Malus domestica]
 ref|XP_008353896.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Malus domestica]
 ref|XP_008353902.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Malus domestica]
Length=611

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 64/103 (62%), Gaps = 9/103 (9%)
 Frame = -1

Query  723  SDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHML  544
            S+    L AP++  QE         D + PC +RLQQLEK   EL NKP  IP EK+ ML
Sbjct  511  SNTNGHLPAPEVVSQE---------DYVRPCLQRLQQLEKVCEELKNKPAAIPLEKERML  561

Query  543  LDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            +DSM+RIKS+E+DL++T+  L A   +Q+E+A  LE L+E   
Sbjct  562  MDSMDRIKSVEYDLEQTKGVLHAAVVKQLEIARLLENLQESKF  604



>ref|NP_001168110.1| uncharacterized protein LOC100381849 [Zea mays]
 gb|ACN27113.1| unknown [Zea mays]
Length=191

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D ++PC ERL +LE    +L  KP E+P +KD  + DS +RIKSIE DLQ+T+K L A
Sbjct  105  KEDRVNPCLERLDRLESMFNQLSKKPPELPEDKDRAIQDSFDRIKSIEFDLQKTKKVLHA  164

Query  474  TASQQVELAESLELLKEDTLKGTKSC  397
            T  +Q+++AE+LE + E  L+  K C
Sbjct  165  TVIKQMQMAETLEAVTEPDLRRRKFC  190



>ref|XP_009379116.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Pyrus x bretschneideri]
 ref|XP_009379117.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Pyrus x bretschneideri]
Length=611

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 64/103 (62%), Gaps = 9/103 (9%)
 Frame = -1

Query  723  SDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHML  544
            S+    L AP++  QE         D + PC +RLQQLEK   EL NKP  IP EK+ ML
Sbjct  511  SNTNGHLPAPEVVSQE---------DFVRPCLQRLQQLEKVCEELNNKPAAIPLEKERML  561

Query  543  LDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            +DSM+RIKS+E+DL++T+  L A   +Q+E+A  L+ L+E   
Sbjct  562  MDSMDRIKSVEYDLEQTKGVLHAAVVKQLEIARLLDNLQESKF  604



>ref|XP_006857582.1| hypothetical protein AMTR_s00061p00081010 [Amborella trichopoda]
 gb|ERN19049.1| hypothetical protein AMTR_s00061p00081010 [Amborella trichopoda]
Length=129

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -1

Query  636  PCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQV  457
            PC ERLQ LE  ++EL +K   IP EK+ ML++S++RIK IEHDL++T+K L AT  +QV
Sbjct  53   PCLERLQMLEAMLSELSSKAVGIPKEKETMLMESLDRIKGIEHDLEKTKKVLHATMLKQV  112

Query  456  ELAESLELL  430
            ELA+SLE L
Sbjct  113  ELAQSLESL  121



>gb|KCW68333.1| hypothetical protein EUGRSUZ_F01995 [Eucalyptus grandis]
Length=642

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 78/128 (61%), Gaps = 5/128 (4%)
 Frame = -1

Query  783  YTFFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEK  604
            + FFR     +  + N    S+    +I  + + Q + +    + D + PC ERLQ+LEK
Sbjct  494  FAFFRLFASKLGRKRNTVHPSN----MIESNTNSQLEVVDDIDEEDHILPCIERLQKLEK  549

Query  603  AVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKE  424
            A+ EL++KP EIP EK+ MLL+S+ RIKS+E DL +T++ L AT  +Q+E+ +  E L +
Sbjct  550  ALEELIHKPAEIPLEKERMLLESLERIKSVEFDLDKTKRVLHATVMKQLEITQRWENL-Q  608

Query  423  DTLKGTKS  400
            D+ KG  S
Sbjct  609  DSSKGGSS  616



>ref|XP_006474768.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Citrus sinensis]
 gb|KDO73984.1| hypothetical protein CISIN_1g007116mg [Citrus sinensis]
Length=617

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            DL+ PC ERLQ+LEKA  EL +KP  IP EK+ ML++S+ RIKS+E DL++T+K L AT 
Sbjct  533  DLVVPCIERLQKLEKAYEELRHKPAAIPLEKEQMLVESLQRIKSVESDLEKTKKVLHATV  592

Query  468  SQQVELAESLELLKEDTL  415
             +Q E+AE+LE L++   
Sbjct  593  VKQHEIAEALENLRQSKF  610



>gb|KDO73983.1| hypothetical protein CISIN_1g007116mg [Citrus sinensis]
Length=614

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            DL+ PC ERLQ+LEKA  EL +KP  IP EK+ ML++S+ RIKS+E DL++T+K L AT 
Sbjct  530  DLVVPCIERLQKLEKAYEELRHKPAAIPLEKEQMLVESLQRIKSVESDLEKTKKVLHATV  589

Query  468  SQQVELAESLELLKEDTL  415
             +Q E+AE+LE L++   
Sbjct  590  VKQHEIAEALENLRQSKF  607



>ref|XP_008796543.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Phoenix dactylifera]
Length=620

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 65/103 (63%), Gaps = 7/103 (7%)
 Frame = -1

Query  705  LIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNR  526
            ++ PD  P  + +    K D + PC ERLQ+LE    EL +KP EIP EKD  LLDS +R
Sbjct  525  VLTPDNHPSVEAV----KEDHVSPCLERLQRLELMCNELSSKPAEIPQEKDRALLDSWDR  580

Query  525  IKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSC  397
            IKSIE DL +T+K   AT  +Q+E+AE LE ++E  L+  K C
Sbjct  581  IKSIEFDLGKTKK---ATVVKQMEIAEMLEAVQESNLRRRKFC  620



>ref|XP_009391899.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Musa acuminata subsp. malaccensis]
 ref|XP_009391900.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Musa acuminata subsp. malaccensis]
Length=610

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  675  QNISSPKKV-DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQ  499
            Q+ S+ K + D L PC ER+++LE    EL  KP EIP EK+HMLL+S +RIK +E DL+
Sbjct  517  QHSSTVKNLEDHLGPCLERIKRLEMMFDELTKKPAEIPSEKEHMLLESWDRIKHVEFDLE  576

Query  498  RTRKALLATASQQVELAESLELLKEDTLKGTKSC  397
            +T++ L AT  +Q+E AESL+ L++  L+    C
Sbjct  577  KTKRVLHATVMKQLEFAESLDALQDLKLEKRMFC  610



>ref|XP_007020322.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 ref|XP_007020323.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY11847.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
 gb|EOY11848.1| Sec14p-like phosphatidylinositol transfer family protein isoform 
1 [Theobroma cacao]
Length=627

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -1

Query  636  PCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQV  457
            PC ERLQ+LEKA  EL NKP  IP EK+ ML+DS++RIKS+E DL++T++ L A   +Q+
Sbjct  547  PCIERLQKLEKAFEELSNKPAGIPVEKEKMLMDSLDRIKSVEFDLEKTKRVLHAAVMKQL  606

Query  456  ELAESLELLKE  424
            E+AE LE ++E
Sbjct  607  EIAELLENIRE  617



>emb|CDY51073.1| BnaC06g07500D [Brassica napus]
Length=511

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC ER+ +LEK   E+ NKP EIP EK+ +L+DS++RIKS+E DL++T++AL AT 
Sbjct  427  DRIGPCLERIHKLEKKYEEIRNKPVEIPVEKERLLMDSLDRIKSVEFDLEKTKRALHATV  486

Query  468  SQQVELAESLELLKEDTL  415
             +Q+E+ E LE ++E  L
Sbjct  487  MKQMEITEMLENIRESQL  504



>ref|XP_010534824.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Tarenaya hassleriana]
Length=624

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D++ PC ERLQ+LEK   +L  KPT IP +KD ML+DS++RIKS+E DL++T++ L  T 
Sbjct  540  DMILPCLERLQKLEKEYEDLRKKPTTIPVDKDRMLMDSLDRIKSVEFDLEKTKRVLQETV  599

Query  468  SQQVELAESLELLKE  424
             +Q+E+ E LE L+E
Sbjct  600  MKQIEITEMLEKLRE  614



>ref|XP_008805533.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Phoenix dactylifera]
Length=623

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
              PC ER+Q+LE    EL +KP +IP EK+  LLDS +RIKSIE DL++T+K L AT  +
Sbjct  542  FRPCLERVQRLELMFNELSSKPAQIPQEKERALLDSWDRIKSIEFDLEKTKKVLQATVVK  601

Query  462  QVELAESLELLKEDTLKGTKSC  397
            Q+E+AE LE ++E  ++  K C
Sbjct  602  QMEIAEMLEAVQESNIRRRKFC  623



>ref|XP_008805530.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Phoenix dactylifera]
 ref|XP_008805531.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Phoenix dactylifera]
 ref|XP_008805532.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Phoenix dactylifera]
Length=625

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
              PC ER+Q+LE    EL +KP +IP EK+  LLDS +RIKSIE DL++T+K L AT  +
Sbjct  544  FRPCLERVQRLELMFNELSSKPAQIPQEKERALLDSWDRIKSIEFDLEKTKKVLQATVVK  603

Query  462  QVELAESLELLKEDTLKGTKSC  397
            Q+E+AE LE ++E  ++  K C
Sbjct  604  QMEIAEMLEAVQESNIRRRKFC  625



>ref|XP_010534825.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Tarenaya hassleriana]
Length=623

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D++ PC ERLQ+LEK   +L  KPT IP +KD ML+DS++RIKS+E DL++T++ L  T 
Sbjct  539  DMILPCLERLQKLEKEYEDLRKKPTTIPVDKDRMLMDSLDRIKSVEFDLEKTKRVLQETV  598

Query  468  SQQVELAESLELLKE  424
             +Q+E+ E LE L+E
Sbjct  599  MKQIEITEMLEKLRE  613



>ref|XP_008219183.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X2 [Prunus mume]
Length=618

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC +RLQQLEK   +L NKP  IP EK+ ML+DS++RIKS+EHDL++T++ L A  
Sbjct  535  DYVLPCLQRLQQLEKVYEDLNNKPAAIPLEKERMLMDSLDRIKSVEHDLEQTKRVLHAAV  594

Query  468  SQQVELAESLELLKEDTLKGTKSC  397
             +Q+E+A  L+ L+E   +    C
Sbjct  595  VKQLEIARLLDNLQESKFRKRPFC  618



>ref|XP_004294878.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Fragaria vesca subsp. vesca]
 ref|XP_011461554.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Fragaria vesca subsp. vesca]
Length=617

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = -1

Query  687  SPQEQNISSPKKV--DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSI  514
            S  + N S+P+ V  D + PC +RLQQLEK   EL NKP  IP EKD ML+ S++RIKS+
Sbjct  518  SITDTNSSAPEAVEEDRVLPCLQRLQQLEKVYEELSNKPATIPLEKDRMLMQSLDRIKSV  577

Query  513  EHDLQRTRKALLATASQQVELAESLELLKE  424
            E+DL++T++ L +   +QVE+A  LE L E
Sbjct  578  EYDLEQTKRVLHSAVVKQVEIANLLENLDE  607



>ref|XP_010252910.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Nelumbo nucifera]
 ref|XP_010252911.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Nelumbo nucifera]
 ref|XP_010252912.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Nelumbo nucifera]
Length=624

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 76/123 (62%), Gaps = 4/123 (3%)
 Frame = -1

Query  780  TFFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKA  601
             FF     G+  R +   TS+ E+ +  P I P    I   K+ + +HPC +RL++LE  
Sbjct  500  AFFHFLRCGLVRRPSNTHTSNLEEPI--PQIHPPASEIV--KEENHVHPCLQRLERLETL  555

Query  600  VAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKED  421
              E+  KP EIP +K+ +LL+SM+RIKS+E DL++T++ L AT  +Q+E+AE LE ++E 
Sbjct  556  FEEIRTKPVEIPLDKEQLLLESMDRIKSVEFDLEKTKRVLHATVMKQLEIAELLEGIRES  615

Query  420  TLK  412
              +
Sbjct  616  QFR  618



>ref|XP_010236016.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Brachypodium distachyon]
Length=619

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 64/100 (64%), Gaps = 0/100 (0%)
 Frame = -1

Query  696  PDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKS  517
            P +S   Q      K D ++PC ERL++LE    +L  KP EIP +KD  + DS +RIKS
Sbjct  519  PTVSGSNQADLQVVKEDRVNPCLERLERLESMCNQLSRKPPEIPQDKDRAIQDSFDRIKS  578

Query  516  IEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSC  397
            IE DL++T+K L AT  +Q+++AE+LE +K+  L+  K C
Sbjct  579  IEFDLEKTKKVLHATVIKQMQMAETLEAVKDSDLRRRKFC  618



>ref|XP_010236015.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Brachypodium distachyon]
Length=620

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 64/100 (64%), Gaps = 0/100 (0%)
 Frame = -1

Query  696  PDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKS  517
            P +S   Q      K D ++PC ERL++LE    +L  KP EIP +KD  + DS +RIKS
Sbjct  520  PTVSGSNQADLQVVKEDRVNPCLERLERLESMCNQLSRKPPEIPQDKDRAIQDSFDRIKS  579

Query  516  IEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSC  397
            IE DL++T+K L AT  +Q+++AE+LE +K+  L+  K C
Sbjct  580  IEFDLEKTKKVLHATVIKQMQMAETLEAVKDSDLRRRKFC  619



>ref|XP_002468412.1| hypothetical protein SORBIDRAFT_01g045510 [Sorghum bicolor]
 gb|EER95410.1| hypothetical protein SORBIDRAFT_01g045510 [Sorghum bicolor]
Length=621

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            VD + P  ERLQ+LE  V EL +KP  IP EK+  LLDS NRIK IE DL+RT+K L AT
Sbjct  536  VDHISPVIERLQRLEGKVDELGSKPPAIPMEKERSLLDSWNRIKCIESDLERTKKVLQAT  595

Query  471  ASQQVELAESLELLKEDTLKGTKSC  397
              +Q+E+AESLE +    L+  + C
Sbjct  596  VMKQLEIAESLEEVIRSNLRRRRFC  620



>gb|KHN01503.1| Sec14 cytosolic factor [Glycine soja]
Length=698

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -1

Query  693  DISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSI  514
            +I+     + +  + D + PC +RLQ+LEK   EL NKP  +P EK+ ML+DSM+RIKS+
Sbjct  527  NINNHSAAVETASERDYILPCVQRLQRLEKVFEELNNKPDGMPQEKEQMLMDSMDRIKSV  586

Query  513  EHDLQRTRKALLATASQQVELAESLELLKE  424
            E DL++T++ L A   +Q+E+AE LE LK+
Sbjct  587  EFDLEKTKRVLHAAVMKQLEIAELLENLKK  616



>ref|XP_009390614.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X2 [Musa acuminata subsp. malaccensis]
Length=626

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = -1

Query  684  PQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHD  505
            P    +S   K D + P  ERL++LE  + EL  KP EIP EK+H +LDSMNRIK++E D
Sbjct  531  PDNHTVSEAVKEDKVTPYIERLEKLELILNELSRKPAEIPQEKEHAILDSMNRIKNVEFD  590

Query  504  LQRTRKALLATASQQVELAESLELLKEDTLKGTKSC  397
            L +T K L +T  +Q+E+  +LE L + +++  K C
Sbjct  591  LHKTNKVLQSTVMKQLEIEATLESLNDTSVRRRKFC  626



>ref|XP_009620229.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Nicotiana tomentosiformis]
 ref|XP_009620230.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Nicotiana tomentosiformis]
Length=619

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  672  NISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRT  493
            N  + +KV   HPC +RL +LE  + E+  KP EIP EKD MLL SM+RIKS+E DL +T
Sbjct  527  NDEAVQKVREAHPCMQRLNRLENLLEEINKKPAEIPAEKDQMLLQSMDRIKSVEVDLDKT  586

Query  492  RKALLATASQQVELAESLELLKE  424
            ++ L AT  +Q+E+AE LE LKE
Sbjct  587  KRVLHATVLKQLEIAELLENLKE  609



>ref|XP_009793720.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X2 [Nicotiana sylvestris]
Length=619

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  672  NISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRT  493
            N  + +KV   HPC +RL +LE  + E+  KP EIP EKD MLL SM+RIKS+E DL +T
Sbjct  527  NDEAVQKVREAHPCMQRLNRLENLLEEINKKPAEIPAEKDQMLLQSMDRIKSVEVDLDKT  586

Query  492  RKALLATASQQVELAESLELLKE  424
            ++ L AT  +Q+E+AE LE LKE
Sbjct  587  KRVLHATVLKQLEIAELLENLKE  609



>ref|XP_009793719.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X1 [Nicotiana sylvestris]
Length=622

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -1

Query  672  NISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRT  493
            N  + +KV   HPC +RL +LE  + E+  KP EIP EKD MLL SM+RIKS+E DL +T
Sbjct  530  NDEAVQKVREAHPCMQRLNRLENLLEEINKKPAEIPAEKDQMLLQSMDRIKSVEVDLDKT  589

Query  492  RKALLATASQQVELAESLELLKE  424
            ++ L AT  +Q+E+AE LE LKE
Sbjct  590  KRVLHATVLKQLEIAELLENLKE  612



>ref|XP_004953732.1| PREDICTED: uncharacterized protein LOC101764103 isoform X5 [Setaria 
italica]
Length=617

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D ++PC ERL +LE    +L  KP E+P +KD  + DS +RIKSIE DL++T+K L AT 
Sbjct  533  DRVNPCLERLDRLESVFNQLSRKPPELPQDKDQAIQDSFDRIKSIEFDLEKTKKVLHATV  592

Query  468  SQQVELAESLELLKEDTLKGTKSC  397
             +Q+++AE+LE +KE  L+  K C
Sbjct  593  IKQMQMAETLEAVKESDLRRRKFC  616



>ref|XP_004953731.1| PREDICTED: uncharacterized protein LOC101764103 isoform X4 [Setaria 
italica]
Length=618

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D ++PC ERL +LE    +L  KP E+P +KD  + DS +RIKSIE DL++T+K L AT 
Sbjct  534  DRVNPCLERLDRLESVFNQLSRKPPELPQDKDQAIQDSFDRIKSIEFDLEKTKKVLHATV  593

Query  468  SQQVELAESLELLKEDTLKGTKSC  397
             +Q+++AE+LE +KE  L+  K C
Sbjct  594  IKQMQMAETLEAVKESDLRRRKFC  617



>ref|XP_010061396.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X2 [Eucalyptus grandis]
 ref|XP_010061397.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X2 [Eucalyptus grandis]
Length=619

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -1

Query  783  YTFFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEK  604
            + FFR     +  + N    S+    +I  + + Q + +    + D + PC ERLQ+LEK
Sbjct  494  FAFFRLFASKLGRKRNTVHPSN----MIESNTNSQLEVVDDIDEEDHILPCIERLQKLEK  549

Query  603  AVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKE  424
            A+ EL++KP EIP EK+ MLL+S+ RIKS+E DL +T++ L AT  +Q+E+ +  E L++
Sbjct  550  ALEELIHKPAEIPLEKERMLLESLERIKSVEFDLDKTKRVLHATVMKQLEITQRWENLQD  609



>ref|XP_010061395.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X1 [Eucalyptus grandis]
Length=621

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 74/120 (62%), Gaps = 4/120 (3%)
 Frame = -1

Query  783  YTFFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEK  604
            + FFR     +  + N    S+    +I  + + Q + +    + D + PC ERLQ+LEK
Sbjct  496  FAFFRLFASKLGRKRNTVHPSN----MIESNTNSQLEVVDDIDEEDHILPCIERLQKLEK  551

Query  603  AVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKE  424
            A+ EL++KP EIP EK+ MLL+S+ RIKS+E DL +T++ L AT  +Q+E+ +  E L++
Sbjct  552  ALEELIHKPAEIPLEKERMLLESLERIKSVEFDLDKTKRVLHATVMKQLEITQRWENLQD  611



>ref|XP_004156352.1| PREDICTED: uncharacterized protein LOC101229964 [Cucumis sativus]
Length=617

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC +RL++LEK   EL NKP +IP EK+H+L +S++RIKS+E DL++T++AL AT 
Sbjct  533  DFVGPCLQRLERLEKIFVELSNKPAKIPLEKEHLLTESLDRIKSVEFDLEKTKRALHATV  592

Query  468  SQQVELAESLELLKE  424
             +Q+E  E LE L++
Sbjct  593  LKQLEAGELLEKLRD  607



>ref|XP_004139763.1| PREDICTED: uncharacterized protein LOC101217583 [Cucumis sativus]
 gb|KGN44101.1| hypothetical protein Csa_7G186690 [Cucumis sativus]
Length=617

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC +RL++LEK   EL NKP +IP EK+H+L +S++RIKS+E DL++T++AL AT 
Sbjct  533  DFVGPCLQRLERLEKIFVELSNKPAKIPLEKEHLLTESLDRIKSVEFDLEKTKRALHATV  592

Query  468  SQQVELAESLELLKE  424
             +Q+E  E LE L++
Sbjct  593  LKQLEAGELLEKLRD  607



>ref|XP_006452761.1| hypothetical protein CICLE_v10010160mg, partial [Citrus clementina]
 gb|ESR66001.1| hypothetical protein CICLE_v10010160mg, partial [Citrus clementina]
Length=611

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC ERLQ+LEKA  EL +KP  IP EK+ ML++S+ RIKS+E DL++T+K L AT 
Sbjct  533  DRVVPCIERLQKLEKAYEELRHKPAAIPLEKEQMLVESLQRIKSVESDLEKTKKVLHATV  592

Query  468  SQQVELAESLELLKEDTL  415
             +Q E+AE+LE L++   
Sbjct  593  VKQHEIAEALENLRQSKF  610



>ref|XP_008219175.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X1 [Prunus mume]
Length=619

 Score = 81.6 bits (200),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC +RLQQLEK   +L NKP  IP EK+ ML+DS++RIKS+EHDL++T++ L A  
Sbjct  535  DYVLPCLQRLQQLEKVYEDLNNKPAAIPLEKERMLMDSLDRIKSVEHDLEQTKRVLHAAV  594

Query  468  SQQVELAESLELLKEDTLK  412
             +Q+E+A  L+ L+E   +
Sbjct  595  VKQLEIARLLDNLQESKFR  613



>ref|XP_008447798.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Cucumis melo]
Length=617

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC ERL++LEK   EL NKP +IP EK+H+L +S++RIKS+E DL++T++AL AT 
Sbjct  533  DFVGPCLERLERLEKIFIELSNKPAKIPLEKEHLLTESLDRIKSVEFDLEKTKRALHATV  592

Query  468  SQQVELAESLELLKE  424
             +Q+E  E LE +++
Sbjct  593  LKQLEAGELLEKIRD  607



>gb|KJB81514.1| hypothetical protein B456_013G148400 [Gossypium raimondii]
 gb|KJB81515.1| hypothetical protein B456_013G148400 [Gossypium raimondii]
Length=623

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = -1

Query  672  NISSPKKV---DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDL  502
            N++ P+ V   D + PC ERLQ+LEKA  EL NKP  IP EK+ ML++S++RIK +E+DL
Sbjct  528  NVTVPEAVNEEDHVRPCIERLQKLEKAFEELCNKPAGIPLEKEKMLMESLDRIKCVEYDL  587

Query  501  QRTRKALLATASQQVELAESLELLK  427
             +T++ L  T  +Q+E++E L+ ++
Sbjct  588  DKTKRVLHGTVMRQIEISEFLDNIR  612



>ref|NP_001047963.1| Os02g0721800 [Oryza sativa Japonica Group]
 dbj|BAD13009.1| putative phosphatidylinositol transfer [Oryza sativa Japonica 
Group]
 dbj|BAF09877.1| Os02g0721800 [Oryza sativa Japonica Group]
Length=612

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D ++PC ERL++LE    +L  KP EIP +KD  + DS +RIK IE DL++T+K L A
Sbjct  526  KEDRVNPCLERLERLETMFNQLSRKPPEIPQDKDRAIQDSFDRIKCIEFDLEKTKKVLHA  585

Query  474  TASQQVELAESLELLKEDTLKGTKSC  397
            T  +Q+++AE+LE +KE  L+  K C
Sbjct  586  TVIRQMQMAETLEAVKESDLRRRKFC  611



>gb|KHF99754.1| SEC14 cytosolic factor [Gossypium arboreum]
Length=602

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = -1

Query  672  NISSPKKV---DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDL  502
            N++ P+ V   D + PC ERLQ+LEKA  EL NKP  IP EK+ ML++S++RIK +E+DL
Sbjct  507  NVTVPEAVNEEDHVRPCIERLQKLEKAFEELCNKPAGIPLEKEKMLMESLDRIKCVEYDL  566

Query  501  QRTRKALLATASQQVELAESLELLK  427
             +T++ L  T  +Q+E++E L+ ++
Sbjct  567  DKTKRVLHGTVMRQIEISEFLDNIR  591



>gb|KJB81518.1| hypothetical protein B456_013G148400 [Gossypium raimondii]
Length=626

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = -1

Query  672  NISSPKKV---DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDL  502
            N++ P+ V   D + PC ERLQ+LEKA  EL NKP  IP EK+ ML++S++RIK +E+DL
Sbjct  531  NVTVPEAVNEEDHVRPCIERLQKLEKAFEELCNKPAGIPLEKEKMLMESLDRIKCVEYDL  590

Query  501  QRTRKALLATASQQVELAESLELLK  427
             +T++ L  T  +Q+E++E L+ ++
Sbjct  591  DKTKRVLHGTVMRQIEISEFLDNIR  615



>ref|XP_008643964.1| PREDICTED: uncharacterized protein LOC100381849 isoform X2 [Zea 
mays]
 gb|AFW73185.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=616

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D ++PC ERL +LE    +L  KP E+P +KD  + DS +RIKSIE DLQ+T+K L A
Sbjct  530  KEDRVNPCLERLDRLESMFNQLSKKPPELPEDKDRAIQDSFDRIKSIEFDLQKTKKVLHA  589

Query  474  TASQQVELAESLELLKEDTLKGTKSC  397
            T  +Q+++AE+LE + E  L+  K C
Sbjct  590  TVIKQMQMAETLEAVTEPDLRRRKFC  615



>gb|KJB81516.1| hypothetical protein B456_013G148400 [Gossypium raimondii]
Length=625

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = -1

Query  672  NISSPKKV---DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDL  502
            N++ P+ V   D + PC ERLQ+LEKA  EL NKP  IP EK+ ML++S++RIK +E+DL
Sbjct  528  NVTVPEAVNEEDHVRPCIERLQKLEKAFEELCNKPAGIPLEKEKMLMESLDRIKCVEYDL  587

Query  501  QRTRKALLATASQQVELAESLELLK  427
             +T++ L  T  +Q+E++E L+ ++
Sbjct  588  DKTKRVLHGTVMRQIEISEFLDNIR  612



>ref|XP_008643963.1| PREDICTED: uncharacterized protein LOC100381849 isoform X1 [Zea 
mays]
 gb|AFW73186.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=617

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D ++PC ERL +LE    +L  KP E+P +KD  + DS +RIKSIE DLQ+T+K L A
Sbjct  531  KEDRVNPCLERLDRLESMFNQLSKKPPELPEDKDRAIQDSFDRIKSIEFDLQKTKKVLHA  590

Query  474  TASQQVELAESLELLKEDTLKGTKSC  397
            T  +Q+++AE+LE + E  L+  K C
Sbjct  591  TVIKQMQMAETLEAVTEPDLRRRKFC  616



>ref|XP_006647810.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Oryza brachyantha]
Length=619

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D ++PC ERL++LE    +L  KP EIP +KD  + DS +RIK IE DL++T+K L A
Sbjct  533  KEDHVNPCLERLERLESMFNQLSRKPPEIPQDKDRAIRDSFDRIKCIEFDLEKTKKVLHA  592

Query  474  TASQQVELAESLELLKEDTLKGTKSC  397
            T  +Q+++AE+LE +KE  L+  K C
Sbjct  593  TVIRQMQMAETLEAVKESDLRRRKFC  618



>gb|KHN20565.1| SEC14 cytosolic factor [Glycine soja]
Length=605

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = -1

Query  693  DISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSI  514
            +I+     + +  + D + PC +RLQ+LEK   EL NKP  +P EK+ ML+DSM+RIKS+
Sbjct  489  NINNYSATVETASERDYVLPCVQRLQRLEKVFEELNNKPDGMPQEKEQMLMDSMDRIKSV  548

Query  513  EHDLQRTRKALLATASQQVELAESLELLKE  424
            E DL++T++ L A   +Q+E+ E LE LK+
Sbjct  549  EFDLEKTKRVLHAAVMKQLEIVELLENLKK  578



>ref|XP_004973243.1| PREDICTED: uncharacterized protein LOC101786635 isoform X2 [Setaria 
italica]
Length=628

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            VD + P  ERLQ+LE  V EL +KP EIP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  543  VDHISPIIERLQRLEGKVDELGSKPPEIPLEKERSLLESWDRIKCIESDLERTKKVLQAT  602

Query  471  ASQQVELAESLELLKEDTLKGTKSC  397
              +Q+E+AESLE +    L+  + C
Sbjct  603  VMKQLEIAESLEEVIRSNLRRRRFC  627



>ref|XP_010481194.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Camelina sativa]
Length=217

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -1

Query  660  PKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKAL  481
            P   D + PC ER+Q+LEK   ++ NKP  IP EK+ ML+DS++RIKS+E DL +T++ L
Sbjct  128  PTMKDRILPCLERIQKLEKTYEDIRNKPVAIPVEKERMLMDSLDRIKSVEFDLDKTKRLL  187

Query  480  LATASQQVELAESLELLKEDTL  415
             AT  +Q+E+ E L+ L++  L
Sbjct  188  HATVMKQMEITEMLQSLRDSQL  209



>ref|XP_003526390.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Glycine max]
 ref|XP_006582422.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Glycine max]
Length=620

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = -1

Query  693  DISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSI  514
            +I+     + +  + D + PC +RLQ+LEK   EL NKP  +P EK+ ML+DSM+RIKS+
Sbjct  521  NINNYSATVETASERDYVLPCVQRLQRLEKVFEELNNKPDGMPQEKEQMLMDSMDRIKSV  580

Query  513  EHDLQRTRKALLATASQQVELAESLELLKE  424
            E DL++T++ L A   +Q+E+ E LE LK+
Sbjct  581  EFDLEKTKRVLHAAVMKQLEIVELLENLKK  610



>ref|XP_004973242.1| PREDICTED: uncharacterized protein LOC101786635 isoform X1 [Setaria 
italica]
Length=630

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            VD + P  ERLQ+LE  V EL +KP EIP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  545  VDHISPIIERLQRLEGKVDELGSKPPEIPLEKERSLLESWDRIKCIESDLERTKKVLQAT  604

Query  471  ASQQVELAESLELLKEDTLKGTKSC  397
              +Q+E+AESLE +    L+  + C
Sbjct  605  VMKQLEIAESLEEVIRSNLRRRRFC  629



>ref|XP_002531776.1| transporter, putative [Ricinus communis]
 gb|EEF30632.1| transporter, putative [Ricinus communis]
Length=618

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  705  LIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNR  526
            L+ PD       + +  + D + PC ERL++LEK V E+ N+P  IP EK+ ML++S+ R
Sbjct  516  LVEPDAGSHSIAVETESE-DHIRPCIERLERLEKVVEEIGNRPAAIPLEKEQMLMESLER  574

Query  525  IKSIEHDLQRTRKALLATASQQVELAESLELLKE  424
            IKS+E DL++T+K L AT  +Q+E+A+ L+ L+E
Sbjct  575  IKSVEFDLEKTKKVLHATIIKQLEIADLLDNLRE  608



>ref|XP_007208038.1| hypothetical protein PRUPE_ppa002925mg [Prunus persica]
 gb|EMJ09237.1| hypothetical protein PRUPE_ppa002925mg [Prunus persica]
Length=621

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC +RLQQLEK   +L NKP  IP EK+ ML+DS++RIKS+EHDL++T++ L +  
Sbjct  537  DYVLPCLQRLQQLEKVYEDLNNKPAAIPLEKERMLMDSLDRIKSVEHDLEQTKRVLHSAV  596

Query  468  SQQVELAESLELLKEDTLK  412
             +Q+E+A+ L+ L+E   +
Sbjct  597  VKQLEIAKLLDNLQESKFR  615



>ref|NP_001061591.1| Os08g0341700 [Oryza sativa Japonica Group]
 dbj|BAD01712.1| phosphatidylinositol transfer-like [Oryza sativa Japonica Group]
 dbj|BAF23505.1| Os08g0341700 [Oryza sativa Japonica Group]
Length=637

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            VD + P  ERLQ+LE  V EL NKP EIP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  552  VDRISPVIERLQRLEGKVDELGNKPPEIPLEKERSLLESWDRIKCIESDLERTKKVLQAT  611

Query  471  ASQQVELAESLE  436
              +Q+E+AES+E
Sbjct  612  VMKQLEIAESIE  623



>ref|XP_002268040.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Vitis vinifera]
 emb|CBI39799.3| unnamed protein product [Vitis vinifera]
Length=621

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D + PC +RLQ +EK   EL NKP EIP EK+ +LL+S++RIKS+E DL++T++ L A
Sbjct  535  KEDPILPCIQRLQSIEKKFEELRNKPAEIPFEKEQILLESLDRIKSVEFDLEKTKRVLHA  594

Query  474  TASQQVELAESLELLKEDTLK  412
            T  +++E+AE LE L++   +
Sbjct  595  TVMKELEIAELLENLRQSKFR  615



>gb|EEC83416.1| hypothetical protein OsI_28876 [Oryza sativa Indica Group]
Length=630

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            VD + P  ERLQ+LE  V EL NKP EIP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  543  VDRISPVIERLQRLEGKVDELGNKPPEIPLEKERSLLESWDRIKCIESDLERTKKVLQAT  602

Query  471  ASQQVELAESLE  436
              +Q+E+AES+E
Sbjct  603  VMKQLEIAESIE  614



>gb|EEE68525.1| hypothetical protein OsJ_26967 [Oryza sativa Japonica Group]
Length=581

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            VD + P  ERLQ+LE  V EL NKP EIP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  494  VDRISPVIERLQRLEGKVDELGNKPPEIPLEKERSLLESWDRIKCIESDLERTKKVLQAT  553

Query  471  ASQQVELAESLE  436
              +Q+E+AES+E
Sbjct  554  VMKQLEIAESIE  565



>ref|XP_007148649.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris]
 ref|XP_007148650.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris]
 ref|XP_007148651.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris]
 gb|ESW20643.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris]
 gb|ESW20644.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris]
 gb|ESW20645.1| hypothetical protein PHAVU_005G003600g [Phaseolus vulgaris]
Length=621

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -1

Query  636  PCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQV  457
            PC +RLQ++EK   EL NKP  +P EK+ ML+DSM+RIKS+E DL++T++ L AT  +Q+
Sbjct  541  PCIQRLQRIEKIFEELNNKPDGMPQEKEKMLMDSMDRIKSVEFDLEKTKRVLHATVIKQL  600

Query  456  ELAESLELLKE  424
            E+AE LE LK+
Sbjct  601  EIAELLENLKK  611



>ref|XP_002894519.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70778.1| SEC14 cytosolic factor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=624

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 70/107 (65%), Gaps = 9/107 (8%)
 Frame = -1

Query  711  QRLIAPDISPQEQN-----ISSPKK---VDLLHPCCERLQQLEKAVAELLNKPTEIPPEK  556
            Q  ++P  SP E +     IS+P++    D + PC ER+Q+LEK   ++ NKP  IP EK
Sbjct  511  QTTVSPS-SPTEDDSRCSFISAPREPTMKDRILPCLERIQELEKCYEDIRNKPVSIPVEK  569

Query  555  DHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            + ML+DS++RIKS+E DL +T++ L AT  +Q+E+ E L+ L+E  L
Sbjct  570  ERMLMDSLDRIKSVEFDLDKTKRLLHATVMKQMEINEMLQNLRESQL  616



>gb|KJB42480.1| hypothetical protein B456_007G154800 [Gossypium raimondii]
Length=574

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -1

Query  678  EQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQ  499
            E  I +  + DLL PC +RLQ LE  V +L NKP  IPPEK+ MLL+S+NRIKS+E DLQ
Sbjct  494  ENGILTEAEEDLLRPCWQRLQNLETMVTKLYNKPANIPPEKEDMLLESLNRIKSMEQDLQ  553

Query  498  RTRKALLA  475
            RT+K   +
Sbjct  554  RTKKGKFS  561



>gb|EMS55272.1| Sec14 cytosolic factor [Triticum urartu]
Length=669

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            VDL+ P  ERLQ+LE  V EL +KP EIP EK+  LLDS +RIK IE DL+RT+K L AT
Sbjct  521  VDLVSPVIERLQKLEGRVDELGSKPPEIPLEKERSLLDSWDRIKCIESDLERTKKVLQAT  580

Query  471  ASQQVELAESLE  436
              +Q+E+A+S++
Sbjct  581  VMKQLEIADSID  592



>gb|KJB42483.1| hypothetical protein B456_007G154800 [Gossypium raimondii]
Length=564

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = -1

Query  678  EQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQ  499
            E  I +  + DLL PC +RLQ LE  V +L NKP  IPPEK+ MLL+S+NRIKS+E DLQ
Sbjct  494  ENGILTEAEEDLLRPCWQRLQNLETMVTKLYNKPANIPPEKEDMLLESLNRIKSMEQDLQ  553

Query  498  RTRKA  484
            RT+K 
Sbjct  554  RTKKV  558



>ref|XP_006659343.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Oryza brachyantha]
Length=637

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
             D + P  ERLQ+LE  V EL NKP EIP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  552  ADNISPVIERLQRLEGKVDELGNKPREIPLEKERSLLESWDRIKCIESDLERTKKVLQAT  611

Query  471  ASQQVELAESLELLKEDTLKGTKSC  397
              +Q+E+AES+E +    L+  + C
Sbjct  612  VMKQLEIAESIEEVIRSQLRRRRFC  636



>ref|XP_002452636.1| hypothetical protein SORBIDRAFT_04g029580 [Sorghum bicolor]
 gb|EES05612.1| hypothetical protein SORBIDRAFT_04g029580 [Sorghum bicolor]
Length=616

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D ++PC ERL +LE    +L  KP E+P +KD  + DS +RIKSIE DL++T+K L A
Sbjct  530  KEDRVNPCLERLDRLESMFNQLSRKPPELPQDKDRAIQDSFDRIKSIEFDLEKTKKVLHA  589

Query  474  TASQQVELAESLELLKEDTLKGTKSC  397
            T  +Q+++AE+LE + E  L+  K C
Sbjct  590  TVIKQMQMAETLEAVTEPDLRRRKFC  615



>ref|XP_010501188.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Camelina sativa]
 ref|XP_010501189.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Camelina sativa]
Length=624

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -1

Query  660  PKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKAL  481
            P   D + PC ER+Q+LEK+  ++ NKP  IP EK+ ML+DS++RIKS+E DL +T++ L
Sbjct  535  PTMKDRILPCLERIQKLEKSYEDIRNKPVAIPVEKERMLMDSLDRIKSVEFDLDKTKRLL  594

Query  480  LATASQQVELAESLELLKEDTL  415
             AT  +Q+E+ E L+ L++  L
Sbjct  595  HATVMKQMEITEMLQSLRDSQL  616



>ref|XP_004244003.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X1 [Solanum lycopersicum]
 ref|XP_010324225.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X2 [Solanum lycopersicum]
 ref|XP_010324226.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X1 [Solanum lycopersicum]
Length=620

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -1

Query  672  NISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRT  493
            N  + ++V  +HPC +RL +LE  + E+  KP EIP EKD ML  S+NRIKS+E DL++T
Sbjct  528  NDEAVQRVREIHPCMQRLHKLENLLEEINKKPAEIPAEKDRMLHQSLNRIKSVEVDLEKT  587

Query  492  RKALLATASQQVELAESLELLKEDTL  415
            ++ L AT  +Q+E+ E L+ LKE + 
Sbjct  588  KRVLHATVLKQLEITELLDNLKESSF  613



>gb|AAF79506.1|AC002328_14 F20N2.11 [Arabidopsis thaliana]
Length=636

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = -1

Query  720  DNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLL  541
            D+   LI+P   P+E     P   D + PC ER+Q+LEK+  ++ NKP  IP EK+ ML+
Sbjct  538  DSRCSLISP--PPRE-----PTMKDRILPCLERIQKLEKSYEDIRNKPVAIPVEKERMLM  590

Query  540  DSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            DS++RIKS+E DL +T++ L AT  +Q+E+ E L+ +++  L
Sbjct  591  DSLDRIKSVEFDLDKTKRLLHATVMKQMEITEMLQNIRDSQL  632



>ref|XP_009390610.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009390611.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009390613.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 isoform X1 [Musa acuminata subsp. malaccensis]
Length=637

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 0/91 (0%)
 Frame = -1

Query  684  PQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHD  505
            P    +S   K D + P  ERL++LE  + EL  KP EIP EK+H +LDSMNRIK++E D
Sbjct  531  PDNHTVSEAVKEDKVTPYIERLEKLELILNELSRKPAEIPQEKEHAILDSMNRIKNVEFD  590

Query  504  LQRTRKALLATASQQVELAESLELLKEDTLK  412
            L +T K L +T  +Q+E+  +LE L + +++
Sbjct  591  LHKTNKVLQSTVMKQLEIEATLESLNDTSVR  621



>ref|XP_010480110.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Camelina sativa]
 ref|XP_010480111.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Camelina sativa]
 ref|XP_010480112.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13 [Camelina sativa]
Length=624

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -1

Query  660  PKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKAL  481
            PK  D + PC ER+Q+LEK+  ++ NKP  IP  K+ ML+DS++RIKS+E DL +T++ L
Sbjct  535  PKMKDRILPCLERIQKLEKSYDDIRNKPVAIPVGKERMLMDSLDRIKSVEFDLDKTKRLL  594

Query  480  LATASQQVELAESLELLKEDTL  415
             AT  +Q+E+ E L+ L++  L
Sbjct  595  HATVMKQMEITEMLQSLRDSQL  616



>ref|XP_010462424.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Camelina sativa]
Length=649

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -1

Query  660  PKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKAL  481
            PK  D + PC ER+Q+LEK+  ++ NKP  IP  K+ ML+DS++RIKS+E DL +T++ L
Sbjct  560  PKMKDRILPCLERIQKLEKSYDDIRNKPVAIPVGKERMLMDSLDRIKSVEFDLDKTKRLL  619

Query  480  LATASQQVELAESLELLKEDTL  415
             AT  +Q+E+ E L+ L++  L
Sbjct  620  HATVMKQMEITEMLQSLRDSQL  641



>ref|NP_849815.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 ref|NP_849816.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 sp|Q501H5.1|SFH13_ARATH RecName: Full=Phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13; AltName: Full=Protein SEC FOURTEEN HOMOLOGS 
13; Short=AtSFH13 [Arabidopsis thaliana]
 gb|AAY25404.1| At1g55690 [Arabidopsis thaliana]
 gb|ACI46507.1| At1g55690 [Arabidopsis thaliana]
 gb|AEE33284.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 gb|AEE33286.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=625

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = -1

Query  720  DNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLL  541
            D+   LI+P   P+E     P   D + PC ER+Q+LEK+  ++ NKP  IP EK+ ML+
Sbjct  523  DSRCSLISP--PPRE-----PTMKDRILPCLERIQKLEKSYEDIRNKPVAIPVEKERMLM  575

Query  540  DSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            DS++RIKS+E DL +T++ L AT  +Q+E+ E L+ +++  L
Sbjct  576  DSLDRIKSVEFDLDKTKRLLHATVMKQMEITEMLQNIRDSQL  617



>ref|XP_010462425.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Camelina sativa]
Length=624

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -1

Query  660  PKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKAL  481
            PK  D + PC ER+Q+LEK+  ++ NKP  IP  K+ ML+DS++RIKS+E DL +T++ L
Sbjct  535  PKMKDRILPCLERIQKLEKSYDDIRNKPVAIPVGKERMLMDSLDRIKSVEFDLDKTKRLL  594

Query  480  LATASQQVELAESLELLKEDTL  415
             AT  +Q+E+ E L+ L++  L
Sbjct  595  HATVMKQMEITEMLQSLRDSQL  616



>ref|NP_175965.2| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
 gb|AEE33285.1| Sec14p-like phosphatidylinositol transfer family protein [Arabidopsis 
thaliana]
Length=621

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 67/102 (66%), Gaps = 7/102 (7%)
 Frame = -1

Query  720  DNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLL  541
            D+   LI+P   P+E     P   D + PC ER+Q+LEK+  ++ NKP  IP EK+ ML+
Sbjct  523  DSRCSLISP--PPRE-----PTMKDRILPCLERIQKLEKSYEDIRNKPVAIPVEKERMLM  575

Query  540  DSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTL  415
            DS++RIKS+E DL +T++ L AT  +Q+E+ E L+ +++  L
Sbjct  576  DSLDRIKSVEFDLDKTKRLLHATVMKQMEITEMLQNIRDSQL  617



>ref|NP_001131503.1| uncharacterized protein LOC100192840 [Zea mays]
 gb|ACF79939.1| unknown [Zea mays]
Length=303

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            VD + P  ERLQ+LE  V EL +KP  IP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  218  VDHISPVIERLQRLEGKVDELGSKPPAIPVEKERSLLESWDRIKCIESDLERTKKVLQAT  277

Query  471  ASQQVELAESLELLKEDTLKGTKSC  397
              +Q+E AESLE +   +L   + C
Sbjct  278  VRKQLESAESLEEVIRSSLPRRRFC  302



>ref|XP_006346082.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Solanum tuberosum]
 ref|XP_006346083.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Solanum tuberosum]
 ref|XP_006346084.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X3 [Solanum tuberosum]
Length=620

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -1

Query  672  NISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRT  493
            N  + ++V  +HPC +RL +LE  + E+  KP EIP EKD ML  S+NRIKS+E DL++T
Sbjct  528  NDEAVQRVREIHPCMQRLHKLENLLEEINKKPAEIPAEKDRMLHQSLNRIKSVEVDLEKT  587

Query  492  RKALLATASQQVELAESLELLKEDTL  415
            ++ L AT  +Q+E+ E ++ LKE + 
Sbjct  588  KRVLHATVLKQLEITELVDNLKESSF  613



>gb|KDP36319.1| hypothetical protein JCGZ_09534 [Jatropha curcas]
Length=619

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQ  463
            + PC ERLQ+LEK   +L NKP  IP EK+ ML++S+ RIKS+E DL++T++ + A   +
Sbjct  537  VRPCMERLQRLEKVFEQLSNKPGAIPLEKEQMLMESLERIKSVEFDLEKTKRLVQAAVVK  596

Query  462  QVELAESLELLKE  424
            Q+E+AESL+ L+E
Sbjct  597  QLEIAESLDNLRE  609



>ref|XP_009399525.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Musa acuminata subsp. malaccensis]
 ref|XP_009399526.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Musa acuminata subsp. malaccensis]
Length=620

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 66/117 (56%), Gaps = 0/117 (0%)
 Frame = -1

Query  747  VRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEI  568
             R+  +R  +N     A  + P   + +   K D + P  ERL++LE  + EL  KP EI
Sbjct  504  FRSRPDRRLENVHPSDALSLIPDNNSTTEAAKEDKVTPLIERLEKLESMLNELSRKPAEI  563

Query  567  PPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDTLKGTKSC  397
            P EK+H + +SMNRIKS+E DL +T K L AT  +Q+E+  +LE L   ++   K C
Sbjct  564  PQEKEHAIRESMNRIKSVEFDLHKTNKVLQATLMKQLEIEATLETLNGKSIGRRKFC  620



>ref|XP_009395896.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X3 [Musa acuminata subsp. malaccensis]
 ref|XP_009395897.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X3 [Musa acuminata subsp. malaccensis]
Length=618

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = -1

Query  630  CERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVEL  451
             ERLQ+LE  + EL NKP EIP EK+HM+LDS++RIK +E+DL +T K L A   +Q E+
Sbjct  542  VERLQKLELIMNELSNKPAEIPQEKEHMILDSIDRIKCVEYDLHKTNKVLQAAVMKQTEI  601

Query  450  AESLELLKEDTLKGTKSC  397
              +LE L++  ++G K C
Sbjct  602  EATLEALEDSNIRG-KFC  618



>gb|EMT15866.1| hypothetical protein F775_32793 [Aegilops tauschii]
Length=569

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D ++PC ERL++LE    +L  KP EIP +KD  + DS +RIKSIE DL++T+K L A
Sbjct  483  KEDRVNPCLERLERLESMCNQLSRKPPEIPQDKDRAIQDSFDRIKSIEFDLEKTKKVLHA  542

Query  474  TASQQVELAESLELLKEDTLKGTKSC  397
            T  +Q+++AE+LE + E   +  K C
Sbjct  543  TVIKQMQMAETLESVTESGHRRRKFC  568



>ref|XP_009395894.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=619

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = -1

Query  630  CERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVEL  451
             ERLQ+LE  + EL NKP EIP EK+HM+LDS++RIK +E+DL +T K L A   +Q E+
Sbjct  543  VERLQKLELIMNELSNKPAEIPQEKEHMILDSIDRIKCVEYDLHKTNKVLQAAVMKQTEI  602

Query  450  AESLELLKEDTLKGTKSC  397
              +LE L++  ++G K C
Sbjct  603  EATLEALEDSNIRG-KFC  619



>ref|XP_009395892.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009395895.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=619

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = -1

Query  630  CERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVEL  451
             ERLQ+LE  + EL NKP EIP EK+HM+LDS++RIK +E+DL +T K L A   +Q E+
Sbjct  543  VERLQKLELIMNELSNKPAEIPQEKEHMILDSIDRIKCVEYDLHKTNKVLQAAVMKQTEI  602

Query  450  AESLELLKEDTLKGTKSC  397
              +LE L++  ++G K C
Sbjct  603  EATLEALEDSNIRG-KFC  619



>gb|EEE57707.1| hypothetical protein OsJ_08188 [Oryza sativa Japonica Group]
Length=637

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D ++PC ERL++LE    +L  KP EIP +KD  + DS +RIK IE DL++T+K L A
Sbjct  547  KEDRVNPCLERLERLETMFNQLSRKPPEIPQDKDRAIQDSFDRIKCIEFDLEKTKKVLHA  606

Query  474  TASQQVELAESLELLKEDTLK  412
            T  +Q+++AE+LE +KE  L+
Sbjct  607  TVIRQMQMAETLEAVKESDLR  627



>ref|XP_009405089.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH9-like [Musa acuminata subsp. malaccensis]
Length=544

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = -1

Query  636  PCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQV  457
            PC ERLQ LE+ V EL  KP  +P EKD+M+LDS+N I+ IEHDLQ+T   +  T+ +QV
Sbjct  472  PCLERLQMLEELVTELNEKPERVPQEKDNMILDSLNHIQPIEHDLQKTNNVVQVTSQKQV  531

Query  456  ELAESLELLK  427
            E+ +SL+ L+
Sbjct  532  EMKDSLQNLR  541



>ref|XP_009407911.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=615

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D L PC ERLQ+LE    EL NK  EIP EK+ +LL+S +RIK +E DL++T++ L AT 
Sbjct  532  DRLSPCLERLQRLEMMFDELTNKHAEIPFEKERVLLESWDRIKHVEFDLEKTKRVLHATV  591

Query  468  SQQVELAESLELLKEDTLKGTKSC  397
             +Q+++AESL+ +++  L+    C
Sbjct  592  MKQLDIAESLDAMQDLKLRKRIFC  615



>ref|XP_009407913.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X3 [Musa acuminata subsp. malaccensis]
Length=610

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D L PC ERLQ+LE    EL NK  EIP EK+ +LL+S +RIK +E DL++T++ L AT 
Sbjct  527  DRLSPCLERLQRLEMMFDELTNKHAEIPFEKERVLLESWDRIKHVEFDLEKTKRVLHATV  586

Query  468  SQQVELAESLELLKEDTLKGTKSC  397
             +Q+++AESL+ +++  L+    C
Sbjct  587  MKQLDIAESLDAMQDLKLRKRIFC  610



>ref|XP_009407912.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=614

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D L PC ERLQ+LE    EL NK  EIP EK+ +LL+S +RIK +E DL++T++ L AT 
Sbjct  531  DRLSPCLERLQRLEMMFDELTNKHAEIPFEKERVLLESWDRIKHVEFDLEKTKRVLHATV  590

Query  468  SQQVELAESLELLKEDTLKGTKSC  397
             +Q+++AESL+ +++  L+    C
Sbjct  591  MKQLDIAESLDAMQDLKLRKRIFC  614



>gb|EEC73905.1| hypothetical protein OsI_08738 [Oryza sativa Indica Group]
Length=758

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D ++PC ERL++LE    +L  KP EIP +KD  + DS +RIK IE DL++T+K L A
Sbjct  668  KEDRVNPCLERLERLETMFNQLSRKPPEIPQDKDRAIQDSFDRIKCIEFDLEKTKKVLHA  727

Query  474  TASQQVELAESLELLKEDTLK  412
            T  +Q+++AE+LE +KE  L+
Sbjct  728  TVIRQMQMAETLEAVKESDLR  748



>gb|KJB10160.1| hypothetical protein B456_001G187000 [Gossypium raimondii]
Length=587

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  642  LHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALL  478
            LHPC +RLQ LE  V +L NKP  IPPEK+ MLL+S++RIKSIE DLQRT+K  L
Sbjct  510  LHPCWQRLQSLESLVTDLCNKPINIPPEKEDMLLESLSRIKSIEQDLQRTKKVRL  564



>gb|EYU33746.1| hypothetical protein MIMGU_mgv1a002979mg [Erythranthe guttata]
Length=619

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC +RLQ+LE  + E+  KP EIP EK+ +LL SM+RIKS+E DL++TR+AL +T 
Sbjct  535  DRVLPCVQRLQKLENLLKEIDKKPAEIPVEKEQLLLRSMDRIKSVEFDLEKTRRALNSTV  594

Query  468  SQQVELAESLELLKEDTL  415
             +Q E+AE LE ++E   
Sbjct  595  LKQHEIAELLENIRESKF  612



>ref|XP_011000369.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Populus euphratica]
Length=610

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC ERLQ+LEK   EL NKP  IP EKD ML +S+ RIKS+E DL++T++ L  T 
Sbjct  526  DHVRPCIERLQRLEKIFEELSNKPAGIPLEKDKMLTESLERIKSVEFDLEKTKRVLHTTV  585

Query  468  SQQVELAESLELLKE  424
             +Q+++ E L+ L+E
Sbjct  586  VKQLQITELLDNLRE  600



>ref|XP_006307003.1| hypothetical protein CARUB_v10008581mg [Capsella rubella]
 gb|EOA39901.1| hypothetical protein CARUB_v10008581mg [Capsella rubella]
Length=626

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -1

Query  660  PKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKAL  481
            P   D + PC ER+Q+LEK+  ++ NKP  IP EK+ ML+DS+ RIKS+E DL +T++ L
Sbjct  537  PTMKDRILPCLERIQKLEKSYEDIRNKPVAIPVEKERMLMDSLERIKSVEFDLDKTKRLL  596

Query  480  LATASQQVELAESLELLKEDTL  415
              T  +Q+E+ E L+ L++  L
Sbjct  597  HVTVMKQMEITEMLQSLRDSQL  618



>ref|XP_011000368.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Populus euphratica]
Length=615

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC ERLQ+LEK   EL NKP  IP EKD ML +S+ RIKS+E DL++T++ L  T 
Sbjct  531  DHVRPCIERLQRLEKIFEELSNKPAGIPLEKDKMLTESLERIKSVEFDLEKTKRVLHTTV  590

Query  468  SQQVELAESLELLKE  424
             +Q+++ E L+ L+E
Sbjct  591  VKQLQITELLDNLRE  605



>ref|XP_008676497.1| PREDICTED: uncharacterized protein LOC100192840 isoform X2 [Zea 
mays]
Length=628

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            VD + P  ERLQ+LE  V EL +KP  IP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  543  VDHISPVIERLQRLEGKVDELGSKPPAIPVEKERSLLESWDRIKCIESDLERTKKVLQAT  602

Query  471  ASQQVELAESLELLKEDTLKGTKSC  397
              +Q+E AESLE +   +L   + C
Sbjct  603  VRKQLESAESLEEVIRSSLPRRRFC  627



>gb|EYU27505.1| hypothetical protein MIMGU_mgv1a003158mg [Erythranthe guttata]
Length=604

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC +RLQ+LE  + EL  KP EIP EKD +L  S++RIK +E+DL++T++ L AT 
Sbjct  520  DTVRPCVQRLQRLESLLEELNKKPAEIPVEKDQVLQQSLDRIKCVEYDLEKTKRVLQATV  579

Query  468  SQQVELAESLELLKEDTLK  412
             +Q+++AE LE ++E   +
Sbjct  580  LKQIQIAELLENMRESKFQ  598



>ref|XP_008676494.1| PREDICTED: uncharacterized protein LOC100192840 isoform X1 [Zea 
mays]
 ref|XP_008676495.1| PREDICTED: uncharacterized protein LOC100192840 isoform X1 [Zea 
mays]
 ref|XP_008676496.1| PREDICTED: uncharacterized protein LOC100192840 isoform X1 [Zea 
mays]
Length=630

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            VD + P  ERLQ+LE  V EL +KP  IP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  545  VDHISPVIERLQRLEGKVDELGSKPPAIPVEKERSLLESWDRIKCIESDLERTKKVLQAT  604

Query  471  ASQQVELAESLELLKEDTLKGTKSC  397
              +Q+E AESLE +   +L   + C
Sbjct  605  VRKQLESAESLEEVIRSSLPRRRFC  629



>ref|XP_010092396.1| hypothetical protein L484_023775 [Morus notabilis]
 gb|EXB51072.1| hypothetical protein L484_023775 [Morus notabilis]
Length=793

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC +RLQ+LEK   EL NKP  IP EK+ +L++S +RIK++E +L++T++ L AT 
Sbjct  538  DRIRPCIQRLQRLEKVFEELSNKPAGIPLEKEKILMESFDRIKNVEFELEKTKRVLHATV  597

Query  468  SQQVELAESLELLKEDTLK  412
             +Q+E+ E LE LK+   +
Sbjct  598  VKQLEITELLEKLKDSNFR  616



>gb|AFW61940.1| putative CRAL/TRIO domain containing, Sec14p-like phosphatidylinositol 
transfer family protein [Zea mays]
Length=621

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            VD + P  ERLQ+LE  V EL +KP  IP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  536  VDHISPVIERLQRLEGKVDELGSKPPAIPVEKERSLLESWDRIKCIESDLERTKKVLQAT  595

Query  471  ASQQVELAESLELLKEDTLKGTKSC  397
              +Q+E AESLE +   +L   + C
Sbjct  596  VRKQLESAESLEEVIRSSLPRRRFC  620



>dbj|BAK04393.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            +D + P  ERLQ+LE  V EL +KP EIP EK+  LLDS +RIK IE DL+RT+K L AT
Sbjct  407  MDRVSPVIERLQKLEGRVDELGSKPPEIPVEKERSLLDSWDRIKCIESDLERTKKVLQAT  466

Query  471  ASQQVELAESLE  436
              +Q+E+A+S++
Sbjct  467  VMKQLEIADSID  478



>ref|XP_003573800.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Brachypodium distachyon]
 ref|XP_010234634.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Brachypodium distachyon]
 ref|XP_010234635.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Brachypodium distachyon]
 ref|XP_010234636.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Brachypodium distachyon]
Length=633

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            +D + P  ERLQ+LE  V EL +KP EIP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  548  LDHISPVIERLQRLEGRVDELGSKPPEIPLEKERSLLESWDRIKCIESDLERTKKVLQAT  607

Query  471  ASQQVELAESLE  436
              +Q+E+AES+E
Sbjct  608  VMKQLEIAESIE  619



>dbj|BAJ96309.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=630

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            +D + P  ERLQ+LE  V EL +KP EIP EK+  LLDS +RIK IE DL+RT+K L AT
Sbjct  545  MDRVSPVIERLQKLEGRVDELGSKPPEIPVEKERSLLDSWDRIKCIESDLERTKKVLQAT  604

Query  471  ASQQVELAESLE  436
              +Q+E+A+S++
Sbjct  605  VMKQLEIADSID  616



>ref|XP_010234637.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Brachypodium distachyon]
Length=631

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  651  VDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLAT  472
            +D + P  ERLQ+LE  V EL +KP EIP EK+  LL+S +RIK IE DL+RT+K L AT
Sbjct  546  LDHISPVIERLQRLEGRVDELGSKPPEIPLEKERSLLESWDRIKCIESDLERTKKVLQAT  605

Query  471  ASQQVELAESLE  436
              +Q+E+AES+E
Sbjct  606  VMKQLEIAESIE  617



>gb|EMS45796.1| hypothetical protein TRIUR3_25550 [Triticum urartu]
Length=530

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -1

Query  654  KVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLA  475
            K D ++PC ERL++LE    +L  KP EIP +KD  + DS +RIKSIE DL++T+K L A
Sbjct  443  KEDRVNPCLERLERLESMCNQLSRKPPEIPQDKDRAIQDSFDRIKSIEFDLEKTKKVLHA  502

Query  474  TASQQVELAESLELLKE  424
            T  +Q+++AE+LE + E
Sbjct  503  TVIKQMQMAETLESVTE  519



>ref|XP_006378002.1| SEC14 cytosolic factor family protein [Populus trichocarpa]
 gb|ERP55799.1| SEC14 cytosolic factor family protein [Populus trichocarpa]
Length=620

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -1

Query  657  KKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALL  478
            K+ D + PC ERLQ+LEK   E+ NKP  IP EK+ ML +S+ RIKS+E DL++T++ L 
Sbjct  523  KEEDHVRPCIERLQRLEKIFEEVSNKPAGIPLEKEKMLTESLERIKSVEFDLEKTKRVLH  582

Query  477  ATASQQVELAESLELLKE  424
             T  +Q+E+ E L+ L+E
Sbjct  583  TTVVKQLEITELLDNLRE  600



>ref|XP_006599218.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Glycine max]
Length=619

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 73/122 (60%), Gaps = 15/122 (12%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSP-----KKVDLLHPCCERLQQ  613
            FFR+      +R    RT +N    I P ++ +  N  +       + D +  C +RL++
Sbjct  483  FFRS------LRLEFWRTQNN----IYPSVAMEHNNNPAAASEILSERDHILRCMQRLER  532

Query  612  LEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLEL  433
            LEK   EL +KP  IP EK+HML +S++RIKS+E DL++T++ L AT  +Q+E+AE LE 
Sbjct  533  LEKTFGELSHKPAGIPLEKEHMLTNSLDRIKSVEFDLEKTKRVLHATVMKQLEIAELLEN  592

Query  432  LK  427
            L+
Sbjct  593  LQ  594



>gb|KHN10116.1| Sec14 cytosolic factor [Glycine soja]
Length=611

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 73/122 (60%), Gaps = 15/122 (12%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSP-----KKVDLLHPCCERLQQ  613
            FFR+      +R    RT +N    I P ++ +  N  +       + D +  C +RL++
Sbjct  487  FFRS------LRLEFWRTQNN----IYPSVAMEHNNNPAAASEILSERDHILRCMQRLER  536

Query  612  LEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLEL  433
            LEK   EL +KP  IP EK+HML +S++RIKS+E DL++T++ L AT  +Q+E+AE LE 
Sbjct  537  LEKTFGELSHKPAGIPLEKEHMLTNSLDRIKSVEFDLEKTKRVLHATVMKQLEIAELLEN  596

Query  432  LK  427
            L+
Sbjct  597  LQ  598



>gb|KEH20296.1| Sec14p-like phosphatidylinositol transfer family protein [Medicago 
truncatula]
Length=604

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -1

Query  675  QNISSPKKVDLLHPCC-ERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQ  499
            ++I +P + D + P   ERL++LEKA  EL ++P EIP EK+ ML+ S++RIKS+E DL+
Sbjct  510  EDIKTPSEEDHILPSIQERLRKLEKAFVELSHRPAEIPMEKEKMLMSSLDRIKSVEFDLE  569

Query  498  RTRKALLATASQQVELAESLELLK  427
             T++ +  T  +QVE+AE LE LK
Sbjct  570  NTKRVVHDTVMKQVEIAELLENLK  593



>emb|CDP13647.1| unnamed protein product [Coffea canephora]
Length=599

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -1

Query  636  PCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQV  457
            PC +RLQ+LEK + EL NK  EIP EK+ ML  SM+RIK +E DL++T++ L AT  +Q+
Sbjct  519  PCVQRLQRLEKLLEELNNKRHEIPMEKEQMLQQSMDRIKCVEMDLEKTKRVLHATVVKQL  578

Query  456  ELAESLELLKEDTLKGTK  403
            E+ E LE ++E   +  K
Sbjct  579  EITELLESIRESKFRQRK  596



>ref|XP_006659538.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X1 [Oryza brachyantha]
 ref|XP_006659539.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X2 [Oryza brachyantha]
Length=604

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 58/89 (65%), Gaps = 4/89 (4%)
 Frame = -1

Query  684  PQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHD  505
            PQ ++I    + D +  C +RL  LE   + L ++P EIP EK+HMLL+S  RIK IE D
Sbjct  511  PQPRSI----RDDDMTACLQRLDNLESLCSHLASRPPEIPKEKEHMLLNSFERIKCIEAD  566

Query  504  LQRTRKALLATASQQVELAESLELLKEDT  418
            L+RT++AL AT  +Q  L E+LE ++E +
Sbjct  567  LERTKRALHATVVKQKSLVETLEAVQESS  595



>gb|EMS66418.1| hypothetical protein TRIUR3_29583 [Triticum urartu]
Length=734

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 62/93 (67%), Gaps = 5/93 (5%)
 Frame = -1

Query  684  PQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHD  505
            PQ + IS+    D +  C +R++ LE     L +KP E+P +K+  LL+S  RI+SIE D
Sbjct  543  PQPRTISA----DEMSACLQRIENLESVCNHLASKPPEMPEDKEQQLLNSFERIRSIEAD  598

Query  504  LQRTRKALLATASQQVELAESLELLKEDT-LKG  409
            L+RT++AL AT ++Q  LAE+LE ++E + +KG
Sbjct  599  LERTKRALHATVAKQNSLAETLEAVQESSRVKG  631



>ref|XP_011097694.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like [Sesamum indicum]
Length=620

 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC +RLQ+LE  + EL  KP EIP EK+ +L  S++RIKS+E DL +T++AL +T 
Sbjct  536  DRVLPCVQRLQRLETLLEELNKKPVEIPLEKEQLLTRSLDRIKSVEFDLDKTKRALNSTV  595

Query  468  SQQVELAESLELLKEDTL  415
             +Q E+AE LE ++E   
Sbjct  596  LKQHEIAELLEKMRESKF  613



>gb|EMT12573.1| hypothetical protein F775_09187 [Aegilops tauschii]
Length=554

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 58/89 (65%), Gaps = 4/89 (4%)
 Frame = -1

Query  684  PQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHD  505
            PQ + I +    D +  C +R++ LE     L +KP E+P +K+  LL+S  RI+SIE D
Sbjct  452  PQPRTIGA----DEMSACLQRIENLESVCNHLASKPPEMPEDKEQQLLNSFERIRSIEAD  507

Query  504  LQRTRKALLATASQQVELAESLELLKEDT  418
            L+RT++AL AT ++Q  LAE+LE ++E +
Sbjct  508  LERTKRALHATVAKQNSLAETLEAVQESS  536



>ref|XP_006352563.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Solanum tuberosum]
Length=626

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  636  PCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQV  457
            PC ERL +LE    E+  KP EIP EKD M+  SM RIKS+E DL +T++ L     +Q+
Sbjct  546  PCMERLHKLEMLFEEIKRKPAEIPAEKDQMIQQSMERIKSVEVDLDKTKRVLHTAVVKQL  605

Query  456  ELAESLELLKEDT  418
            E+AE LE LK+ +
Sbjct  606  EIAELLENLKQSS  618



>ref|XP_006352564.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Solanum tuberosum]
Length=621

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  636  PCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQV  457
            PC ERL +LE    E+  KP EIP EKD M+  SM RIKS+E DL +T++ L     +Q+
Sbjct  541  PCMERLHKLEMLFEEIKRKPAEIPAEKDQMIQQSMERIKSVEVDLDKTKRVLHTAVVKQL  600

Query  456  ELAESLELLKEDT  418
            E+AE LE LK+ +
Sbjct  601  EIAELLENLKQSS  613



>ref|XP_006352565.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X3 [Solanum tuberosum]
Length=620

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -1

Query  636  PCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQV  457
            PC ERL +LE    E+  KP EIP EKD M+  SM RIKS+E DL +T++ L     +Q+
Sbjct  540  PCMERLHKLEMLFEEIKRKPAEIPAEKDQMIQQSMERIKSVEVDLDKTKRVLHTAVVKQL  599

Query  456  ELAESLELLKEDT  418
            E+AE LE LK+ +
Sbjct  600  EIAELLENLKQSS  612



>gb|KJB81517.1| hypothetical protein B456_013G148400 [Gossypium raimondii]
Length=613

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 49/68 (72%), Gaps = 3/68 (4%)
 Frame = -1

Query  672  NISSPKKV---DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDL  502
            N++ P+ V   D + PC ERLQ+LEKA  EL NKP  IP EK+ ML++S++RIK +E+DL
Sbjct  528  NVTVPEAVNEEDHVRPCIERLQKLEKAFEELCNKPAGIPLEKEKMLMESLDRIKCVEYDL  587

Query  501  QRTRKALL  478
             +T++  L
Sbjct  588  DKTKRVWL  595



>ref|XP_003598312.1| SEC14 cytosolic factor [Medicago truncatula]
Length=604

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -1

Query  669  ISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTR  490
            I S  + D + PC +RLQ+LEK   EL NKP  +P EK+ ML++S++RIKS+E DL++T+
Sbjct  486  IESTSERDYILPCEQRLQRLEKVFNELNNKPDGMPLEKEQMLMESLDRIKSVEFDLEKTK  545

Query  489  KALLATASQQVEL  451
            + L A   +Q+E+
Sbjct  546  RVLHAAVMKQLEI  558



>ref|XP_006392610.1| hypothetical protein EUTSA_v10011321mg [Eutrema salsugineum]
 gb|ESQ29896.1| hypothetical protein EUTSA_v10011321mg [Eutrema salsugineum]
Length=594

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 7/84 (8%)
 Frame = -1

Query  732  NRTSDNEQRLIAPDISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKD  553
            N T DN +R + P  +            D + PC ER+Q+LEK   E+ NKP EIP EK+
Sbjct  518  NPTEDNNRRSLIPTSTELTMK-------DRILPCLERIQKLEKKYEEIRNKPVEIPVEKE  570

Query  552  HMLLDSMNRIKSIEHDLQRTRKAL  481
             MLLDS++RIKS+E DL +T++ L
Sbjct  571  RMLLDSLDRIKSVEFDLVKTKRVL  594



>gb|EEC83813.1| hypothetical protein OsI_29745 [Oryza sativa Indica Group]
Length=571

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  633  CCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVE  454
            C +RL  LE     L ++P EIP EK+HMLL+S  RIK IE DL+RT++ L AT  +Q  
Sbjct  491  CLQRLDSLESLCNHLASRPPEIPREKEHMLLNSFERIKCIEADLERTKRVLHATVVKQKA  550

Query  453  LAESLELLKEDT  418
            L E+LE ++E +
Sbjct  551  LVETLEAVQESS  562



>gb|EEE68935.1| hypothetical protein OsJ_27809 [Oryza sativa Japonica Group]
Length=571

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  633  CCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVE  454
            C +RL  LE     L ++P EIP EK+HMLL+S  RIK IE DL+RT++ L AT  +Q  
Sbjct  491  CLQRLDSLESLCNHLASRPPEIPREKEHMLLNSFERIKCIEADLERTKRVLHATVVKQKA  550

Query  453  LAESLELLKEDT  418
            L E+LE ++E +
Sbjct  551  LVETLEAVQESS  562



>ref|NP_001062139.1| Os08g0497300 [Oryza sativa Japonica Group]
 dbj|BAD08712.1| putative phosphatidylinositol- phosphatidylcholine transfer protein 
[Oryza sativa Japonica Group]
 dbj|BAF24053.1| Os08g0497300 [Oryza sativa Japonica Group]
 dbj|BAG91848.1| unnamed protein product [Oryza sativa Japonica Group]
Length=604

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = -1

Query  633  CCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVE  454
            C +RL  LE     L ++P EIP EK+HMLL+S  RIK IE DL+RT++ L AT  +Q  
Sbjct  524  CLQRLDSLESLCNHLASRPPEIPREKEHMLLNSFERIKCIEADLERTKRVLHATVVKQKA  583

Query  453  LAESLELLKEDT  418
            L E+LE ++E +
Sbjct  584  LVETLEAVQESS  595



>dbj|BAJ98447.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86826.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=605

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 70/125 (56%), Gaps = 12/125 (10%)
 Frame = -1

Query  783  YTFFRNRIGGVCVRNNLNRTSDNEQRLIAPDIS---PQEQNISSPKKVDLLHPCCERLQQ  613
            ++FFR  I    VR       +N    I P  +   PQ + IS+    D +  C  R++ 
Sbjct  481  FSFFRLFISSRTVRR-----LENAHPSIMPVPAAEKPQPRTISA----DDMSACLRRIEN  531

Query  612  LEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLEL  433
            LE     L +KP E+P +K+  LL+S+ RI+SIE DL+RT++AL  T ++Q  L E+LE 
Sbjct  532  LESVCNHLASKPPEMPEDKEKQLLNSLERIRSIEADLERTKRALQVTVAKQNSLVETLEA  591

Query  432  LKEDT  418
            ++E +
Sbjct  592  VQESS  596



>ref|XP_010327215.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Solanum lycopersicum]
 ref|XP_010327216.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Solanum lycopersicum]
 ref|XP_010327217.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Solanum lycopersicum]
Length=619

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 62/113 (55%), Gaps = 16/113 (14%)
 Frame = -1

Query  738  NLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLH------PCCERLQQLEKAVAELLNKP  577
            N +RTS  E+R          Q  SS    +++H      PC ERL +LE    E+  KP
Sbjct  509  NASRTSALEER----------QESSSSAYGEVVHKSDEALPCMERLHKLEMLFEEIKRKP  558

Query  576  TEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDT  418
             EIP EKD M+  S+ RIKS+E DL + ++ L     +Q+E+AE LE LK+ +
Sbjct  559  AEIPAEKDQMIQQSLERIKSVEVDLDKAKRVLHTAVVKQLEIAELLENLKQSS  611



>ref|XP_010327218.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Solanum lycopersicum]
Length=618

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 62/113 (55%), Gaps = 16/113 (14%)
 Frame = -1

Query  738  NLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLH------PCCERLQQLEKAVAELLNKP  577
            N +RTS  E+R          Q  SS    +++H      PC ERL +LE    E+  KP
Sbjct  508  NASRTSALEER----------QESSSSAYGEVVHKSDEALPCMERLHKLEMLFEEIKRKP  557

Query  576  TEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLELLKEDT  418
             EIP EKD M+  S+ RIKS+E DL + ++ L     +Q+E+AE LE LK+ +
Sbjct  558  AEIPAEKDQMIQQSLERIKSVEVDLDKAKRVLHTAVVKQLEIAELLENLKQSS  610



>ref|XP_006660747.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like [Oryza brachyantha]
Length=606

 Score = 68.9 bits (167),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D +  C +RL++LE     L +KP ++P EK+H+LL S +RIKSIE DL+RT++ L  T 
Sbjct  519  DGISACLQRLEKLESLGNHLASKPPDMPKEKEHLLLQSFDRIKSIEADLERTKRVLHMTL  578

Query  468  SQQVELAESLELLKE  424
             +Q+E+ E+LE +++
Sbjct  579  VKQMEMMETLEAMQQ  593



>emb|CAJ75628.1| SEC14 cytosolic factor (secretion factor 14) family protein [Brachypodium 
sylvaticum]
Length=151

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 57/89 (64%), Gaps = 4/89 (4%)
 Frame = -1

Query  684  PQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHD  505
            PQ + IS     D +  C +R++ LE    +L +KP EIP +K+ +L +S  RI+SIE D
Sbjct  60   PQPRTISD----DDMIACLQRIENLESLCNQLASKPPEIPEDKEQILQNSFERIRSIEAD  115

Query  504  LQRTRKALLATASQQVELAESLELLKEDT  418
            L+RT++ L AT ++Q  L E+LE ++E +
Sbjct  116  LERTKRVLHATVAKQQSLVETLEAVQESS  144



>ref|XP_004962618.1| PREDICTED: SEC14 cytosolic factor-like [Setaria italica]
Length=506

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = -1

Query  666  SSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRK  487
              P   D   PC ERL++LE  V EL  +   IPPEK+ ++ +SM RI+SIE D+++T++
Sbjct  411  GGPTDKDCTAPCLERLKRLENMVMELNQRSPRIPPEKEDLIEESMRRIRSIECDIKKTQR  470

Query  486  ALLATASQQVELAESLELLKEDTLKGTKSC  397
            AL  T+ +Q +L + +E  KE  L  T SC
Sbjct  471  ALNRTSLKQQKLEQRVENWKESML--TNSC  498



>ref|XP_011095638.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X1 [Sesamum indicum]
Length=658

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC +RLQ+LE  + +L +KP EIP EKD +L  S++RIK +E DL+ T++ L    
Sbjct  574  DRILPCVQRLQRLESLLEQLNSKPAEIPIEKDQILQQSLDRIKCVEFDLENTKRVLDTAV  633

Query  468  SQQVELAESLELLKE  424
             +Q+++A+ LE ++E
Sbjct  634  LKQLQIADLLENMRE  648



>gb|EAZ45138.1| hypothetical protein OsJ_29776 [Oryza sativa Japonica Group]
Length=573

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D +  C +RL++LE     L++KP ++P EK+ +LL S +RIK+IE DL+RT++ L  T 
Sbjct  485  DNMSACLQRLEKLESLCNHLMSKPPDMPKEKECLLLQSFDRIKTIESDLERTKRVLHMTL  544

Query  468  SQQVELAESLELLK  427
             +Q+E+ E+LE ++
Sbjct  545  VKQMEMMETLEAMQ  558



>gb|EEC84766.1| hypothetical protein OsI_31788 [Oryza sativa Indica Group]
Length=582

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = -1

Query  693  DISPQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSI  514
            ++  + Q  S+P+  D +  C +RL++LE     L++KP ++P EK+ +LL S +RIK+I
Sbjct  476  NVEDEPQPRSAPE--DNMSACLQRLEKLESLCNHLMSKPPDMPKEKECLLLQSFDRIKTI  533

Query  513  EHDLQRTRKALLATASQQVELAESLELLK  427
            E DL+RT++ L  T  +Q+E+ E+LE ++
Sbjct  534  ESDLERTKRVLHMTLVKQMEMMETLEAMQ  562



>ref|XP_011095639.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH13-like isoform X2 [Sesamum indicum]
Length=616

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D + PC +RLQ+LE  + +L +KP EIP EKD +L  S++RIK +E DL+ T++ L    
Sbjct  532  DRILPCVQRLQRLESLLEQLNSKPAEIPIEKDQILQQSLDRIKCVEFDLENTKRVLDTAV  591

Query  468  SQQVELAESLELLKE  424
             +Q+++A+ LE ++E
Sbjct  592  LKQLQIADLLENMRE  606



>ref|NP_001063492.1| Os09g0481100 [Oryza sativa Japonica Group]
 dbj|BAD33395.1| putative phosphatidylinositol transfer-like protein II| [Oryza 
sativa Japonica Group]
 dbj|BAD46342.1| putative phosphatidylinositol transfer-like protein II [Oryza 
sativa Japonica Group]
 dbj|BAF25406.1| Os09g0481100 [Oryza sativa Japonica Group]
Length=611

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATA  469
            D +  C +RL++LE     L++KP ++P EK+ +LL S +RIK+IE DL+RT++ L  T 
Sbjct  523  DNMSACLQRLEKLESLCNHLMSKPPDMPKEKECLLLQSFDRIKTIESDLERTKRVLHMTL  582

Query  468  SQQVELAESLELLK  427
             +Q+E+ E+LE ++
Sbjct  583  VKQMEMMETLEAMQ  596



>ref|XP_007156281.1| hypothetical protein PHAVU_003G273400g [Phaseolus vulgaris]
 gb|ESW28275.1| hypothetical protein PHAVU_003G273400g [Phaseolus vulgaris]
Length=646

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 16/123 (13%)
 Frame = -1

Query  777  FFRNRIGGVCVRNNLNRTSDNEQRLIAPDISPQEQNISSPKKVDLLHP------CCERLQ  616
            FFR+      +R    RT +N    I P ++ + +N S     + +          +RL+
Sbjct  521  FFRS------LRLEFWRTQNN----IYPSVAMEHENNSLTAASETVSERNHILQFTQRLE  570

Query  615  QLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLE  436
             LEK   EL +KP  IP EK+ ML+ S++RIK +E DL +T++ L AT  +Q E+AE +E
Sbjct  571  ILEKTFGELSHKPAGIPLEKEQMLMSSLDRIKCVEFDLDKTKRVLHATVMKQFEIAELVE  630

Query  435  LLK  427
             L+
Sbjct  631  NLR  633



>ref|XP_010235277.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH8-like isoform X2 [Brachypodium distachyon]
Length=591

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 56/89 (63%), Gaps = 4/89 (4%)
 Frame = -1

Query  684  PQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHD  505
            PQ + IS     D +  C +R++ LE    +L +KP EIP +K+ +L +S  RI+SIE D
Sbjct  498  PQPRTISD----DDMIACLQRIENLESLCNQLASKPPEIPEDKEQILQNSFERIRSIEAD  553

Query  504  LQRTRKALLATASQQVELAESLELLKEDT  418
            L+RT++ L +T ++Q  L E LE ++E +
Sbjct  554  LERTKRVLHSTLAKQQSLVERLEAVQESS  582



>ref|XP_010235275.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X1 [Brachypodium distachyon]
 ref|XP_010235276.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH6-like isoform X1 [Brachypodium distachyon]
Length=606

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 56/89 (63%), Gaps = 4/89 (4%)
 Frame = -1

Query  684  PQEQNISSPKKVDLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHD  505
            PQ + IS     D +  C +R++ LE    +L +KP EIP +K+ +L +S  RI+SIE D
Sbjct  513  PQPRTISD----DDMIACLQRIENLESLCNQLASKPPEIPEDKEQILQNSFERIRSIEAD  568

Query  504  LQRTRKALLATASQQVELAESLELLKEDT  418
            L+RT++ L +T ++Q  L E LE ++E +
Sbjct  569  LERTKRVLHSTLAKQQSLVERLEAVQESS  597



>ref|XP_002299075.2| hypothetical protein POPTR_0001s47530g [Populus trichocarpa]
 gb|EEE83880.2| hypothetical protein POPTR_0001s47530g [Populus trichocarpa]
Length=622

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 4/79 (5%)
 Frame = -1

Query  648  DLLHPCCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTR----KAL  481
            D + PC  RLQ+LEK   EL  +P  IP EK+ ML +S+ RIKS+E DL++T+    + L
Sbjct  534  DHVRPCIYRLQRLEKIYEELSKRPAVIPLEKEKMLTESLERIKSVESDLEKTKTLCSQVL  593

Query  480  LATASQQVELAESLELLKE  424
              T  +Q+E+A+ L+ L+E
Sbjct  594  HTTVVKQLEIAKLLDNLRE  612



>ref|XP_010536782.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH14 isoform X1 [Tarenaya hassleriana]
Length=569

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = -1

Query  708  RLIAPDISPQEQNISSPKKVDLLHP--------CCERLQQLEKAVAELLNKPTEIPPEKD  553
            +L+AP       N     ++D+ +P        C +RLQ+LE  + EL  KP  IP EK+
Sbjct  458  KLVAPSRFLWPCNCRRNSQIDMSNPLDRSRILQCVDRLQRLEIELEELKKKPVTIPSEKE  517

Query  552  HMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLE  436
             +L++S+ RIK++E DL +T++ +  T S+Q+ + E+LE
Sbjct  518  KLLMESLERIKTLEQDLDKTKRVVNDTISKQLNITEALE  556



>ref|XP_010536783.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer 
protein SFH14 isoform X2 [Tarenaya hassleriana]
Length=565

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 59/99 (60%), Gaps = 8/99 (8%)
 Frame = -1

Query  708  RLIAPDISPQEQNISSPKKVDLLHP--------CCERLQQLEKAVAELLNKPTEIPPEKD  553
            +L+AP       N     ++D+ +P        C +RLQ+LE  + EL  KP  IP EK+
Sbjct  454  KLVAPSRFLWPCNCRRNSQIDMSNPLDRSRILQCVDRLQRLEIELEELKKKPVTIPSEKE  513

Query  552  HMLLDSMNRIKSIEHDLQRTRKALLATASQQVELAESLE  436
             +L++S+ RIK++E DL +T++ +  T S+Q+ + E+LE
Sbjct  514  KLLMESLERIKTLEQDLDKTKRVVNDTISKQLNITEALE  552



>ref|XP_004973803.1| PREDICTED: uncharacterized protein LOC101785974 isoform X1 [Setaria 
italica]
 ref|XP_004973804.1| PREDICTED: uncharacterized protein LOC101785974 isoform X2 [Setaria 
italica]
 ref|XP_004973805.1| PREDICTED: uncharacterized protein LOC101785974 isoform X3 [Setaria 
italica]
Length=608

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -1

Query  633  CCERLQQLEKAVAELLNKPTEIPPEKDHMLLDSMNRIKSIEHDLQRTRKALLATASQQVE  454
            C +RL  LE     L  KP +IP +K+ +LL S  RIKS+E DL+RT++ L AT ++Q  
Sbjct  528  CLQRLDNLESLCNHLATKPPQIPEDKELVLLSSFERIKSVEADLERTKRVLNATVAKQKS  587

Query  453  LAESLELLKEDT  418
            L E+LE ++E +
Sbjct  588  LVEALESVQESS  599



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1659957175625