BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038P17

Length=863
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU38112.1|  hypothetical protein MIMGU_mgv1a0013162mg               217   7e-67   Erythranthe guttata [common monkey flower]
ref|XP_004158630.1|  PREDICTED: serine/threonine-protein phosphat...    219   2e-65   
gb|EPS64063.1|  serine/threonine-protein phosphatase                    214   6e-65   Genlisea aurea
gb|KGN47886.1|  hypothetical protein Csa_6G409920                       220   7e-65   Cucumis sativus [cucumbers]
gb|KJB22565.1|  hypothetical protein B456_004G054500                    218   6e-63   Gossypium raimondii
ref|XP_010070326.1|  PREDICTED: serine/threonine-protein phosphat...    223   8e-63   Eucalyptus grandis [rose gum]
ref|XP_007050742.1|  BRI1 suppressor 1 (BSU1)-like 1                    221   5e-62   
emb|CDP03570.1|  unnamed protein product                                220   6e-62   Coffea canephora [robusta coffee]
ref|XP_008449460.1|  PREDICTED: serine/threonine-protein phosphat...    220   8e-62   Cucumis melo [Oriental melon]
ref|XP_008777710.1|  PREDICTED: serine/threonine-protein phosphat...    216   8e-62   
ref|XP_009593091.1|  PREDICTED: serine/threonine-protein phosphat...    220   8e-62   Nicotiana tomentosiformis
ref|XP_009778415.1|  PREDICTED: serine/threonine-protein phosphat...    220   8e-62   Nicotiana sylvestris
gb|KJB22563.1|  hypothetical protein B456_004G054500                    218   8e-62   Gossypium raimondii
ref|XP_006366382.1|  PREDICTED: serine/threonine-protein phosphat...    209   9e-62   
ref|NP_001169882.1|  uncharacterized protein LOC100383776               205   1e-61   
ref|XP_004140092.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    220   1e-61   
emb|CAC11128.1|  protein phosphatase                                    207   1e-61   Fagus sylvatica
ref|XP_010279479.1|  PREDICTED: serine/threonine-protein phosphat...    219   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010522673.1|  PREDICTED: serine/threonine-protein phosphat...    219   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_010522672.1|  PREDICTED: serine/threonine-protein phosphat...    219   3e-61   Tarenaya hassleriana [spider flower]
gb|KJB22561.1|  hypothetical protein B456_004G054500                    218   3e-61   Gossypium raimondii
gb|KJB22560.1|  hypothetical protein B456_004G054500                    219   3e-61   Gossypium raimondii
gb|KHG21887.1|  Serine/threonine-protein phosphatase BSL1               218   3e-61   Gossypium arboreum [tree cotton]
gb|AEK86563.1|  serine/threonine-protein phosphatase                    218   3e-61   Camellia sinensis [black tea]
gb|KJB22562.1|  hypothetical protein B456_004G054500                    218   3e-61   Gossypium raimondii
gb|KHG21886.1|  Serine/threonine-protein phosphatase BSL1               218   4e-61   Gossypium arboreum [tree cotton]
ref|XP_011082512.1|  PREDICTED: serine/threonine-protein phosphat...    218   4e-61   Sesamum indicum [beniseed]
dbj|BAK04150.1|  predicted protein                                      207   5e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010684726.1|  PREDICTED: serine/threonine-protein phosphat...    214   1e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011033645.1|  PREDICTED: serine/threonine-protein phosphat...    213   2e-59   Populus euphratica
ref|XP_011033646.1|  PREDICTED: serine/threonine-protein phosphat...    213   2e-59   Populus euphratica
ref|XP_010556798.1|  PREDICTED: serine/threonine-protein phosphat...    211   8e-59   Tarenaya hassleriana [spider flower]
gb|KDO87444.1|  hypothetical protein CISIN_1g002713mg                   206   1e-58   Citrus sinensis [apfelsine]
ref|NP_192217.2|  serine/threonine-protein phosphatase BSL1             211   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007201214.1|  hypothetical protein PRUPE_ppa001177mg             211   1e-58   Prunus persica
gb|AFN44702.1|  Ser/Thr phosphatase-containing Kelch repeat domai...    206   1e-58   Nicotiana benthamiana
gb|AAC79097.1|  putative phospho-ser/thr phosphatase                    211   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008234964.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    211   2e-58   Prunus mume [ume]
ref|XP_009385028.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX97296.1|  BnaA02g20870D                                          210   2e-58   
gb|AFN44700.1|  Ser/Thr phosphatase-containing Kelch repeat domai...    210   3e-58   Solanum tuberosum [potatoes]
emb|CDY17964.1|  BnaC03g30360D                                          210   3e-58   Brassica napus [oilseed rape]
ref|XP_006286760.1|  hypothetical protein CARUB_v10003201mg             210   3e-58   Capsella rubella
emb|CDX90906.1|  BnaA03g25860D                                          210   3e-58   
ref|XP_006396534.1|  hypothetical protein EUTSA_v10028417mg             210   3e-58   Eutrema salsugineum [saltwater cress]
ref|XP_009144526.1|  PREDICTED: serine/threonine-protein phosphat...    210   3e-58   Brassica rapa
ref|XP_010422504.1|  PREDICTED: serine/threonine-protein phosphat...    210   3e-58   
ref|XP_010455968.1|  PREDICTED: serine/threonine-protein phosphat...    210   3e-58   
ref|XP_009134374.1|  PREDICTED: serine/threonine-protein phosphat...    210   3e-58   Brassica rapa
emb|CDY62088.1|  BnaC02g46770D                                          210   3e-58   Brassica napus [oilseed rape]
ref|XP_010430668.1|  PREDICTED: serine/threonine-protein phosphat...    210   4e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010231727.1|  PREDICTED: serine/threonine-protein phosphat...    209   4e-58   Brachypodium distachyon [annual false brome]
ref|XP_002872798.1|  kelch repeat-containing serine/threonine pho...    209   4e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_010231726.1|  PREDICTED: serine/threonine-protein phosphat...    209   4e-58   Brachypodium distachyon [annual false brome]
ref|XP_003568959.1|  PREDICTED: serine/threonine-protein phosphat...    209   5e-58   Brachypodium distachyon [annual false brome]
ref|XP_006654987.1|  PREDICTED: serine/threonine-protein phosphat...    209   8e-58   
emb|CAC09573.1|  protein phosphatase 1 (PP1)                            193   1e-57   Fagus sylvatica
ref|NP_001054625.1|  Os05g0144400                                       208   1e-57   
gb|EEE62303.1|  hypothetical protein OsJ_17091                          208   1e-57   Oryza sativa Japonica Group [Japonica rice]
gb|AAM83219.1|  AT4g03080/T4I9_4                                        208   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003591594.1|  Serine/threonine protein phosphatase               201   1e-57   
gb|EMS55151.1|  Serine/threonine-protein phosphatase BSL1-like pr...    207   2e-57   Triticum urartu
gb|KDO87443.1|  hypothetical protein CISIN_1g002713mg                   206   2e-57   Citrus sinensis [apfelsine]
ref|XP_008368904.1|  PREDICTED: serine/threonine-protein phosphat...    207   2e-57   
ref|XP_008368903.1|  PREDICTED: serine/threonine-protein phosphat...    207   2e-57   
gb|EMT11348.1|  Serine/threonine phosphatase BSL1-like protein          207   3e-57   
gb|KDO87442.1|  hypothetical protein CISIN_1g002713mg                   205   4e-57   Citrus sinensis [apfelsine]
gb|KDP21537.1|  hypothetical protein JCGZ_22008                         207   4e-57   Jatropha curcas
ref|XP_002520710.1|  bsu-protein phosphatase, putative                  207   4e-57   Ricinus communis
ref|XP_002270638.2|  PREDICTED: serine/threonine-protein phosphat...    206   5e-57   Vitis vinifera
ref|XP_004290707.1|  PREDICTED: serine/threonine-protein phosphat...    206   7e-57   Fragaria vesca subsp. vesca
ref|XP_011011092.1|  PREDICTED: serine/threonine-protein phosphat...    206   7e-57   Populus euphratica
gb|KDO87440.1|  hypothetical protein CISIN_1g002713mg                   206   7e-57   Citrus sinensis [apfelsine]
ref|XP_011011093.1|  PREDICTED: serine/threonine-protein phosphat...    206   8e-57   Populus euphratica
ref|XP_006444191.1|  hypothetical protein CICLE_v10018791mg             206   8e-57   Citrus clementina [clementine]
ref|XP_008386603.1|  PREDICTED: serine/threonine-protein phosphat...    206   9e-57   
ref|XP_006444192.1|  hypothetical protein CICLE_v10018791mg             206   1e-56   Citrus clementina [clementine]
ref|XP_009347104.1|  PREDICTED: serine/threonine-protein phosphat...    205   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_002439264.1|  hypothetical protein SORBIDRAFT_09g003440          205   2e-56   Sorghum bicolor [broomcorn]
ref|XP_002301559.1|  phosphatase family protein                         205   2e-56   
ref|XP_008655294.1|  PREDICTED: uncharacterized protein LOC100383...    205   4e-56   Zea mays [maize]
ref|XP_008655295.1|  PREDICTED: uncharacterized protein LOC100383...    204   4e-56   Zea mays [maize]
ref|XP_003518942.1|  PREDICTED: serine/threonine-protein phosphat...    203   7e-56   Glycine max [soybeans]
gb|KHN46606.1|  Serine/threonine-protein phosphatase BSL1               203   8e-56   Glycine soja [wild soybean]
ref|XP_007201685.1|  hypothetical protein PRUPE_ppa022807mg             202   1e-55   
ref|XP_010244624.1|  PREDICTED: serine/threonine-protein phosphat...    202   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010244625.1|  PREDICTED: serine/threonine-protein phosphat...    202   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_003591586.1|  Serine/threonine protein phosphatase               202   1e-55   
gb|AES61845.2|  serine/threonine-protein phosphatase                    202   1e-55   Medicago truncatula
ref|XP_004496006.1|  PREDICTED: serine/threonine-protein phosphat...    202   2e-55   Cicer arietinum [garbanzo]
ref|XP_007144577.1|  hypothetical protein PHAVU_007G167400g             202   2e-55   Phaseolus vulgaris [French bean]
ref|XP_002321044.2|  phosphatase family protein                         202   2e-55   
ref|XP_006826451.1|  hypothetical protein AMTR_s00004p00179740          200   2e-55   
gb|KGN66603.1|  hypothetical protein Csa_1G638500                       192   3e-55   Cucumis sativus [cucumbers]
ref|XP_010914371.1|  PREDICTED: serine/threonine-protein phosphat...    199   3e-55   
ref|XP_010914370.1|  PREDICTED: serine/threonine-protein phosphat...    199   6e-55   
ref|XP_003536338.1|  PREDICTED: serine/threonine-protein phosphat...    201   7e-55   Glycine max [soybeans]
gb|AFY26889.1|  kelch repeat-containing serine/threonine phosphoe...    200   8e-55   Morella rubra [Chinese arbutus]
ref|XP_010914369.1|  PREDICTED: serine/threonine-protein phosphat...    199   8e-55   
ref|NP_001266004.1|  Hop-interacting protein THI129                     199   3e-54   Solanum lycopersicum
gb|ACR38393.1|  unknown                                                 186   3e-54   Zea mays [maize]
gb|KJB42021.1|  hypothetical protein B456_007G132700                    198   5e-54   Gossypium raimondii
gb|EYU41290.1|  hypothetical protein MIMGU_mgv1a0202662mg               195   5e-54   Erythranthe guttata [common monkey flower]
gb|KHG15629.1|  Serine/threonine-protein phosphatase BSL1 -like p...    197   7e-54   Gossypium arboreum [tree cotton]
ref|XP_001760494.1|  predicted protein                                  197   2e-53   
ref|NP_001131445.1|  uncharacterized LOC100192777                       187   2e-53   
ref|NP_001167772.1|  uncharacterized protein LOC100381465               182   2e-53   
ref|XP_001769730.1|  predicted protein                                  197   3e-53   
gb|KFK30905.1|  hypothetical protein AALP_AA6G041300                    196   3e-53   Arabis alpina [alpine rockcress]
gb|EYU25965.1|  hypothetical protein MIMGU_mgv1a0006241mg               194   4e-53   Erythranthe guttata [common monkey flower]
gb|KJB55562.1|  hypothetical protein B456_009G082300                    192   5e-53   Gossypium raimondii
ref|XP_010647448.1|  PREDICTED: serine/threonine-protein phosphat...    193   8e-53   Vitis vinifera
ref|NP_001189614.1|  serine/threonine-protein phosphatase BSL3          196   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180289.3|  serine/threonine-protein phosphatase BSL3             196   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006591057.1|  PREDICTED: serine/threonine-protein phosphat...    196   1e-52   Glycine max [soybeans]
ref|XP_003538088.1|  PREDICTED: serine/threonine-protein phosphat...    195   1e-52   Glycine max [soybeans]
emb|CDY57791.1|  BnaCnng32470D                                          195   1e-52   Brassica napus [oilseed rape]
gb|KHN36505.1|  Serine/threonine-protein phosphatase BSL2               194   2e-52   Glycine soja [wild soybean]
gb|KEH38997.1|  serine/threonine-protein phosphatase BSL2-like pr...    194   2e-52   Medicago truncatula
ref|XP_006408677.1|  hypothetical protein EUTSA_v10001894mg             194   2e-52   Eutrema salsugineum [saltwater cress]
ref|XP_004170230.1|  PREDICTED: serine/threonine-protein phosphat...    192   2e-52   
ref|XP_003543410.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-52   Glycine max [soybeans]
dbj|BAK06303.1|  predicted protein                                      187   3e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003596905.1|  Serine/threonine protein phosphatase               194   3e-52   Medicago truncatula
ref|XP_004291538.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-52   Fragaria vesca subsp. vesca
ref|XP_007150014.1|  hypothetical protein PHAVU_005G118700g             194   3e-52   Phaseolus vulgaris [French bean]
ref|XP_010045170.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-52   Eucalyptus grandis [rose gum]
ref|XP_003540821.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-52   Glycine max [soybeans]
ref|XP_002264614.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-52   Vitis vinifera
ref|XP_009336399.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_009373887.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_004506226.1|  PREDICTED: serine/threonine-protein phosphat...    194   3e-52   Cicer arietinum [garbanzo]
ref|XP_007208428.1|  hypothetical protein PRUPE_ppa000783mg             194   3e-52   Prunus persica
ref|XP_011090288.1|  PREDICTED: serine/threonine-protein phosphat...    194   4e-52   Sesamum indicum [beniseed]
ref|XP_011090289.1|  PREDICTED: serine/threonine-protein phosphat...    194   4e-52   Sesamum indicum [beniseed]
ref|XP_008361620.1|  PREDICTED: serine/threonine-protein phosphat...    194   4e-52   
gb|KJB55561.1|  hypothetical protein B456_009G082300                    192   4e-52   Gossypium raimondii
ref|XP_009368358.1|  PREDICTED: serine/threonine-protein phosphat...    194   4e-52   Pyrus x bretschneideri [bai li]
ref|XP_004164757.1|  PREDICTED: serine/threonine-protein phosphat...    192   4e-52   
ref|XP_008230041.1|  PREDICTED: serine/threonine-protein phosphat...    194   4e-52   Prunus mume [ume]
ref|XP_009398342.1|  PREDICTED: serine/threonine-protein phosphat...    194   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002879075.1|  kelch repeat-containing serine/threonine pho...    194   4e-52   
ref|XP_008230036.1|  PREDICTED: serine/threonine-protein phosphat...    194   4e-52   Prunus mume [ume]
ref|XP_009398341.1|  PREDICTED: serine/threonine-protein phosphat...    194   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006295510.1|  hypothetical protein CARUB_v10024614mg             194   4e-52   
gb|KDP42962.1|  hypothetical protein JCGZ_23904                         194   4e-52   Jatropha curcas
ref|XP_008385576.1|  PREDICTED: serine/threonine-protein phosphat...    194   4e-52   
ref|XP_009775149.1|  PREDICTED: serine/threonine-protein phosphat...    183   4e-52   Nicotiana sylvestris
ref|XP_010513312.1|  PREDICTED: serine/threonine-protein phosphat...    194   4e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007015660.1|  BRI1 suppressor 1 (BSU1)-like 3 isoform 4          192   4e-52   
ref|XP_004487445.1|  PREDICTED: serine/threonine-protein phosphat...    194   4e-52   Cicer arietinum [garbanzo]
ref|XP_009412503.1|  PREDICTED: serine/threonine-protein phosphat...    193   5e-52   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI24435.3|  unnamed protein product                                194   5e-52   Vitis vinifera
ref|XP_010685448.1|  PREDICTED: serine/threonine-protein phosphat...    194   5e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009418973.1|  PREDICTED: serine/threonine-protein phosphat...    193   6e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010904839.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    192   6e-52   Elaeis guineensis
ref|XP_004139147.1|  PREDICTED: serine/threonine-protein phosphat...    193   6e-52   
ref|XP_008450272.1|  PREDICTED: serine/threonine-protein phosphat...    193   7e-52   
gb|KHN03759.1|  Serine/threonine-protein phosphatase BSL1               191   7e-52   Glycine soja [wild soybean]
ref|XP_009140775.1|  PREDICTED: serine/threonine-protein phosphat...    193   8e-52   Brassica rapa
ref|XP_010544322.1|  PREDICTED: serine/threonine-protein phosphat...    193   8e-52   Tarenaya hassleriana [spider flower]
emb|CDY57485.1|  BnaAnng14650D                                          193   8e-52   Brassica napus [oilseed rape]
ref|XP_010544321.1|  PREDICTED: serine/threonine-protein phosphat...    193   8e-52   Tarenaya hassleriana [spider flower]
gb|KHG22818.1|  Serine/threonine-protein phosphatase BSL3 -like p...    193   9e-52   Gossypium arboreum [tree cotton]
ref|XP_004140171.1|  PREDICTED: serine/threonine-protein phosphat...    193   9e-52   Cucumis sativus [cucumbers]
ref|XP_006369377.1|  hypothetical protein POPTR_0001s22320g             192   1e-51   
ref|XP_010557449.1|  PREDICTED: serine/threonine-protein phosphat...    192   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_007015657.1|  BRI1 suppressor 1 (BSU1)-like 2 isoform 1          192   1e-51   
ref|XP_008449600.1|  PREDICTED: serine/threonine-protein phosphat...    192   1e-51   Cucumis melo [Oriental melon]
ref|XP_011008746.1|  PREDICTED: serine/threonine-protein phosphat...    192   1e-51   Populus euphratica
ref|XP_011008648.1|  PREDICTED: serine/threonine-protein phosphat...    192   1e-51   Populus euphratica
ref|XP_011044597.1|  PREDICTED: serine/threonine-protein phosphat...    192   1e-51   Populus euphratica
ref|XP_007132502.1|  hypothetical protein PHAVU_011G099600g             192   1e-51   Phaseolus vulgaris [French bean]
ref|XP_004960470.1|  PREDICTED: serine/threonine-protein phosphat...    191   2e-51   Setaria italica
gb|KJB55556.1|  hypothetical protein B456_009G082300                    192   2e-51   Gossypium raimondii
gb|KHG29076.1|  Serine/threonine-protein phosphatase BSL3 -like p...    192   2e-51   Gossypium arboreum [tree cotton]
gb|EYU36016.1|  hypothetical protein MIMGU_mgv1a000720mg                192   2e-51   Erythranthe guttata [common monkey flower]
gb|KJB35468.1|  hypothetical protein B456_006G116600                    189   2e-51   Gossypium raimondii
ref|XP_011088983.1|  PREDICTED: serine/threonine-protein phosphat...    192   2e-51   Sesamum indicum [beniseed]
gb|KHN17986.1|  Serine/threonine-protein phosphatase BSL2               191   2e-51   Glycine soja [wild soybean]
dbj|BAF02235.1|  putative protein serine/threonine phosphatase alpha    189   3e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KDO46579.1|  hypothetical protein CISIN_1g001895mg                   189   3e-51   Citrus sinensis [apfelsine]
ref|XP_009388972.1|  PREDICTED: serine/threonine-protein phosphat...    191   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009606099.1|  PREDICTED: serine/threonine-protein phosphat...    189   3e-51   Nicotiana tomentosiformis
ref|XP_010263036.1|  PREDICTED: serine/threonine-protein phosphat...    191   4e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008787776.1|  PREDICTED: serine/threonine-protein phosphat...    189   4e-51   
ref|XP_008787777.1|  PREDICTED: serine/threonine-protein phosphat...    189   4e-51   Phoenix dactylifera
ref|XP_003539489.1|  PREDICTED: serine/threonine-protein phosphat...    191   4e-51   Glycine max [soybeans]
ref|XP_009606096.1|  PREDICTED: serine/threonine-protein phosphat...    189   4e-51   
ref|XP_001765008.1|  predicted protein                                  191   4e-51   
ref|XP_010473113.1|  PREDICTED: serine/threonine-protein phosphat...    191   5e-51   Camelina sativa [gold-of-pleasure]
ref|NP_001275238.1|  serine/threonine-protein phosphatase BSL3-like     191   5e-51   Solanum tuberosum [potatoes]
ref|XP_010247574.1|  PREDICTED: serine/threonine-protein phosphat...    191   5e-51   Nelumbo nucifera [Indian lotus]
gb|KJB35474.1|  hypothetical protein B456_006G116600                    191   6e-51   Gossypium raimondii
ref|XP_003605992.1|  Serine/threonine protein phosphatase               189   6e-51   
ref|XP_004241349.1|  PREDICTED: serine/threonine-protein phosphat...    191   6e-51   Solanum lycopersicum
gb|KJB35470.1|  hypothetical protein B456_006G116600                    191   6e-51   Gossypium raimondii
ref|XP_006367582.1|  PREDICTED: serine/threonine-protein phosphat...    188   7e-51   Solanum tuberosum [potatoes]
ref|XP_009770255.1|  PREDICTED: serine/threonine-protein phosphat...    190   7e-51   Nicotiana sylvestris
ref|XP_010907354.1|  PREDICTED: serine/threonine-protein phosphat...    190   8e-51   Elaeis guineensis
ref|XP_010907353.1|  PREDICTED: serine/threonine-protein phosphat...    190   8e-51   Elaeis guineensis
ref|XP_009770253.1|  PREDICTED: serine/threonine-protein phosphat...    190   8e-51   Nicotiana sylvestris
ref|XP_009795596.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    190   9e-51   Nicotiana sylvestris
gb|AES88189.2|  serine/threonine-protein phosphatase BSL2-like pr...    190   9e-51   Medicago truncatula
ref|XP_010941606.1|  PREDICTED: serine/threonine-protein phosphat...    190   9e-51   
ref|XP_008811286.1|  PREDICTED: serine/threonine-protein phosphat...    190   1e-50   Phoenix dactylifera
ref|XP_006424083.1|  hypothetical protein CICLE_v10027742mg             190   1e-50   Citrus clementina [clementine]
ref|XP_002513730.1|  bsu-protein phosphatase, putative                  189   1e-50   
ref|XP_008811285.1|  PREDICTED: serine/threonine-protein phosphat...    189   1e-50   Phoenix dactylifera
ref|XP_008811284.1|  PREDICTED: serine/threonine-protein phosphat...    189   1e-50   Phoenix dactylifera
gb|AFW68155.1|  putative kelch repeat-containing protein containi...    182   1e-50   
ref|XP_006424082.1|  hypothetical protein CICLE_v10027742mg             189   1e-50   
ref|XP_006592359.1|  PREDICTED: serine/threonine-protein phosphat...    189   1e-50   
ref|XP_011090290.1|  PREDICTED: serine/threonine-protein phosphat...    189   1e-50   Sesamum indicum [beniseed]
ref|XP_010458078.1|  PREDICTED: serine/threonine-protein phosphat...    189   1e-50   
ref|XP_006303893.1|  hypothetical protein CARUB_v10008182mg             189   1e-50   Capsella rubella
ref|XP_010488844.1|  PREDICTED: serine/threonine-protein phosphat...    189   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010475640.1|  PREDICTED: serine/threonine-protein phosphat...    189   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010322449.1|  PREDICTED: serine/threonine-protein phosphat...    189   1e-50   Solanum lycopersicum
dbj|BAH19666.1|  AT1G08420                                              189   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172318.1|  serine/threonine-protein phosphatase BSL2             189   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889692.1|  kelch repeat-containing protein                    189   2e-50   Arabidopsis lyrata subsp. lyrata
ref|NP_001266022.1|  Hop-interacting protein THI140                     189   2e-50   Solanum lycopersicum
ref|NP_001184935.1|  serine/threonine-protein phosphatase BSL2          189   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|EEE65895.1|  hypothetical protein OsJ_21718                          189   2e-50   Oryza sativa Japonica Group [Japonica rice]
emb|CDP15567.1|  unnamed protein product                                189   2e-50   Coffea canephora [robusta coffee]
ref|NP_001067290.1|  Os12g0617900                                       189   2e-50   
gb|EMS59471.1|  Serine/threonine-protein phosphatase BSL2-like pr...    187   3e-50   Triticum urartu
ref|XP_004963199.1|  PREDICTED: serine/threonine-protein phosphat...    189   3e-50   Setaria italica
ref|XP_008674098.1|  PREDICTED: serine/threonine-protein phosphat...    188   3e-50   Zea mays [maize]
ref|XP_001781021.1|  predicted protein                                  189   3e-50   
ref|XP_002980607.1|  hypothetical protein SELMODRAFT_268371             188   3e-50   
ref|XP_009587053.1|  PREDICTED: serine/threonine-protein phosphat...    188   3e-50   
gb|KJB21740.1|  hypothetical protein B456_004G011600                    188   3e-50   Gossypium raimondii
ref|XP_009587040.1|  PREDICTED: serine/threonine-protein phosphat...    188   3e-50   Nicotiana tomentosiformis
ref|XP_002443577.1|  hypothetical protein SORBIDRAFT_08g021850          188   4e-50   Sorghum bicolor [broomcorn]
ref|XP_002976889.1|  hypothetical protein SELMODRAFT_175932             188   4e-50   
ref|XP_006651637.1|  PREDICTED: serine/threonine-protein phosphat...    187   4e-50   Oryza brachyantha
ref|XP_006361106.1|  PREDICTED: serine/threonine-protein phosphat...    188   4e-50   Solanum tuberosum [potatoes]
ref|XP_002313501.2|  kelch repeat-containing family protein             188   4e-50   
gb|EEE59591.1|  hypothetical protein OsJ_11899                          187   5e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664752.1|  PREDICTED: serine/threonine-protein phosphat...    187   6e-50   
gb|ABF97885.1|  kelch repeat-containing serine/threonine phosphoe...    187   6e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008681503.1|  PREDICTED: uncharacterized protein LOC100192...    187   6e-50   Zea mays [maize]
ref|XP_008681453.1|  PREDICTED: uncharacterized protein LOC100192...    187   6e-50   
gb|EEC75832.1|  hypothetical protein OsI_12812                          187   6e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_011088984.1|  PREDICTED: serine/threonine-protein phosphat...    187   7e-50   Sesamum indicum [beniseed]
gb|EPS70499.1|  hypothetical protein M569_04238                         187   8e-50   Genlisea aurea
ref|XP_009606098.1|  PREDICTED: serine/threonine-protein phosphat...    185   9e-50   
ref|XP_006592783.1|  PREDICTED: serine/threonine-protein phosphat...    186   2e-49   
gb|AAD26883.1|  putative phosphoprotein phosphatase                     184   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417691.1|  hypothetical protein EUTSA_v10006669mg             186   3e-49   Eutrema salsugineum [saltwater cress]
ref|XP_009770254.1|  PREDICTED: serine/threonine-protein phosphat...    186   3e-49   Nicotiana sylvestris
ref|XP_009587046.1|  PREDICTED: serine/threonine-protein phosphat...    186   3e-49   Nicotiana tomentosiformis
ref|XP_009587594.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-49   Nicotiana tomentosiformis
ref|XP_008643918.1|  PREDICTED: uncharacterized protein LOC100381...    182   4e-49   
ref|XP_003561867.1|  PREDICTED: serine/threonine-protein phosphat...    185   5e-49   Brachypodium distachyon [annual false brome]
ref|XP_010232097.1|  PREDICTED: serine/threonine-protein phosphat...    185   7e-49   Brachypodium distachyon [annual false brome]
ref|XP_004982315.1|  PREDICTED: serine/threonine-protein phosphat...    183   9e-49   
ref|XP_008795124.1|  PREDICTED: serine/threonine-protein phosphat...    183   1e-48   Phoenix dactylifera
ref|XP_006340327.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-48   Solanum tuberosum [potatoes]
ref|XP_004251224.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-48   Solanum lycopersicum
ref|XP_006592360.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-48   
ref|XP_010419412.1|  PREDICTED: serine/threonine-protein phosphat...    184   1e-48   Camelina sativa [gold-of-pleasure]
gb|ABV91338.1|  kelch repeat-containing protein /serine/threonine...    184   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010101992.1|  Serine/threonine-protein phosphatase BSL2          184   2e-48   
ref|XP_006340328.1|  PREDICTED: serine/threonine-protein phosphat...    183   2e-48   Solanum tuberosum [potatoes]
ref|XP_010313488.1|  PREDICTED: serine/threonine-protein phosphat...    183   2e-48   Solanum lycopersicum
gb|AAF22889.1|AC006932_6  T27G7.10                                      183   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002464169.1|  hypothetical protein SORBIDRAFT_01g013460          183   3e-48   Sorghum bicolor [broomcorn]
ref|XP_004496005.1|  PREDICTED: serine/threonine-protein phosphat...    182   3e-48   
ref|XP_004982314.1|  PREDICTED: serine/threonine-protein phosphat...    182   4e-48   Setaria italica
gb|EMT08803.1|  Serine/threonine-phosphatase BSL2-like protein          182   4e-48   
ref|XP_003577251.1|  PREDICTED: serine/threonine-protein phosphat...    182   4e-48   Brachypodium distachyon [annual false brome]
ref|XP_010112705.1|  Serine/threonine-protein phosphatase BSL1          181   4e-48   
gb|KDO46578.1|  hypothetical protein CISIN_1g001895mg                   182   6e-48   Citrus sinensis [apfelsine]
ref|XP_006826448.1|  hypothetical protein AMTR_s00004p00175690          182   2e-47   
gb|EMT33719.1|  Serine/threonine-phosphatase BSL2-like protein          179   1e-46   
emb|CDY22684.1|  BnaC08g43180D                                          178   1e-46   Brassica napus [oilseed rape]
emb|CDY06313.1|  BnaA09g48900D                                          178   2e-46   
ref|XP_009118376.1|  PREDICTED: serine/threonine-protein phosphat...    178   2e-46   
gb|KFK43163.1|  hypothetical protein AALP_AA1G088000                    176   5e-46   
ref|XP_010031570.1|  PREDICTED: serine/threonine-protein phosphat...    176   7e-46   
emb|CBI24997.3|  unnamed protein product                                176   9e-46   
ref|XP_002262846.2|  PREDICTED: serine/threonine-protein phosphat...    176   1e-45   
gb|AFW68156.1|  putative kelch repeat-containing protein containi...    169   2e-45   
ref|XP_009110896.1|  PREDICTED: serine/threonine-protein phosphat...    171   3e-44   
emb|CDX97481.1|  BnaC08g13460D                                          171   3e-44   
ref|XP_007508044.1|  predicted protein                                  166   5e-44   
emb|CDY31148.1|  BnaA08g26980D                                          170   8e-44   
ref|XP_002974662.1|  hypothetical protein SELMODRAFT_442608             166   9e-43   
ref|XP_002963377.1|  hypothetical protein SELMODRAFT_438528             166   1e-42   
ref|XP_007510268.1|  predicted protein                                  167   2e-42   
ref|XP_001420111.1|  predicted protein                                  164   1e-41   
emb|CEF99328.1|  Serine/threonine-specific protein phosphatase/bi...    162   6e-41   
ref|XP_003081555.1|  Serine/threonine specific protein phosphatas...    162   9e-41   
gb|KDD72092.1|  calcineurin-like phosphoesterase                        155   1e-40   
gb|KJB35473.1|  hypothetical protein B456_006G116600                    160   2e-40   
emb|CAN67845.1|  hypothetical protein VITISV_016668                     155   1e-39   
emb|CDY17966.1|  BnaC03g30380D                                          147   4e-39   
ref|XP_003058098.1|  predicted protein                                  155   8e-39   
ref|XP_001689767.1|  protein phosphatase 1 beta                         155   1e-38   
ref|XP_002499734.1|  predicted protein                                  154   4e-38   
ref|XP_005846245.1|  hypothetical protein CHLNCDRAFT_135536             154   4e-38   
ref|XP_005645525.1|  protein phosphatase 1 beta                         153   5e-38   
ref|XP_011402161.1|  Serine/threonine-protein phosphatase BSL3          150   1e-37   
ref|XP_002958148.1|  hypothetical protein VOLCADRAFT_84366              152   1e-37   
ref|XP_010474966.1|  PREDICTED: serine/threonine-protein phosphat...    147   5e-36   
gb|EPS58158.1|  serine/threonine-protein phosphatase                    139   2e-35   
ref|XP_010457353.1|  PREDICTED: serine/threonine-protein phosphat...    144   7e-35   
ref|XP_007508023.1|  predicted protein                                  135   6e-33   
pir||T00913  probable phosphoprotein phosphatase (EC 3.1.3.16) F2...    137   1e-32
ref|NP_171844.6|  serine/threonine-protein phosphatase BSU1             137   2e-32   
gb|AAF86539.1|AC002560_32  F21B7.7                                      137   3e-32   
emb|CDY07313.1|  BnaC05g26750D                                          129   8e-32   
ref|XP_006304779.1|  hypothetical protein CARUB_v10012319mg             135   1e-31   
ref|XP_006418234.1|  hypothetical protein EUTSA_v10009980mg             131   1e-30   
ref|XP_002892160.1|  Serine/threonine-protein phosphatase BSU1          129   8e-30   
emb|CAN62681.1|  hypothetical protein VITISV_026755                     122   1e-29   
ref|XP_009144944.1|  PREDICTED: serine/threonine-protein phosphat...    127   5e-29   
emb|CDY29598.1|  BnaA05g15720D                                          126   6e-29   
tpg|DAA50299.1|  TPA: putative kelch repeat-containing protein co...    121   6e-27   
gb|KFK42698.1|  hypothetical protein AALP_AA1G028300                    122   6e-27   
gb|KFK42699.1|  hypothetical protein AALP_AA1G028300                    122   7e-27   
gb|AAC69437.1|  protein serine/threonine phosphatase alpha              115   6e-25   
gb|ETW46597.1|  hypothetical protein PFMALIP_05500                      114   1e-24   
gb|AFK45415.1|  unknown                                                 108   1e-24   
gb|ETB63046.1|  hypothetical protein YYC_00643                          114   1e-24   
ref|XP_727284.1|  protein serine/threonine phosphatase alpha            114   1e-24   
ref|XP_678280.1|  protein serine/threonine phosphatase                  114   1e-24   
emb|CDS50472.1|  protein phosphatase containing kelch-like domains      114   1e-24   
gb|EUD70469.1|  protein phosphatase                                     114   2e-24   
gb|EWC73527.1|  hypothetical protein C923_05783                         114   2e-24   
ref|XP_001348804.1|  protein serine/threonine phosphatase               114   2e-24   
ref|XP_008622216.1|  protein phosphatase                                114   2e-24   
emb|CDO67125.1|  protein phosphatase containing kelch-like domain...    114   2e-24   
emb|CDR15635.1|  protein phosphatase containing kelch-like domain...    114   2e-24   
ref|XP_002260205.1|  protein serine/threonine phosphatase               114   2e-24   
gb|ABR25780.1|  serine/threonine-protein phosphatase bsl2               108   3e-24   
ref|XP_008813960.1|  protein phosphatase                                113   3e-24   
ref|XP_004223870.1|  protein serine/threonine phosphatase               113   3e-24   
ref|XP_001615727.1|  protein serine/threonine phosphatase               113   4e-24   
ref|XP_001388090.1|  protein serine/threonine phosphatase alpha         112   4e-24   
ref|XP_666328.1|  protein serine/threonine phosphatase alpha            112   4e-24   
gb|KFG42467.1|  kelch repeat domain containing/Serine/threonine p...    108   4e-24   
ref|XP_001609688.1|  kelch repeat domain containing/Serine/threon...    112   4e-24   
ref|XP_953085.1|  serine/threonine phosphatase                          112   6e-24   
ref|XP_764058.1|  serine/threonine protein phosphatase                  112   7e-24   
emb|CDX71467.1|  BnaC04g17020D                                          108   8e-24   
ref|XP_001458952.1|  hypothetical protein                               111   1e-23   
ref|XP_011129274.1|  serine/threonine-protein phosphatase               109   1e-23   
emb|CDR94993.1|  kelch repeat domain containing/Serine/threonine ...    111   1e-23   
emb|CDJ38799.1|  Serine/threonine-protein phosphatase , related         106   2e-23   
ref|XP_001438977.1|  hypothetical protein                               110   2e-23   
ref|XP_001443631.1|  hypothetical protein                               110   2e-23   
emb|CDI76910.1|  Serine/threonine-protein phosphatase , related         109   5e-23   
ref|XP_004831147.1|  Ser/Thr protein phosphatase family member pr...    110   5e-23   
ref|XP_001022531.2|  Ser/Thr protein phosphatase family protein         109   6e-23   
emb|CCF73649.1|  unnamed protein product                                109   7e-23   
ref|XP_008889177.1|  kelch repeat domain containing/Serine/threon...    109   9e-23   
ref|XP_002368432.1|  protein serine/threonine phosphatase, putati...    108   2e-22   
gb|EPR59771.1|  kelch repeat domain containing/Serine/threonine p...    108   2e-22   
gb|ESS33859.1|  kelch repeat domain containing/Serine/threonine p...    108   2e-22   
emb|CDW91130.1|  ser thr protein phosphatase family protein             107   3e-22   
emb|CDJ50529.1|  protein serine/threonine phosphatase, putative /...    106   4e-22   
ref|XP_002785335.1|  bsu-protein phosphatase, putative                  104   4e-22   
emb|CDJ58913.1|  Serine/threonine-protein phosphatase , related         105   5e-22   
ref|XP_002139134.1|  serine/threonine protein phosphatase               106   7e-22   
gb|EJY66618.1|  Serine/threonine-protein phosphatase                    105   1e-21   
ref|XP_004036424.1|  protein serine threonine phosphatase alpha, ...    104   4e-21   
ref|XP_004030178.1|  ser thr protein phosphatase family protein, ...    103   7e-21   
ref|XP_002788680.1|  protein serine/threonine phosphatase, putative     101   3e-20   
gb|KIY95206.1|  hypothetical protein MNEG_12757                       93.2    6e-20   
ref|XP_004995703.1|  hypothetical protein PTSG_03117                    100   1e-19   
gb|ETO30408.1|  hypothetical protein RFI_06712                        95.9    2e-19   
ref|XP_004987444.1|  hypothetical protein PTSG_11520                  94.7    3e-19   
gb|ETO22086.1|  protein serine/threonine phosphatase                  97.8    5e-19   
ref|XP_001429774.1|  hypothetical protein                             97.4    5e-19   
ref|XP_001746829.1|  hypothetical protein                             97.1    7e-19   
ref|XP_010023961.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    2e-18   
ref|XP_010023960.1|  PREDICTED: serine/threonine-protein phosphat...  92.4    3e-18   
gb|EWM21847.1|  serine threonine-protein phosphatase bsl2             95.5    3e-18   
ref|XP_005793306.1|  hypothetical protein EMIHUDRAFT_417293           94.0    4e-18   
dbj|BAF48782.1|  hypothetical protein                                 89.7    4e-17   
gb|ETO81245.1|  hypothetical protein F444_04413                       90.1    1e-16   
gb|ETM52081.1|  hypothetical protein L914_04213                       90.1    1e-16   
gb|ETL98921.1|  hypothetical protein L917_04107                       90.1    1e-16   
gb|ETK92354.1|  hypothetical protein L915_04269                       90.1    1e-16   
ref|XP_002902202.1|  calcineurin-like phosphoesterase, putative       89.4    1e-16   
gb|ETI52475.1|  hypothetical protein F443_04391                       90.1    1e-16   
gb|ETP50198.1|  hypothetical protein F442_04419                       89.7    2e-16   
ref|XP_008901676.1|  hypothetical protein PPTG_08717                  89.7    2e-16   
ref|XP_009692418.1|  serine/threonine protein phosphatase             89.7    2e-16   
ref|XP_007222643.1|  hypothetical protein PRUPE_ppa008543mg           85.9    5e-16   
ref|XP_008224363.1|  PREDICTED: serine/threonine-protein phosphat...  85.9    5e-16   
ref|XP_009397621.1|  PREDICTED: serine/threonine-protein phosphat...  85.5    6e-16   
ref|XP_003881208.1|  serine/threonine protein phosphatase, related    87.4    1e-15   
dbj|BAJ99103.1|  predicted protein                                    84.3    1e-15   
ref|XP_001985583.1|  GH17149                                          84.3    1e-15   
gb|ADE76458.1|  unknown                                               84.3    2e-15   
dbj|BAM19951.1|  flapwing                                             80.1    2e-15   
ref|XP_011073522.1|  PREDICTED: serine/threonine-protein phosphat...  84.0    2e-15   
ref|XP_009339616.1|  PREDICTED: serine/threonine-protein phosphat...  84.0    3e-15   
ref|XP_010924761.1|  PREDICTED: serine/threonine-protein phosphat...  84.0    3e-15   
ref|XP_010935745.1|  PREDICTED: serine/threonine-protein phosphat...  84.0    3e-15   
ref|XP_002319103.2|  hypothetical protein POPTR_0013s04310g           83.2    3e-15   
ref|XP_009342488.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    3e-15   
ref|XP_006827474.1|  hypothetical protein AMTR_s00009p00134520        83.2    3e-15   
ref|XP_010935744.1|  PREDICTED: serine/threonine-protein phosphat...  84.0    3e-15   
gb|KDP23705.1|  hypothetical protein JCGZ_23538                       84.0    3e-15   
ref|XP_004510082.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    3e-15   
ref|XP_004296363.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    4e-15   
ref|XP_002521968.1|  serine/threonine protein phosphatase, putative   84.0    4e-15   
ref|XP_009382144.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    4e-15   
gb|KIR26850.1|  serine/threonine-protein phosphatase PP1              80.5    4e-15   
ref|XP_010940610.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    4e-15   
sp|P48480.1|PP11_ACEPE  RecName: Full=Serine/threonine-protein ph...  83.2    4e-15   
ref|XP_011462265.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    4e-15   
gb|AAK68780.1|  protein phosphatase                                   81.6    5e-15   
ref|XP_009373991.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    5e-15   
ref|XP_008341122.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    5e-15   
gb|ABE93049.1|  Serine/threonine-specific protein phosphatase and...  82.4    5e-15   
gb|KDO57610.1|  hypothetical protein CISIN_1g017614mg                 81.6    6e-15   
gb|EJU02609.1|  catalytic subunit of type 1 serine/threonine prot...  83.2    6e-15   
ref|XP_010935746.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    6e-15   
ref|XP_008795019.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    6e-15   
ref|XP_002908542.1|  serine/threonine-protein phosphatase, putative   85.1    6e-15   
ref|XP_009398030.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    6e-15   
gb|KJB82281.1|  hypothetical protein B456_013G187100                  83.2    6e-15   
emb|CDS04786.1|  Putative Serine/threonine-protein phosphatase        82.8    6e-15   
emb|CDH50078.1|  serine threonine-protein phosphatase pp1             82.8    6e-15   
gb|KDO69205.1|  hypothetical protein CISIN_1g020919mg                 82.0    6e-15   
ref|XP_008796501.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    6e-15   
ref|XP_003626624.1|  Serine/threonine protein phosphatase PP1         82.4    6e-15   
ref|XP_001395377.2|  serine/threonine-protein phosphatase PP2A ca...  82.8    7e-15   
gb|KFG33412.1|  kelch repeat domain containing/Serine/threonine p...  85.1    7e-15   
gb|KDO41477.1|  hypothetical protein CISIN_1g044282mg                 82.0    7e-15   
gb|KHN22207.1|  Serine/threonine-protein phosphatase PP1              82.4    7e-15   
emb|CDS11155.1|  Putative Serine/threonine-protein phosphatase        82.4    7e-15   
gb|KJB82279.1|  hypothetical protein B456_013G187100                  82.8    7e-15   
gb|KHG15640.1|  hypothetical protein F383_03332                       82.8    7e-15   
ref|XP_007016295.1|  Type one serine/threonine protein phosphatase 2  82.4    7e-15   
ref|XP_004305060.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    7e-15   
ref|XP_011091215.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    7e-15   
emb|CCA19201.1|  serine/threonineprotein phosphatase PP1gamma cat...  82.4    7e-15   
ref|XP_002277816.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    7e-15   
ref|XP_009398739.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    7e-15   
ref|XP_006581185.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    7e-15   
emb|CCI39850.1|  unnamed protein product                              82.4    7e-15   
emb|CAK41137.1|  unnamed protein product                              82.4    8e-15   
ref|XP_010261395.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    8e-15   
emb|CAK36941.1|  unnamed protein product                              79.3    8e-15   
ref|XP_008370734.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    8e-15   
gb|EHA25766.1|  hypothetical protein ASPNIDRAFT_50362                 82.4    8e-15   
ref|XP_011091216.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    8e-15   
ref|XP_008789570.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    8e-15   
ref|XP_008784741.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    8e-15   
ref|XP_006442698.1|  hypothetical protein CICLE_v10023735mg           82.0    8e-15   
ref|XP_008789569.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    8e-15   
gb|KHG03131.1|  Serine/threonine-protein phosphatase PP1 isozyme ...  81.6    8e-15   
ref|XP_006486426.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    9e-15   
ref|XP_009382143.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    9e-15   
ref|XP_006435598.1|  hypothetical protein CICLE_v10032138mg           82.0    9e-15   
gb|KDO24417.1|  serine/threonine-protein phosphatase PP1              82.0    9e-15   
ref|XP_008604603.1|  hypothetical protein SDRG_00878                  84.3    1e-14   
gb|KDO32597.1|  hypothetical protein SPRG_03070                       84.3    1e-14   
dbj|BAD93940.1|  phosphoprotein phosphatase                           79.0    1e-14   
gb|KJB19980.1|  hypothetical protein B456_003G128300                  82.0    1e-14   
ref|XP_002905419.1|  serine/threonine-protein phosphatase PP1-gam...  82.0    1e-14   
ref|XP_009845345.1|  serine/threonine-protein phosphatase             82.4    1e-14   
emb|CCF44786.1|  serine/threonine-protein phosphatase PP1             79.0    1e-14   
ref|XP_001388833.2|  serine/threonine-protein phosphatase PP1         79.0    1e-14   
gb|ERG80424.1|  serine threonine-protein phosphatase pp1 isozyme 7    79.3    1e-14   
ref|XP_008388710.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    1e-14   
gb|ACN69491.1|  serine/threonine-protein phosphatase                  79.3    1e-14   
emb|CDX80301.1|  BnaC09g34410D                                        81.6    1e-14   
ref|XP_011038522.1|  PREDICTED: serine/threonine-protein phosphat...  82.0    1e-14   
gb|ETW45826.1|  serine/threonine-protein phosphatase PP1-gamma ca...  78.2    1e-14   
ref|XP_009381054.1|  PREDICTED: serine/threonine-protein phosphat...  82.0    1e-14   
gb|EGA59032.1|  Glc7p                                                 79.0    1e-14   
ref|XP_009364450.1|  PREDICTED: serine/threonine-protein phosphat...  82.4    1e-14   
ref|XP_009622804.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    1e-14   
gb|EUR64176.1|  serine/threonine-protein phosphatase PP1-gamma ca...  78.6    1e-14   
ref|XP_010759698.1|  serine/threonine-protein phosphatase PP1         79.3    1e-14   
ref|XP_006648131.1|  PREDICTED: serine/threonine-protein phosphat...  81.6    1e-14   
ref|XP_002863660.1|  hypothetical protein ARALYDRAFT_494661           82.0    1e-14   
ref|XP_008610962.1|  serine/threonine-protein phosphatase PP1         82.0    1e-14   
ref|XP_002863032.1|  predicted protein                                81.3    1e-14   
emb|CDY33013.1|  BnaA10g12190D                                        81.6    1e-14   
gb|KHG02218.1|  Serine/threonine-protein phosphatase PP1 isozyme ...  81.6    1e-14   
ref|XP_009763458.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    1e-14   
ref|XP_007205491.1|  hypothetical protein PRUPE_ppa008194mg           82.0    1e-14   
emb|CAN71489.1|  hypothetical protein VITISV_005340                   81.6    1e-14   
emb|CAA78153.1|  protein phosphatase 1A                               81.6    1e-14   
ref|XP_009101787.1|  PREDICTED: serine/threonine-protein phosphat...  81.6    1e-14   
gb|KJB08918.1|  hypothetical protein B456_001G112800                  81.6    1e-14   
emb|CDY22350.1|  BnaA06g36720D                                        81.6    1e-14   
ref|XP_009126716.1|  PREDICTED: serine/threonine-protein phosphat...  81.6    1e-14   
ref|XP_002298335.1|  Serine/threonine protein phosphatase PP1 iso...  81.6    1e-14   
ref|XP_010443663.1|  PREDICTED: serine/threonine-protein phosphat...  81.6    2e-14   



>gb|EYU38112.1| hypothetical protein MIMGU_mgv1a0013162mg, partial [Erythranthe 
guttata]
Length=144

 Score =   217 bits (552),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  1    SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  60

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGR LVIVPKLIHPLPPP  SP+TSPERV ++TWMQELN
Sbjct  61   ITLFSATNYCGTANNAGAILVVGRELVIVPKLIHPLPPPFQSPETSPERVTDETWMQELN  120

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQP+LDR+SLAYI
Sbjct  121  IQRPPTPTRGRPQPELDRSSLAYI  144



>ref|XP_004158630.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Cucumis 
sativus]
Length=321

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  178  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL  237

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELN
Sbjct  238  ITLFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELN  297

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQR PTPTRGRPQPDLDR+SLAYI
Sbjct  298  IQRRPTPTRGRPQPDLDRSSLAYI  321



>gb|EPS64063.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=212

 Score =   214 bits (545),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTEND V+GLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  69   SDPTENDGVQGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL  128

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPE   ++TWMQELN
Sbjct  129  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPEHAADETWMQELN  188

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  189  IQRPPTPTRGRPQPDLDRNSLAYI  212



>gb|KGN47886.1| hypothetical protein Csa_6G409920 [Cucumis sativus]
Length=394

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  251  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL  310

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELN
Sbjct  311  ITLFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELN  370

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR+SLAYI
Sbjct  371  IQRPPTPTRGRPQPDLDRSSLAYI  394



>gb|KJB22565.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=538

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  395  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  454

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELN
Sbjct  455  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELN  514

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  515  IQRPPTPTRGRPQPDHDRSSLAYI  538



>ref|XP_010070326.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Eucalyptus 
grandis]
 gb|KCW58989.1| hypothetical protein EUGRSUZ_H01613 [Eucalyptus grandis]
Length=887

 Score =   223 bits (568),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 139/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  744  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  803

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELN
Sbjct  804  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVIEDTWMQELN  863

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR+SLAYI
Sbjct  864  IQRPPTPTRGRPQPDLDRSSLAYI  887



>ref|XP_007050742.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
 gb|EOX94899.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
Length=887

 Score =   221 bits (562),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  744  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  803

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELN
Sbjct  804  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVADDTWMQELN  863

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR+SLAYI
Sbjct  864  IQRPPTPTRGRPQPDLDRSSLAYI  887



>emb|CDP03570.1| unnamed protein product [Coffea canephora]
Length=883

 Score =   220 bits (561),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  740  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  799

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPER+ E+ WMQELN
Sbjct  800  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERMTEENWMQELN  859

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  860  IQRPPTPTRGRPQPDLDRNSLAYI  883



>ref|XP_008449460.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Cucumis 
melo]
Length=883

 Score =   220 bits (561),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  740  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL  799

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER  EDTWMQELN
Sbjct  800  ITLFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERTVEDTWMQELN  859

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR+SLAYI
Sbjct  860  IQRPPTPTRGRPQPDLDRSSLAYI  883



>ref|XP_008777710.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Phoenix dactylifera]
Length=552

 Score =   216 bits (549),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  409  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  468

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRG V+VPKLIHPLPPPL SPD+SP+ V EDTWMQELN
Sbjct  469  ITLFSATNYCGTANNAGAILVVGRGFVVVPKLIHPLPPPLRSPDSSPDHVLEDTWMQELN  528

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DRNSLAYI
Sbjct  529  IQRPPTPTRGRPQSANDRNSLAYI  552



>ref|XP_009593091.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
tomentosiformis]
Length=879

 Score =   220 bits (561),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  736  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  795

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELN
Sbjct  796  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELN  855

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  856  IQRPPTPTRGRPQPDHDRSSLAYI  879



>ref|XP_009778415.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778416.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778417.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778418.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
Length=879

 Score =   220 bits (560),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  736  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  795

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELN
Sbjct  796  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELN  855

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  856  IQRPPTPTRGRPQPDHDRSSLAYI  879



>gb|KJB22563.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
 gb|KJB22564.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=670

 Score =   218 bits (555),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  527  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  586

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELN
Sbjct  587  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELN  646

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  647  IQRPPTPTRGRPQPDHDRSSLAYI  670



>ref|XP_006366382.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Solanum 
tuberosum]
Length=293

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  150  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  209

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSP+TSPERV +D WMQELN
Sbjct  210  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSPETSPERVMDDNWMQELN  269

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  270  IQRPPTPTRGRPQPDHDRSSLAYI  293



>ref|NP_001169882.1| uncharacterized protein LOC100383776 [Zea mays]
 gb|ACN35157.1| unknown [Zea mays]
Length=187

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 136/144 (94%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  45   SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQL  104

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  105  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELN  163

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DRNSLAYI
Sbjct  164  IQRPPTPTRGRPQAAGDRNSLAYI  187



>ref|XP_004140092.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1-like [Cucumis sativus]
Length=905

 Score =   220 bits (560),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  762  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL  821

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELN
Sbjct  822  ITLFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELN  881

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR+SLAYI
Sbjct  882  IQRPPTPTRGRPQPDLDRSSLAYI  905



>emb|CAC11128.1| protein phosphatase [Fagus sylvatica]
Length=262

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLI+RAHECVMDGFERFAQGQL
Sbjct  119  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIVRAHECVMDGFERFAQGQL  178

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELN
Sbjct  179  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERIQEDTWMQELN  238

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR+SLAYI
Sbjct  239  IQRPPTPTRGRPQPDLDRSSLAYI  262



>ref|XP_010279479.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Nelumbo 
nucifera]
Length=885

 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  742  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  801

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV ++TWMQELN
Sbjct  802  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVLDETWMQELN  861

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTP RGRPQPDLDR+SLAYI
Sbjct  862  IQRPPTPIRGRPQPDLDRSSLAYI  885



>ref|XP_010522673.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=837

 Score =   219 bits (557),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  694  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  753

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPER  +DTWMQELN
Sbjct  754  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPERSGDDTWMQELN  813

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  814  IQRPPTPTRGRPQPDLDRNSLAYI  837



>ref|XP_010522672.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
Length=887

 Score =   219 bits (557),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  744  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  803

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPER  +DTWMQELN
Sbjct  804  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPERSGDDTWMQELN  863

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  864  IQRPPTPTRGRPQPDLDRNSLAYI  887



>gb|KJB22561.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=777

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  634  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  693

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELN
Sbjct  694  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELN  753

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  754  IQRPPTPTRGRPQPDHDRSSLAYI  777



>gb|KJB22560.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=887

 Score =   219 bits (557),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  744  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  803

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELN
Sbjct  804  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELN  863

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  864  IQRPPTPTRGRPQPDHDRSSLAYI  887



>gb|KHG21887.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=827

 Score =   218 bits (556),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  684  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  743

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELN
Sbjct  744  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELN  803

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  804  IQRPPTPTRGRPQPDHDRSSLAYI  827



>gb|AEK86563.1| serine/threonine-protein phosphatase [Camellia sinensis]
Length=888

 Score =   218 bits (556),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  745  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  804

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGA+LVVGRGLVIVPKLIHPLPPP  SP+TSPERV  D WMQELN
Sbjct  805  ITLFSATNYCGTANNAGALLVVGRGLVIVPKLIHPLPPPFQSPETSPERVVHDAWMQELN  864

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQP+LDRNSLAYI
Sbjct  865  IQRPPTPTRGRPQPELDRNSLAYI  888



>gb|KJB22562.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=891

 Score =   218 bits (556),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  748  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  807

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELN
Sbjct  808  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELN  867

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  868  IQRPPTPTRGRPQPDHDRSSLAYI  891



>gb|KHG21886.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=854

 Score =   218 bits (555),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  711  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  770

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELN
Sbjct  771  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELN  830

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  831  IQRPPTPTRGRPQPDHDRSSLAYI  854



>ref|XP_011082512.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Sesamum 
indicum]
Length=882

 Score =   218 bits (555),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  739  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  798

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPER+ E+TWMQELN
Sbjct  799  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERMTEETWMQELN  858

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  859  IQRPPTPTRGRPQPDHDRSSLAYI  882



>dbj|BAK04150.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  237  SDPTENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIIRAHECVMDGFERFAHGQL  296

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  297  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELN  356

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRP    DRNSLAYI
Sbjct  357  IQRPPTPTRGRPHSAGDRNSLAYI  380



>ref|XP_010684726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Beta vulgaris 
subsp. vulgaris]
Length=877

 Score =   214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFA GQL
Sbjct  734  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAHGQL  793

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER  +DTWMQELN
Sbjct  794  ITLFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERCLDDTWMQELN  853

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DRNSLAYI
Sbjct  854  IQRPPTPTRGRPQPDHDRNSLAYI  877



>ref|XP_011033645.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Populus euphratica]
Length=886

 Score =   213 bits (543),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  743  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  802

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV GRGLV+VPKLIHPLPPPL SP+TSPE V +DTWMQELN
Sbjct  803  ITLFSATNYCGTANNAGAILVGGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELN  862

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRP TPTRGRPQPD DR+SLAYI
Sbjct  863  IQRPQTPTRGRPQPDHDRSSLAYI  886



>ref|XP_011033646.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Populus euphratica]
Length=885

 Score =   213 bits (543),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  742  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  801

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV GRGLV+VPKLIHPLPPPL SP+TSPE V +DTWMQELN
Sbjct  802  ITLFSATNYCGTANNAGAILVGGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELN  861

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRP TPTRGRPQPD DR+SLAYI
Sbjct  862  IQRPQTPTRGRPQPDHDRSSLAYI  885



>ref|XP_010556798.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010556799.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=887

 Score =   211 bits (538),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  744  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  803

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGR LVIVPKLIHPLPPP+LSP+ SPER  +DTWMQELN
Sbjct  804  ITLFSATNYCGTANNAGAILVVGRELVIVPKLIHPLPPPILSPENSPERSMDDTWMQELN  863

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  864  IQRPPTPTRGRPQPDFDRSSLAYI  887



>gb|KDO87444.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=475

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  332  SDPTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQL  391

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELN
Sbjct  392  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELN  451

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  452  IQRPPTPTRGRPQPDLDRNSLAYI  475



>ref|NP_192217.2| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
 sp|Q8L7U5.2|BSL1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL1; AltName: 
Full=BSU1-like protein 1 [Arabidopsis thaliana]
 gb|AEE82268.1| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
Length=881

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  738  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL  797

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  798  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  857

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  858  IQRPPTPTRGRPQPDFDRSSLAYI  881



>ref|XP_007201214.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
 gb|EMJ02413.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
Length=887

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 140/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  744  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  803

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV EDTWMQELN
Sbjct  804  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDTWMQELN  863

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  864  IQRPPTPTRGRPQPDLDRNSLAYI  887



>gb|AFN44702.1| Ser/Thr phosphatase-containing Kelch repeat domain protein, partial 
[Nicotiana benthamiana]
Length=490

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKL LIIRAHECVMDGFERFAQGQL
Sbjct  359  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLXLIIRAHECVMDGFERFAQGQL  418

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             TLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELN
Sbjct  419  XTLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELN  478

Query  502  I  500
            I
Sbjct  479  I  479



>gb|AAC79097.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
 emb|CAB77793.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
Length=894

 Score =   211 bits (537),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  751  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL  810

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  811  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  870

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  871  IQRPPTPTRGRPQPDFDRSSLAYI  894



>ref|XP_008234964.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 [Prunus mume]
Length=873

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 140/144 (97%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  730  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  789

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV EDTWMQELN
Sbjct  790  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDTWMQELN  849

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  850  IQRPPTPTRGRPQPDLDRNSLAYI  873



>ref|XP_009385028.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Musa acuminata subsp. malaccensis]
Length=893

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  750  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL  809

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP++SPE   EDTWMQELN
Sbjct  810  ITLFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPESSPEHAVEDTWMQELN  869

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DR+SLAYI
Sbjct  870  IQRPPTPTRGRPQSANDRSSLAYI  893



>emb|CDX97296.1| BnaA02g20870D [Brassica napus]
Length=874

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  731  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  790

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  791  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  850

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  851  IQRPPTPTRGRPQPDFDRSSLAYI  874



>gb|AFN44700.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=878

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  735  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  794

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSP+TSPERV +D WMQELN
Sbjct  795  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSPETSPERVMDDNWMQELN  854

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  855  IQRPPTPTRGRPQPDHDRSSLAYI  878



>emb|CDY17964.1| BnaC03g30360D [Brassica napus]
Length=886

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  743  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  802

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  803  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  862

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  863  IQRPPTPTRGRPQPDFDRSSLAYI  886



>ref|XP_006286760.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
 gb|EOA19658.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
Length=881

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  738  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  797

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  798  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  857

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  858  IQRPPTPTRGRPQPDFDRSSLAYI  881



>emb|CDX90906.1| BnaA03g25860D [Brassica napus]
Length=886

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  743  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  802

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  803  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  862

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  863  IQRPPTPTRGRPQPDFDRSSLAYI  886



>ref|XP_006396534.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
 gb|ESQ37987.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
Length=881

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  738  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  797

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  798  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  857

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  858  IQRPPTPTRGRPQPDFDRSSLAYI  881



>ref|XP_009144526.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Brassica 
rapa]
Length=880

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  737  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  796

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  797  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  856

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  857  IQRPPTPTRGRPQPDFDRSSLAYI  880



>ref|XP_010422504.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=881

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  738  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  797

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  798  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  857

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  858  IQRPPTPTRGRPQPDFDRSSLAYI  881



>ref|XP_010455968.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Camelina sativa]
 ref|XP_010455970.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Camelina sativa]
Length=882

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  739  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  798

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  799  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  858

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  859  IQRPPTPTRGRPQPDFDRSSLAYI  882



>ref|XP_009134374.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Brassica 
rapa]
Length=878

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  735  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  794

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  795  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  854

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  855  IQRPPTPTRGRPQPDFDRSSLAYI  878



>emb|CDY62088.1| BnaC02g46770D [Brassica napus]
Length=877

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  734  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  793

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  794  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  853

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  854  IQRPPTPTRGRPQPDFDRSSLAYI  877



>ref|XP_010430668.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=882

 Score =   210 bits (534),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  739  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  798

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  799  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  858

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  859  IQRPPTPTRGRPQPDFDRSSLAYI  882



>ref|XP_010231727.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Brachypodium distachyon]
Length=868

 Score =   209 bits (533),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  725  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQL  784

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  785  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELN  844

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRP    DRNSLAYI
Sbjct  845  IQRPPTPTRGRPHSASDRNSLAYI  868



>ref|XP_002872798.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49057.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=881

 Score =   209 bits (533),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  738  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  797

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  798  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  857

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  858  IQRPPTPTRGRPQPDFDRSSLAYI  881



>ref|XP_010231726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Brachypodium distachyon]
Length=900

 Score =   209 bits (533),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  757  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQL  816

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  817  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELN  876

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRP    DRNSLAYI
Sbjct  877  IQRPPTPTRGRPHSASDRNSLAYI  900



>ref|XP_003568959.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Brachypodium distachyon]
Length=889

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  746  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQL  805

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  806  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELN  865

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRP    DRNSLAYI
Sbjct  866  IQRPPTPTRGRPHSASDRNSLAYI  889



>ref|XP_006654987.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Oryza brachyantha]
Length=829

 Score =   209 bits (531),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRN+LQLIIRAHECVMDGFERFA GQL
Sbjct  686  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNRLQLIIRAHECVMDGFERFAHGQL  745

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  746  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELN  805

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DRNSLAYI
Sbjct  806  IQRPPTPTRGRPQSASDRNSLAYI  829



>emb|CAC09573.1| protein phosphatase 1 (PP1) [Fagus sylvatica]
Length=139

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLI+RAHECVMDGFERFAQGQL
Sbjct  5    SDPTENDSAEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIVRAHECVMDGFERFAQGQL  64

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELN
Sbjct  65   ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERIQEDTWMQELN  124

Query  502  I  500
            I
Sbjct  125  I  125



>ref|NP_001054625.1| Os05g0144400 [Oryza sativa Japonica Group]
 sp|Q60EX6.1|BSL1_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL1 homolog; 
AltName: Full=BSU1-like protein 1 homolog [Oryza sativa 
Japonica Group]
 gb|AAU90203.1| putative Serine/threonine protein phosphatase BSL1 [Oryza sativa 
Japonica Group]
 dbj|BAF16539.1| Os05g0144400 [Oryza sativa Japonica Group]
 dbj|BAG99920.1| unnamed protein product [Oryza sativa Japonica Group]
Length=883

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRN+LQLIIRAHECVMDGFERFA GQL
Sbjct  740  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNRLQLIIRAHECVMDGFERFAHGQL  799

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  800  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELN  859

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DRNSLAYI
Sbjct  860  IQRPPTPTRGRPQSASDRNSLAYI  883



>gb|EEE62303.1| hypothetical protein OsJ_17091 [Oryza sativa Japonica Group]
Length=877

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRN+LQLIIRAHECVMDGFERFA GQL
Sbjct  734  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNRLQLIIRAHECVMDGFERFAHGQL  793

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  794  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELN  853

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DRNSLAYI
Sbjct  854  IQRPPTPTRGRPQSASDRNSLAYI  877



>gb|AAM83219.1| AT4g03080/T4I9_4 [Arabidopsis thaliana]
Length=881

 Score =   208 bits (530),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  738  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAPGQL  797

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  798  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  857

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  858  IQRPPTPTRGRPQPDFDRSSLAYI  881



>ref|XP_003591594.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=425

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  282  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  341

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELN
Sbjct  342  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELN  401

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR SLAYI
Sbjct  402  IQRPPTPTRGRPQPDLDRGSLAYI  425



>gb|EMS55151.1| Serine/threonine-protein phosphatase BSL1-like protein [Triticum 
urartu]
Length=770

 Score =   207 bits (527),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  627  SDPTENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIIRAHECVMDGFERFAHGQL  686

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  687  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELN  746

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRP    DRNSLAYI
Sbjct  747  IQRPPTPTRGRPHSAGDRNSLAYI  770



>gb|KDO87443.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=646

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  503  SDPTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQL  562

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELN
Sbjct  563  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELN  622

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  623  IQRPPTPTRGRPQPDLDRNSLAYI  646



>ref|XP_008368904.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
 ref|XP_008363689.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
Length=882

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  739  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL  798

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELN
Sbjct  799  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELN  858

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  859  IQRPPTPTRGRPQPDLDRNSLAYI  882



>ref|XP_008368903.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
 ref|XP_008363688.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
Length=884

 Score =   207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 138/144 (96%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  741  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL  800

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELN
Sbjct  801  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELN  860

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  861  IQRPPTPTRGRPQPDLDRNSLAYI  884



>gb|EMT11348.1| Serine/threonine phosphatase BSL1-like protein [Aegilops tauschii]
Length=840

 Score =   207 bits (527),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  697  SDPTENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIIRAHECVMDGFERFAHGQL  756

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  757  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELN  816

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRP    DRNSLAYI
Sbjct  817  IQRPPTPTRGRPHSAGDRNSLAYI  840



>gb|KDO87442.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=679

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  536  SDPTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQL  595

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELN
Sbjct  596  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELN  655

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  656  IQRPPTPTRGRPQPDLDRNSLAYI  679



>gb|KDP21537.1| hypothetical protein JCGZ_22008 [Jatropha curcas]
Length=886

 Score =   207 bits (526),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  743  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  802

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELN
Sbjct  803  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVMDDTWMQELN  862

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR+SLAYI
Sbjct  863  IQRPPTPTRGRPQPDLDRSSLAYI  886



>ref|XP_002520710.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF41672.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=885

 Score =   207 bits (526),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  742  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  801

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELN
Sbjct  802  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVMDDTWMQELN  861

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR+SLAYI
Sbjct  862  IQRPPTPTRGRPQPDLDRSSLAYI  885



>ref|XP_002270638.2| PREDICTED: serine/threonine-protein phosphatase BSL1 [Vitis vinifera]
 emb|CBI32287.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   206 bits (525),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  745  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  804

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER  +DTWMQELN
Sbjct  805  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERTVDDTWMQELN  864

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  865  IQRPPTPTRGRPQPDLDRNSLAYI  888



>ref|XP_004290707.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Fragaria 
vesca subsp. vesca]
Length=883

 Score =   206 bits (524),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTEND VEGLRPNARGPGLVTFGPDRV DFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  740  SDPTENDGVEGLRPNARGPGLVTFGPDRVMDFCKRNKLQLIIRAHECVMDGFERFAQGQL  799

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP+TSPERV +DTWMQELN
Sbjct  800  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIQSPETSPERVIDDTWMQELN  859

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  860  IQRPPTPTRGRPQPDLDRNSLAYI  883



>ref|XP_011011092.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011012419.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
Length=886

 Score =   206 bits (524),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  743  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  802

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV  D WMQELN
Sbjct  803  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIHDAWMQELN  862

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  863  IQRPPTPTRGRPQPDLDRNSLAYI  886



>gb|KDO87440.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87441.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=810

 Score =   206 bits (523),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  667  SDPTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQL  726

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELN
Sbjct  727  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELN  786

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  787  IQRPPTPTRGRPQPDLDRNSLAYI  810



>ref|XP_011011093.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
 ref|XP_011012420.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
Length=885

 Score =   206 bits (524),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  742  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  801

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV  D WMQELN
Sbjct  802  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIHDAWMQELN  861

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  862  IQRPPTPTRGRPQPDLDRNSLAYI  885



>ref|XP_006444191.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479835.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Citrus sinensis]
 gb|ESR57431.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87437.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87438.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=885

 Score =   206 bits (524),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  742  SDPTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQL  801

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELN
Sbjct  802  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELN  861

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  862  IQRPPTPTRGRPQPDLDRNSLAYI  885



>ref|XP_008386603.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
 ref|XP_008350076.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
Length=886

 Score =   206 bits (523),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLI+RAHECVMDGFERFAQGQL
Sbjct  743  SDPTENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIVRAHECVMDGFERFAQGQL  802

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELN
Sbjct  803  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELN  862

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  863  IQRPPTPTRGRPQPDLDRNSLAYI  886



>ref|XP_006444192.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006444193.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479834.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Citrus sinensis]
 gb|ESR57432.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|ESR57433.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87439.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=889

 Score =   206 bits (523),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  746  SDPTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQL  805

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELN
Sbjct  806  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELN  865

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  866  IQRPPTPTRGRPQPDLDRNSLAYI  889



>ref|XP_009347104.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Pyrus x 
bretschneideri]
Length=885

 Score =   205 bits (522),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 136/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLI+RAHECVMDGFERFAQGQL
Sbjct  742  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIVRAHECVMDGFERFAQGQL  801

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELN
Sbjct  802  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDAWMQELN  861

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  862  IQRPPTPTRGRPQPDLDRNSLAYI  885



>ref|XP_002439264.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
 gb|EES17694.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
Length=895

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 136/144 (94%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  753  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQL  812

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  813  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELN  871

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DRNSLAYI
Sbjct  872  IQRPPTPTRGRPQAAGDRNSLAYI  895



>ref|XP_002301559.1| phosphatase family protein [Populus trichocarpa]
 gb|EEE80832.1| phosphatase family protein [Populus trichocarpa]
Length=890

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRV+DFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  747  SDPTENDSIEGLRPNARGPGLVTFGPDRVSDFCKKNKLQLIIRAHECVMDGFERFAQGQL  806

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELN
Sbjct  807  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDAWMQELN  866

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  867  IQRPPTPTRGRPQPDLDRNSLAYI  890



>ref|XP_008655294.1| PREDICTED: uncharacterized protein LOC100383776 isoform X1 [Zea 
mays]
Length=987

 Score =   205 bits (521),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 136/144 (94%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  845  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQL  904

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  905  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELN  963

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DRNSLAYI
Sbjct  964  IQRPPTPTRGRPQAAGDRNSLAYI  987



>ref|XP_008655295.1| PREDICTED: uncharacterized protein LOC100383776 isoform X2 [Zea 
mays]
Length=979

 Score =   204 bits (520),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 131/144 (91%), Positives = 136/144 (94%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  837  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQL  896

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  897  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELN  955

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DRNSLAYI
Sbjct  956  IQRPPTPTRGRPQAAGDRNSLAYI  979



>ref|XP_003518942.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Glycine max]
Length=881

 Score =   203 bits (517),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  738  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  797

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPERV ++TWMQELN
Sbjct  798  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERVMDETWMQELN  857

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR SLAYI
Sbjct  858  IQRPPTPTRGRPQPDLDRGSLAYI  881



>gb|KHN46606.1| Serine/threonine-protein phosphatase BSL1 [Glycine soja]
Length=818

 Score =   203 bits (516),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  675  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  734

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPERV ++TWMQELN
Sbjct  735  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERVMDETWMQELN  794

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR SLAYI
Sbjct  795  IQRPPTPTRGRPQPDLDRGSLAYI  818



>ref|XP_007201685.1| hypothetical protein PRUPE_ppa022807mg, partial [Prunus persica]
 gb|EMJ02884.1| hypothetical protein PRUPE_ppa022807mg, partial [Prunus persica]
Length=729

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKR KLQLIIRAHECVMDGFERFAQGQL
Sbjct  479  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRKKLQLIIRAHECVMDGFERFAQGQL  538

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV ED WMQELN
Sbjct  539  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDMWMQELN  598

Query  502  IqrpptptrgrpqPDLDRNSLA  437
            IQRPPTPTRGRPQPDLDRNSLA
Sbjct  599  IQRPPTPTRGRPQPDLDRNSLA  620



>ref|XP_010244624.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Nelumbo nucifera]
Length=897

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  754  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  813

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPE V ++TWMQELN
Sbjct  814  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVLDETWMQELN  873

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR+SLAYI
Sbjct  874  IQRPPTPTRGRPQPDLDRSSLAYI  897



>ref|XP_010244625.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Nelumbo nucifera]
Length=888

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 134/144 (93%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  745  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  804

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPE V ++TWMQELN
Sbjct  805  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVLDETWMQELN  864

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR+SLAYI
Sbjct  865  IQRPPTPTRGRPQPDLDRSSLAYI  888



>ref|XP_003591586.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=771

 Score =   202 bits (513),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  628  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  687

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELN
Sbjct  688  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELN  747

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR SLAYI
Sbjct  748  IQRPPTPTRGRPQPDLDRGSLAYI  771



>gb|AES61845.2| serine/threonine-protein phosphatase [Medicago truncatula]
Length=879

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  736  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  795

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELN
Sbjct  796  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELN  855

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR SLAYI
Sbjct  856  IQRPPTPTRGRPQPDLDRGSLAYI  879



>ref|XP_004496006.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Cicer arietinum]
Length=876

 Score =   202 bits (514),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 141/144 (98%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  733  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  792

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELN
Sbjct  793  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELN  852

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR SLAYI
Sbjct  853  IQRPPTPTRGRPQPDLDRGSLAYI  876



>ref|XP_007144577.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
 gb|ESW16571.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
Length=878

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 135/144 (94%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  735  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  794

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER  ++TWMQELN
Sbjct  795  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERGMDETWMQELN  854

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR SLAYI
Sbjct  855  IQRPPTPTRGRPQPDLDRGSLAYI  878



>ref|XP_002321044.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE99359.2| phosphatase family protein [Populus trichocarpa]
Length=892

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  749  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQL  808

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPE V +DTWMQELN
Sbjct  809  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELN  868

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRP TPTRGRPQPD DR+SLAYI
Sbjct  869  IQRPQTPTRGRPQPDHDRSSLAYI  892



>ref|XP_006826451.1| hypothetical protein AMTR_s00004p00179740, partial [Amborella 
trichopoda]
 gb|ERM93688.1| hypothetical protein AMTR_s00004p00179740, partial [Amborella 
trichopoda]
Length=671

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRV DFCK+N+LQLIIRAHECVMDGFERFAQG L
Sbjct  528  SDPTENDSIEGLRPNARGPGLVTFGPDRVLDFCKKNRLQLIIRAHECVMDGFERFAQGHL  587

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGR LV+VPKLIHPLPPP  SP++SP+   E+TWMQELN
Sbjct  588  ITLFSATNYCGTANNAGAILVVGRDLVVVPKLIHPLPPPFQSPESSPDHALEETWMQELN  647

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQP  DRNSLA+I
Sbjct  648  IQRPPTPTRGRPQPAHDRNSLAFI  671



>gb|KGN66603.1| hypothetical protein Csa_1G638500 [Cucumis sativus]
Length=288

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  145  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  204

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN
Sbjct  205  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELN  264

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA++
Sbjct  265  ANRPPTPTRGRPQVANDRGSLAWM  288



>ref|XP_010914371.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Elaeis guineensis]
Length=611

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  468  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  527

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP++SP+ V EDTWMQELN
Sbjct  528  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELN  587

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DR+SLAYI
Sbjct  588  IQRPPTPTRGRPQSANDRHSLAYI  611



>ref|XP_010914370.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Elaeis guineensis]
Length=619

 Score =   199 bits (505),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  476  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  535

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP++SP+ V EDTWMQELN
Sbjct  536  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELN  595

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DR+SLAYI
Sbjct  596  IQRPPTPTRGRPQSANDRHSLAYI  619



>ref|XP_003536338.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Glycine 
max]
Length=881

 Score =   201 bits (510),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 133/144 (92%), Positives = 140/144 (97%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  738  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  797

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPER  ++TWMQELN
Sbjct  798  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERGMDETWMQELN  857

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDR SLAYI
Sbjct  858  IQRPPTPTRGRPQPDLDRGSLAYI  881



>gb|AFY26889.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Morella rubra]
Length=887

 Score =   200 bits (509),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  744  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  803

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPLLSP+TSPERV +D WMQELN
Sbjct  804  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLLSPETSPERVIDDAWMQELN  863

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPDLDRNSLAYI
Sbjct  864  IQRPPTPTRGRPQPDLDRNSLAYI  887



>ref|XP_010914369.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Elaeis guineensis]
Length=669

 Score =   199 bits (505),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 132/144 (92%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  526  SDPTENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  585

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP++SP+ V EDTWMQELN
Sbjct  586  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELN  645

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DR+SLAYI
Sbjct  646  IQRPPTPTRGRPQSANDRHSLAYI  669



>ref|NP_001266004.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 ref|XP_010326541.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326542.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69819.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 gb|AFU48608.1| BSL1, partial [Solanum lycopersicum]
Length=878

 Score =   199 bits (505),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 137/144 (95%), Positives = 142/144 (99%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct  735  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL  794

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPLLSP+TSPERV +DTWMQELN
Sbjct  795  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLLSPETSPERVMDDTWMQELN  854

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  855  IQRPPTPTRGRPQPDHDRSSLAYI  878



>gb|ACR38393.1| unknown [Zea mays]
Length=213

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  69   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  128

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  129  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  188



>gb|KJB42021.1| hypothetical protein B456_007G132700 [Gossypium raimondii]
Length=878

 Score =   198 bits (503),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV DFCK+N+LQLIIRAHECVMDGFERFA GQL
Sbjct  735  SDPTENDSVEGLRPNARGPGLVTFGPDRVADFCKKNRLQLIIRAHECVMDGFERFAHGQL  794

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP+ SPERV +D WMQELN
Sbjct  795  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIHSPEASPERVGDDAWMQELN  854

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQP++DRNSLAYI
Sbjct  855  IQRPPTPTRGRPQPEVDRNSLAYI  878



>gb|EYU41290.1| hypothetical protein MIMGU_mgv1a0202662mg, partial [Erythranthe 
guttata]
Length=554

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  411  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  470

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER+ EDTWMQELN
Sbjct  471  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERLIEDTWMQELN  530

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  531  ANRPPTPTRGRPQVTNDRGSLAWI  554



>gb|KHG15629.1| Serine/threonine-protein phosphatase BSL1 -like protein [Gossypium 
arboreum]
Length=838

 Score =   197 bits (501),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRV DFCK+N+LQLIIRAHECVMDGFERFA GQL
Sbjct  695  SDPTENDSIEGLRPNARGPGLVTFGPDRVADFCKKNRLQLIIRAHECVMDGFERFAHGQL  754

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP+ SPERV +D WMQELN
Sbjct  755  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIHSPEASPERVGDDAWMQELN  814

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQP++DRNSLAYI
Sbjct  815  IQRPPTPTRGRPQPEVDRNSLAYI  838



>ref|XP_001760494.1| predicted protein [Physcomitrella patens]
 gb|EDQ74569.1| predicted protein [Physcomitrella patens]
Length=954

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG L
Sbjct  811  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHL  870

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP++SPER  EDTWMQELN
Sbjct  871  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAITSPESSPERHLEDTWMQELN  930

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            +QRPPTPTRGRPQ   DR SLA+I
Sbjct  931  VQRPPTPTRGRPQAGNDRGSLAWI  954



>ref|NP_001131445.1| uncharacterized LOC100192777 [Zea mays]
 gb|ACF79850.1| unknown [Zea mays]
Length=290

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  146  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  205

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  206  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  265



>ref|NP_001167772.1| uncharacterized protein LOC100381465 [Zea mays]
 gb|ACN26023.1| unknown [Zea mays]
Length=157

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 109/120 (91%), Gaps = 1/120 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  14   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  73

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+ + EDTWMQELN
Sbjct  74   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPEASPDHI-EDTWMQELN  132



>ref|XP_001769730.1| predicted protein [Physcomitrella patens]
 gb|EDQ65531.1| predicted protein [Physcomitrella patens]
Length=962

 Score =   197 bits (500),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVT+GPDRV +FCK N LQLI+RAHECVMDGFERFAQG L
Sbjct  819  SDPTENDSVEGLRPNARGPGLVTYGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHL  878

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPER  EDTWMQ+LN
Sbjct  879  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPESSPERHLEDTWMQDLN  938

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            + RPPTPTRGRPQP  DRNSLA+I
Sbjct  939  VARPPTPTRGRPQPTSDRNSLAWI  962



>gb|KFK30905.1| hypothetical protein AALP_AA6G041300 [Arabis alpina]
Length=878

 Score =   196 bits (497),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  735  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  794

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+LSP+ SPE   +D WMQELN
Sbjct  795  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPILSPENSPEHSGDDAWMQELN  854

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQPD DR+SLAYI
Sbjct  855  IQRPPTPTRGRPQPDFDRSSLAYI  878



>gb|EYU25965.1| hypothetical protein MIMGU_mgv1a0006241mg, partial [Erythranthe 
guttata]
Length=701

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  558  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  617

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER+ EDTWMQELN
Sbjct  618  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERLIEDTWMQELN  677

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  678  ANRPPTPTRGRPQVTNDRGSLAWI  701



>gb|KJB55562.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=528

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  385  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  444

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  445  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  504

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  505  ANRPPTPTRGRPQVANDRGSLAWI  528



>ref|XP_010647448.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Vitis 
vinifera]
 ref|XP_010647506.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Vitis 
vinifera]
Length=660

 Score =   193 bits (491),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  517  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  576

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  577  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  636

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  637  ANRPPTPTRGRPQVTNDRGSLAWI  660



>ref|NP_001189614.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 gb|AEC07954.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1001

 Score =   196 bits (497),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  858   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  917

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  918   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELN  977

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
             + RPPTPTRGRPQ   DR SLA+I
Sbjct  978   VNRPPTPTRGRPQNPNDRGSLAWI  1001



>ref|NP_180289.3| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 sp|Q9SHS7.2|BSL3_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL3; AltName: 
Full=BSU1-like protein 3 [Arabidopsis thaliana]
 gb|AEC07953.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1006

 Score =   196 bits (497),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  863   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  922

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  923   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELN  982

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
             + RPPTPTRGRPQ   DR SLA+I
Sbjct  983   VNRPPTPTRGRPQNPNDRGSLAWI  1006



>ref|XP_006591057.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=1014

 Score =   196 bits (497),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  871   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  930

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SPDTSPER  EDTWMQELN
Sbjct  931   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDTSPERHIEDTWMQELN  990

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  991   ANRPPTPTRGRPQVTNDRGSLAWI  1014



>ref|XP_003538088.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=1010

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  867   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  926

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SPDTSPER  EDTWMQELN
Sbjct  927   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDTSPERHIEDTWMQELN  986

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  987   ANRPPTPTRGRPQVTNDRGSLAWI  1010



>emb|CDY57791.1| BnaCnng32470D [Brassica napus]
Length=997

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG L
Sbjct  854  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHL  913

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN
Sbjct  914  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHVDDTWMQELN  973

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  974  ANRPPTPTRGRPQTPDDRGSLAWI  997



>gb|KHN36505.1| Serine/threonine-protein phosphatase BSL2 [Glycine soja]
Length=861

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  718  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  777

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  778  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  837

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRP    DR SLA+I
Sbjct  838  ANRPPTPTRGRPPVTNDRGSLAWI  861



>gb|KEH38997.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=882

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  739  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  798

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  799  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  858

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRP    DR SLA+I
Sbjct  859  ANRPPTPTRGRPPVTNDRGSLAWI  882



>ref|XP_006408677.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
 gb|ESQ50130.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
Length=1005

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  921

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  922   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELN  981

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  982   ANRPPTPTRGRPQTPNDRGSLAWI  1005



>ref|XP_004170230.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=654

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  511  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  570

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  571  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELN  630

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  631  ANRPPTPTRGRPQVTNDRGSLAWI  654



>ref|XP_003543410.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=988

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  845  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  904

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  905  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  964

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRP    DR SLA+I
Sbjct  965  ANRPPTPTRGRPPVTNDRGSLAWI  988



>dbj|BAK06303.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  253  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  312

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  313  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPTITSPETSPEHHIEDTWMQELN  372



>ref|XP_003596905.1| Serine/threonine protein phosphatase [Medicago truncatula]
 gb|AES67156.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=995

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  852  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  911

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  912  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  971

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRP    DR SLA+I
Sbjct  972  ANRPPTPTRGRPPVTNDRGSLAWI  995



>ref|XP_004291538.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Fragaria 
vesca subsp. vesca]
Length=998

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  855  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  914

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  915  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  974

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  975  ANRPPTPTRGRPQVANDRGSLAWI  998



>ref|XP_007150014.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
 gb|ESW22008.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
Length=996

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  853  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  912

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  913  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  972

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRP    DR SLA+I
Sbjct  973  ANRPPTPTRGRPPVTNDRGSLAWI  996



>ref|XP_010045170.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Eucalyptus 
grandis]
 gb|KCW87326.1| hypothetical protein EUGRSUZ_B03812 [Eucalyptus grandis]
Length=999

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  856  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNINDLQLIVRAHECVMDGFERFAQGHL  915

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  916  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  975

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  976  ANRPPTPTRGRPQVATDRGSLAWI  999



>ref|XP_003540821.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1001

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  858   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  917

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  918   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  977

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  978   ANRPPTPTRGRPQVTNDRGSLAWI  1001



>ref|XP_002264614.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Vitis vinifera]
Length=1006

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  863   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  922

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  923   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHLEDTWMQELN  982

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  983   ANRPPTPTRGRPQVTNDRGSLAWI  1006



>ref|XP_009336399.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336400.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Pyrus x bretschneideri]
Length=1001

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  858   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  917

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  918   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  977

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  978   ANRPPTPTRGRPQGANDRGSLAWI  1001



>ref|XP_009373887.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Pyrus 
x bretschneideri]
Length=1001

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  858   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  917

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  918   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  977

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  978   ANRPPTPTRGRPQGANDRGSLAWI  1001



>ref|XP_004506226.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004506227.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Cicer arietinum]
Length=1003

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  860   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  919

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  920   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  979

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRP    DR SLA+I
Sbjct  980   ANRPPTPTRGRPPVANDRGSLAWI  1003



>ref|XP_007208428.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
 gb|EMJ09627.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
Length=1005

 Score =   194 bits (493),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  921

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  922   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  981

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  982   ANRPPTPTRGRPQVANDRGSLAWI  1005



>ref|XP_011090288.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Sesamum indicum]
Length=1007

 Score =   194 bits (493),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  864   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  923

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  924   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  983

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  984   ANRPPTPTRGRPQVPNDRGSLAWI  1007



>ref|XP_011090289.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Sesamum indicum]
Length=1006

 Score =   194 bits (493),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  863   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  922

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  923   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  982

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  983   ANRPPTPTRGRPQVPNDRGSLAWI  1006



>ref|XP_008361620.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Malus 
domestica]
Length=1001

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  858   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  917

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  918   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  977

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  978   ANRPPTPTRGRPQGANDRGSLAWI  1001



>gb|KJB55561.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=700

 Score =   192 bits (487),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  557  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  616

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  617  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  676

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  677  ANRPPTPTRGRPQVANDRGSLAWI  700



>ref|XP_009368358.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Pyrus x 
bretschneideri]
Length=1004

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  861   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  920

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  921   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  980

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  981   ANRPPTPTRGRPQVANDRGSLAWI  1004



>ref|XP_004164757.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like, partial 
[Cucumis sativus]
Length=864

 Score =   192 bits (489),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  721  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  780

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN
Sbjct  781  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELN  840

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA++
Sbjct  841  ANRPPTPTRGRPQVANDRGSLAWM  864



>ref|XP_008230041.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Prunus mume]
Length=1004

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  861   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  920

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  921   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  980

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  981   ANRPPTPTRGRPQVANDRGSLAWI  1004



>ref|XP_009398342.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=985

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLIIRAHECVMDGFERFAQG L
Sbjct  842  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIIRAHECVMDGFERFAQGHL  901

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  902  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPVINSPETSPERRIEDTWMQELN  961

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  962  ANRPPTPTRGRPQVANDRGSLAWI  985



>ref|XP_002879075.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55334.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=1002

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  859   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  918

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  919   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELN  978

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  979   ANRPPTPTRGRPQNPNDRGSLAWI  1002



>ref|XP_008230036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Prunus mume]
Length=1005

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  921

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  922   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  981

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  982   ANRPPTPTRGRPQVANDRGSLAWI  1005



>ref|XP_009398341.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=986

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLIIRAHECVMDGFERFAQG L
Sbjct  843  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIIRAHECVMDGFERFAQGHL  902

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  903  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPVINSPETSPERRIEDTWMQELN  962

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  963  ANRPPTPTRGRPQVANDRGSLAWI  986



>ref|XP_006295510.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
 gb|EOA28408.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
Length=999

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  856  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  915

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  916  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELN  975

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  976  ANRPPTPTRGRPQNPNDRGSLAWI  999



>gb|KDP42962.1| hypothetical protein JCGZ_23904 [Jatropha curcas]
Length=1008

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  865   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  924

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  925   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  984

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  985   ANRPPTPTRGRPQVANDRGSLAWI  1008



>ref|XP_008385576.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Malus domestica]
Length=1002

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  859   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  918

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  919   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  978

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  979   ANRPPTPTRGRPQVANDRGSLAWI  1002



>ref|XP_009775149.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
Length=286

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 118/144 (82%), Gaps = 3/144 (2%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  146  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  205

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR   +V       P P  SP+ SPER+ EDTWMQELN
Sbjct  206  ITLFSATNYCGTANNAGAILVLGR--DLVVVPKLIHPLPPASPENSPERM-EDTWMQELN  262

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  263  ANRPPTPTRGRPQTANDRGSLAWI  286



>ref|XP_010513312.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1045

 Score =   194 bits (493),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  902   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  961

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  962   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELN  1021

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  1022  ANRPPTPTRGRPQNPNDRGSLAWI  1045



>ref|XP_007015660.1| BRI1 suppressor 1 (BSU1)-like 3 isoform 4 [Theobroma cacao]
 gb|EOY33279.1| BRI1 suppressor 1 (BSU1)-like 3 isoform 4 [Theobroma cacao]
Length=822

 Score =   192 bits (488),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  679  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  738

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  739  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  798

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  799  ANRPPTPTRGRPQVTNDRGSLAWI  822



>ref|XP_004487445.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cicer 
arietinum]
Length=1003

 Score =   194 bits (492),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  860   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  919

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  920   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  979

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  980   ANRPPTPTRGRPQVTNDRGSLAWI  1003



>ref|XP_009412503.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=981

 Score =   193 bits (491),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  838  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  897

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SPD SPE   EDTWMQELN
Sbjct  898  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDASPEHHTEDTWMQELN  957

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  958  ANRPPTPTRGRPQSSNDRGSLAWI  981



>emb|CBI24435.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score =   194 bits (492),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  906   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  965

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  966   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHLEDTWMQELN  1025

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  1026  ANRPPTPTRGRPQVTNDRGSLAWI  1049



>ref|XP_010685448.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Beta vulgaris 
subsp. vulgaris]
Length=1019

 Score =   194 bits (492),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  876   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  935

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  936   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  995

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  996   ANRPPTPTRGRPQVANDRGSLAWI  1019



>ref|XP_009418973.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=982

 Score =   193 bits (491),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  839  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  898

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  899  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAINSPEASPERHTEDTWMQELN  958

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  959  ANRPPTPTRGRPQTSNDRGSLAWI  982



>ref|XP_010904839.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 homolog [Elaeis guineensis]
Length=888

 Score =   192 bits (488),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDS+EGLRPNARGPGLV FGPDRV DFC +N+LQLIIRAHECVMDGFERFAQGQL
Sbjct  745  SDPTENDSIEGLRPNARGPGLVAFGPDRVADFCTKNQLQLIIRAHECVMDGFERFAQGQL  804

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            IT+FSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP  SP++SPE V EDTWMQELN
Sbjct  805  ITVFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPQQSPESSPEHVLEDTWMQELN  864

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DRNSLAYI
Sbjct  865  IQRPPTPTRGRPQSANDRNSLAYI  888



>ref|XP_004139147.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=981

 Score =   193 bits (490),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  838  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  897

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN
Sbjct  898  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELN  957

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA++
Sbjct  958  ANRPPTPTRGRPQVANDRGSLAWM  981



>ref|XP_008450272.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450273.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450274.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
Length=1008

 Score =   193 bits (491),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  865   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  924

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN
Sbjct  925   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELN  984

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA++
Sbjct  985   ANRPPTPTRGRPQVANDRGSLAWM  1008



>gb|KHN03759.1| Serine/threonine-protein phosphatase BSL1 [Glycine soja]
Length=820

 Score =   191 bits (486),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 140/155 (90%), Gaps = 11/155 (7%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQL
Sbjct  666  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQL  725

Query  682  ITLFSATNYC-----------GTANNAGAILVVGRGlvivpklihplppplLSPDTSPER  536
            ITLFSATNYC           GTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPER
Sbjct  726  ITLFSATNYCAFQSHAGCVILGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPER  785

Query  535  VNEDTWMQELNIqrpptptrgrpqPDLDRNSLAYI  431
              ++TWMQELNIQRPPTPTRGRPQPDLDR SLAYI
Sbjct  786  GMDETWMQELNIQRPPTPTRGRPQPDLDRGSLAYI  820



>ref|XP_009140775.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Brassica 
rapa]
Length=998

 Score =   193 bits (490),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  855  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  914

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN
Sbjct  915  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIDDTWMQELN  974

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  975  ANRPPTPTRGRPQTPDDRGSLAWI  998



>ref|XP_010544322.1| PREDICTED: serine/threonine-protein phosphatase BSL2 isoform 
X2 [Tarenaya hassleriana]
Length=991

 Score =   193 bits (490),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  848  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  907

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  908  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  967

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  968  ANRPPTPTRGRPQSPNDRGSLAWI  991



>emb|CDY57485.1| BnaAnng14650D [Brassica napus]
Length=998

 Score =   193 bits (490),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  855  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  914

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN
Sbjct  915  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIDDTWMQELN  974

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  975  ANRPPTPTRGRPQTPDDRGSLAWI  998



>ref|XP_010544321.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Tarenaya hassleriana]
Length=1015

 Score =   193 bits (490),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  872   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  931

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  932   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  991

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  992   ANRPPTPTRGRPQSPNDRGSLAWI  1015



>gb|KHG22818.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1015

 Score =   193 bits (490),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  872   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  931

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  932   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  991

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  992   ANRPPTPTRGRPQVANDRGSLAWI  1015



>ref|XP_004140171.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
 gb|KGN48053.1| hypothetical protein Csa_6G426880 [Cucumis sativus]
Length=1002

 Score =   193 bits (490),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  859   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  918

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  919   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELN  978

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  979   ANRPPTPTRGRPQVTNDRGSLAWI  1002



>ref|XP_006369377.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
 gb|ERP65946.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
Length=1000

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  857  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  916

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  917  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELN  976

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  977  ANRPPTPTRGRPQVTNDRGSLAWI  1000



>ref|XP_010557449.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Tarenaya 
hassleriana]
Length=1008

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  865   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCSNNDLQLIVRAHECVMDGFERFAQGHL  924

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  925   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  984

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  985   ANRPPTPTRGRPQAPNDRGSLAWI  1008



>ref|XP_007015657.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015658.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015659.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33276.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33277.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33278.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
Length=1019

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  876   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  935

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  936   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  995

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  996   ANRPPTPTRGRPQVTNDRGSLAWI  1019



>ref|XP_008449600.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Cucumis 
melo]
Length=1002

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  859   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  918

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  919   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELN  978

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  979   ANRPPTPTRGRPQVTNDRGSLAWI  1002



>ref|XP_011008746.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  868   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  927

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  928   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELN  987

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  988   ANRPPTPTRGRPQVTNDRGSLAWI  1011



>ref|XP_011008648.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Populus 
euphratica]
Length=1011

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  868   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  927

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  928   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELN  987

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  988   ANRPPTPTRGRPQVTNDRGSLAWI  1011



>ref|XP_011044597.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  868   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  927

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+ P+ IHPLPP + SP+ SPER  EDTWMQELN
Sbjct  928   ITLFSATNYCGTANNAGAILVLGRDLVVGPQHIHPLPPAISSPEASPERHIEDTWMQELN  987

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  988   ANRPPTPTRGRPQVTNDRGSLAWI  1011



>ref|XP_007132502.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
 gb|ESW04496.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
Length=1007

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  864   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  923

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  924   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  983

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   +R SLA+I
Sbjct  984   ANRPPTPTRGRPQVTNERGSLAWI  1007



>ref|XP_004960470.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Setaria italica]
Length=887

 Score =   191 bits (485),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 136/144 (94%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct  745  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQL  804

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP++SPER  + TWMQELN
Sbjct  805  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPVNSPESSPER-GDATWMQELN  863

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
            IQRPPTPTRGRPQ   DRNSLAYI
Sbjct  864  IQRPPTPTRGRPQAAGDRNSLAYI  887



>gb|KJB55556.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55557.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55558.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55559.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55560.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=1016

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  873   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  932

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  933   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  992

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  993   ANRPPTPTRGRPQVANDRGSLAWI  1016



>gb|KHG29076.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1016

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  873   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  932

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  933   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  992

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  993   ANRPPTPTRGRPQVANDRGSLAWI  1016



>gb|EYU36016.1| hypothetical protein MIMGU_mgv1a000720mg [Erythranthe guttata]
Length=1005

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  921

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN
Sbjct  922   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIDDTWMQELN  981

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  982   ANRPPTPTRGRPQVANDRGSLAWI  1005



>gb|KJB35468.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35469.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=682

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  539  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  598

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  599  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  658

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA I
Sbjct  659  ANRPPTPTRGRPQVANDRGSLACI  682



>ref|XP_011088983.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Sesamum indicum]
Length=1015

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  872   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  931

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  932   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEHHIEDTWMQELN  991

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  992   ANRPPTPTRGRPQVANDRGSLAWI  1015



>gb|KHN17986.1| Serine/threonine-protein phosphatase BSL2 [Glycine soja]
Length=929

 Score =   191 bits (485),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  786  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  845

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  846  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEPHIEDTWMQELN  905

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRP    DR SLA+I
Sbjct  906  ANRPPTPTRGRPPVTNDRGSLAWI  929



>dbj|BAF02235.1| putative protein serine/threonine phosphatase alpha [Arabidopsis 
thaliana]
Length=737

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  593  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  652

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  653  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  712



>gb|KDO46579.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=744

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  605  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  664

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  665  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  724



>ref|XP_009388972.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=986

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  843  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  902

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+ SPE   EDTWMQELN
Sbjct  903  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAVSSPEASPEHHIEDTWMQELN  962

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  963  ANRPPTPTRGRPQVASDRGSLAWI  986



>ref|XP_009606099.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana tomentosiformis]
Length=643

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  501  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  560

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN
Sbjct  561  ITLFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELN  619

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  620  ANRPPTPTRGRPQVANDRGSLAWI  643



>ref|XP_010263036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Nelumbo 
nucifera]
Length=1015

 Score =   191 bits (486),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  872   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  931

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP TSPE   EDTWMQELN
Sbjct  932   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAVASPQTSPEHHIEDTWMQELN  991

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  992   ANRPPTPTRGRPQVANDRGSLAWI  1015



>ref|XP_008787776.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Phoenix dactylifera]
Length=826

 Score =   189 bits (481),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  683  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  742

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   EDTWMQELN
Sbjct  743  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELN  802

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  803  ANRPPTPTRGRPQVANDRGSLAWI  826



>ref|XP_008787777.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Phoenix dactylifera]
Length=825

 Score =   189 bits (481),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  682  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  741

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   EDTWMQELN
Sbjct  742  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELN  801

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  802  ANRPPTPTRGRPQVANDRGSLAWI  825



>ref|XP_003539489.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1003

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  860   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  919

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  920   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEPHIEDTWMQELN  979

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRP    DR SLA+I
Sbjct  980   ANRPPTPTRGRPPVTNDRGSLAWI  1003



>ref|XP_009606096.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana tomentosiformis]
Length=678

 Score =   189 bits (479),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  536  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  595

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN
Sbjct  596  ITLFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELN  654

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  655  ANRPPTPTRGRPQVANDRGSLAWI  678



>ref|XP_001765008.1| predicted protein [Physcomitrella patens]
 gb|EDQ70224.1| predicted protein [Physcomitrella patens]
Length=986

 Score =   191 bits (484),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 132/149 (89%), Gaps = 5/149 (3%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVT+GPDRV +FCK N LQLI+RAHECVMDGFERFAQG L
Sbjct  838  SDPTENDSVEGLRPNARGPGLVTYGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHL  897

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQ---  512
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPER  EDTWMQ   
Sbjct  898  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPESSPERHLEDTWMQARN  957

Query  511  --ELNIqrpptptrgrpqPDLDRNSLAYI  431
              +LN+ RPPTPTRGRPQP  DRNSLA+I
Sbjct  958  SKDLNVARPPTPTRGRPQPTSDRNSLAWI  986



>ref|XP_010473113.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Camelina 
sativa]
Length=1011

 Score =   191 bits (484),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  870   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  929

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  930   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELN  989

Query  502   IqrpptptrgrpqPDLDRNSLA  437
               RPPTPTRGRPQ   DR SLA
Sbjct  990   ANRPPTPTRGRPQNPNDRGSLA  1011



>ref|NP_001275238.1| serine/threonine-protein phosphatase BSL3-like [Solanum tuberosum]
 gb|AFN44701.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=999

 Score =   191 bits (484),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  856  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  915

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  916  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  975

Query  502  IqrpptptrgrpqPDLDRNSLAY  434
              RPPTPTRGRPQ   DR S+A+
Sbjct  976  ANRPPTPTRGRPQVANDRGSVAW  998



>ref|XP_010247574.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nelumbo 
nucifera]
Length=1021

 Score =   191 bits (485),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  878   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  937

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + +P TSPE   EDTWMQELN
Sbjct  938   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAIATPQTSPEHHIEDTWMQELN  997

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA+I
Sbjct  998   ANRPPTPTRGRPQVASDRGSLAWI  1021



>gb|KJB35474.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=982

 Score =   191 bits (484),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  839  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  898

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  899  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  958

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA I
Sbjct  959  ANRPPTPTRGRPQVANDRGSLACI  982



>ref|XP_003605992.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=875

 Score =   189 bits (481),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  733  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  792

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR  ++V   +    PP LSP+TSPER  EDTWMQELN
Sbjct  793  ITLFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPALSPETSPERHIEDTWMQELN  851

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRP    DR SLA+I
Sbjct  852  ANRPPTPTRGRPPVANDRGSLAWI  875



>ref|XP_004241349.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Solanum lycopersicum]
Length=996

 Score =   191 bits (484),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  853  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  912

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  913  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  972

Query  502  IqrpptptrgrpqPDLDRNSLAY  434
              RPPTPTRGRPQ   DR S+A+
Sbjct  973  ANRPPTPTRGRPQVANDRGSVAW  995



>gb|KJB35470.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35471.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35472.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1015

 Score =   191 bits (484),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  872   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  931

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  932   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELN  991

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA I
Sbjct  992   ANRPPTPTRGRPQVANDRGSLACI  1015



>ref|XP_006367582.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Solanum 
tuberosum]
Length=744

 Score =   188 bits (478),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  602  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  661

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+ SPER+ EDTWMQELN
Sbjct  662  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPENSPERM-EDTWMQELN  720

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  721  ANRPPTPTRGRPQTANDRGSLAWI  744



>ref|XP_009770255.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana sylvestris]
Length=949

 Score =   190 bits (482),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  807  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  866

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN
Sbjct  867  ITLFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELN  925

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  926  ANRPPTPTRGRPQVANDRGSLAWI  949



>ref|XP_010907354.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Elaeis guineensis]
Length=1028

 Score =   190 bits (483),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  886   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  945

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE + EDTWMQELN
Sbjct  946   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHI-EDTWMQELN  1004

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGR Q   DR+SLA+I
Sbjct  1005  ANRPPTPTRGRSQAANDRSSLAWI  1028



>ref|XP_010907353.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Elaeis guineensis]
Length=1029

 Score =   190 bits (483),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  887   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  946

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE + EDTWMQELN
Sbjct  947   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHI-EDTWMQELN  1005

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGR Q   DR+SLA+I
Sbjct  1006  ANRPPTPTRGRSQAANDRSSLAWI  1029



>ref|XP_009770253.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana sylvestris]
Length=984

 Score =   190 bits (482),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  842  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  901

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN
Sbjct  902  ITLFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELN  960

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  961  ANRPPTPTRGRPQVANDRGSLAWI  984



>ref|XP_009795596.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL3-like [Nicotiana sylvestris]
Length=989

 Score =   190 bits (482),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  847  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  906

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN
Sbjct  907  ITLFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELN  965

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  966  ANRPPTPTRGRPQVANDRGSLAWI  989



>gb|AES88189.2| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=999

 Score =   190 bits (482),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  857  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  916

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR  ++V   +    PP LSP+TSPER  EDTWMQELN
Sbjct  917  ITLFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPALSPETSPERHIEDTWMQELN  975

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRP    DR SLA+I
Sbjct  976  ANRPPTPTRGRPPVANDRGSLAWI  999



>ref|XP_010941606.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Elaeis guineensis]
Length=978

 Score =   190 bits (482),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  835  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  894

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   EDTWMQELN
Sbjct  895  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELN  954

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  955  ANRPPTPTRGRPQVANDRGSLAWI  978



>ref|XP_008811286.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Phoenix dactylifera]
Length=994

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  851  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  910

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+   EDTWMQELN
Sbjct  911  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELN  970

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGR Q   DR+SLA+I
Sbjct  971  ANRPPTPTRGRSQAANDRSSLAWI  994



>ref|XP_006424083.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 ref|XP_006487860.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Citrus 
sinensis]
 gb|ESR37323.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46577.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=998

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  859  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  918

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  919  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  978



>ref|XP_002513730.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF48677.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=874

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  731  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  790

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + S + SPER  EDTWMQELN
Sbjct  791  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSAEASPERHIEDTWMQELN  850

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  851  ANRPPTPTRGRPQVTNDRGSLAWI  874



>ref|XP_008811285.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Phoenix dactylifera]
Length=995

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  852  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  911

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+   EDTWMQELN
Sbjct  912  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELN  971

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGR Q   DR+SLA+I
Sbjct  972  ANRPPTPTRGRSQAANDRSSLAWI  995



>ref|XP_008811284.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Phoenix dactylifera]
Length=995

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  852  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  911

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+   EDTWMQELN
Sbjct  912  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELN  971

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGR Q   DR+SLA+I
Sbjct  972  ANRPPTPTRGRSQAANDRSSLAWI  995



>gb|AFW68155.1| putative kelch repeat-containing protein containing ser/thr protein 
kinase family protein [Zea mays]
Length=396

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 109/120 (91%), Gaps = 1/120 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  253  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  312

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+ + EDTWMQELN
Sbjct  313  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPEASPDHI-EDTWMQELN  371



>ref|XP_006424082.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|ESR37322.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46576.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=999

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  859  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  918

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  919  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  978



>ref|XP_006592359.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=996

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  858  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  917

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  918  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  977



>ref|XP_011090290.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Sesamum indicum]
Length=1005

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  864  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  923

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  924  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  983



>ref|XP_010458078.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Camelina 
sativa]
Length=1017

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  873  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  932

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  933  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  992



>ref|XP_006303893.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
 gb|EOA36791.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
Length=1018

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  874  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  933

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  934  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  993



>ref|XP_010488844.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Camelina 
sativa]
Length=1022

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  878  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  937

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  938  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  997



>ref|XP_010475640.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X1 [Camelina sativa]
 ref|XP_010475641.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X2 [Camelina sativa]
Length=1023

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  879  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  938

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  939  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  998



>ref|XP_010322449.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Solanum lycopersicum]
Length=994

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  853  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  912

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  913  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  972



>dbj|BAH19666.1| AT1G08420 [Arabidopsis thaliana]
Length=1018

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  874  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  933

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  934  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  993



>ref|NP_172318.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 sp|Q9SJF0.2|BSL2_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL2; AltName: 
Full=BSU1-like protein 2 [Arabidopsis thaliana]
 gb|AEE28287.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1018

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  874  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  933

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  934  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  993



>ref|XP_002889692.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65951.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1017

 Score =   189 bits (481),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  873  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  932

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  933  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  992



>ref|NP_001266022.1| Hop-interacting protein THI140 [Solanum lycopersicum]
 gb|AEW69826.1| Hop-interacting protein THI140 [Solanum lycopersicum]
Length=982

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  840  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  899

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+ SPER+ EDTWMQELN
Sbjct  900  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPENSPERM-EDTWMQELN  958

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SLA+I
Sbjct  959  ANRPPTPTRGRPQTANDRGSLAWI  982



>ref|NP_001184935.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 gb|AEE28288.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1013

 Score =   189 bits (481),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  869  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  928

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  929  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  988



>gb|EEE65895.1| hypothetical protein OsJ_21718 [Oryza sativa Japonica Group]
Length=944

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  800  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  859

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  860  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELN  919

Query  502  Iqrpptptr-grpqPDLDRNSLAYI  431
              RPPTPTR      + DR SLA+I
Sbjct  920  ANRPPTPTRGRPQAANNDRGSLAWI  944



>emb|CDP15567.1| unnamed protein product [Coffea canephora]
Length=1012

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  871  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  930

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  931  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELN  990



>ref|NP_001067290.1| Os12g0617900 [Oryza sativa Japonica Group]
 sp|Q2QM47.2|BSL2_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL2 homolog; 
AltName: Full=BSU1-like protein 2 homolog [Oryza sativa 
Japonica Group]
 gb|ABA99873.2| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30309.1| Os12g0617900 [Oryza sativa Japonica Group]
 dbj|BAG89347.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69687.1| hypothetical protein OsI_39138 [Oryza sativa Indica Group]
Length=1009

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 119/145 (82%), Gaps = 1/145 (1%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  865   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  924

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  925   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELN  984

Query  502   I-qrpptptrgrpqPDLDRNSLAYI  431
               + P          + DR SLA+I
Sbjct  985   ANRPPTPTRGRPQAANNDRGSLAWI  1009



>gb|EMS59471.1| Serine/threonine-protein phosphatase BSL2-like protein [Triticum 
urartu]
Length=864

 Score =   187 bits (476),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  719  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  778

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  779  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  838



>ref|XP_004963199.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Setaria italica]
Length=997

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  853  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  912

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  913  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  972

Query  502  I-qrpptptrgrpqPDLDRNSLAYI  431
              + P         P+ DR SLA+I
Sbjct  973  ANRPPTPTRGRPQAPNNDRGSLAWI  997



>ref|XP_008674098.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Zea mays]
 tpg|DAA54714.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=998

 Score =   188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  854  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  913

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  914  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  973

Query  502  I-qrpptptrgrpqPDLDRNSLAYI  431
              + P         P+ DR SLA+I
Sbjct  974  ANRPPTPTRGRPQAPNNDRGSLAWI  998



>ref|XP_001781021.1| predicted protein [Physcomitrella patens]
 gb|EDQ54130.1| predicted protein [Physcomitrella patens]
Length=1047

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG L
Sbjct  904   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHL  963

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   +D WMQELN
Sbjct  964   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPEHSPEHHLDDIWMQELN  1023

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQP  DR SLA+I
Sbjct  1024  EHRPPTPTRGRPQPAHDRGSLAWI  1047



>ref|XP_002980607.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
 gb|EFJ18258.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
Length=995

 Score =   188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG L
Sbjct  851  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNNLQLIVRAHECVMDGFERFAQGHL  910

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPE   EDTWM ELN
Sbjct  911  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAVTSPESSPEHQLEDTWMHELN  970

Query  502  I  500
            +
Sbjct  971  V  971



>ref|XP_009587053.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Nicotiana tomentosiformis]
Length=956

 Score =   188 bits (477),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  814  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  873

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN
Sbjct  874  ITLFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELN  932

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SL +I
Sbjct  933  ANRPPTPTRGRPQVANDRGSLTWI  956



>gb|KJB21740.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
 gb|KJB21741.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
Length=1013

 Score =   188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  870   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  929

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ S ER  EDTWMQELN
Sbjct  930   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASSERHIEDTWMQELN  989

Query  502   IqrpptptrgrpqPDLDRNSLAYI  431
               RPPTPTRGRPQ   DR SLA++
Sbjct  990   ANRPPTPTRGRPQVTNDRGSLAWV  1013



>ref|XP_009587040.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=991

 Score =   188 bits (478),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 119/144 (83%), Gaps = 1/144 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  849  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  908

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN
Sbjct  909  ITLFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELN  967

Query  502  IqrpptptrgrpqPDLDRNSLAYI  431
              RPPTPTRGRPQ   DR SL +I
Sbjct  968  ANRPPTPTRGRPQVANDRGSLTWI  991



>ref|XP_002443577.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
 gb|EES17415.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
Length=1008

 Score =   188 bits (478),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  864   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  923

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  924   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  983

Query  502   I-qrpptptrgrpqPDLDRNSLAYI  431
               + P         P+ DR SLA+I
Sbjct  984   ANRPPTPTRGRPQAPNNDRGSLAWI  1008



>ref|XP_002976889.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
 gb|EFJ21999.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
Length=994

 Score =   188 bits (478),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG L
Sbjct  850  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNNLQLIVRAHECVMDGFERFAQGHL  909

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPE   EDTWM ELN
Sbjct  910  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAVTSPESSPEHQLEDTWMHELN  969

Query  502  I  500
            +
Sbjct  970  V  970



>ref|XP_006651637.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=940

 Score =   187 bits (476),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  796  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  855

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  856  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  915

Query  502  IqrpptptrgrpqPDL-DRNSLAYI  431
              RPPTPTRGRPQ    DR SLA+I
Sbjct  916  ANRPPTPTRGRPQVAANDRGSLAWI  940



>ref|XP_006361106.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=997

 Score =   188 bits (477),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  856  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  915

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  ED WMQELN
Sbjct  916  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHMEDIWMQELN  975



>ref|XP_002313501.2| kelch repeat-containing family protein [Populus trichocarpa]
 gb|EEE87456.2| kelch repeat-containing family protein [Populus trichocarpa]
Length=993

 Score =   188 bits (477),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  849  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  908

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  909  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELN  968



>gb|EEE59591.1| hypothetical protein OsJ_11899 [Oryza sativa Japonica Group]
Length=936

 Score =   187 bits (476),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  792  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  851

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  852  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  911



>ref|XP_006664752.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=941

 Score =   187 bits (475),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 119/145 (82%), Gaps = 1/145 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQL++RAHECVMDGFERFAQG L
Sbjct  797  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLMVRAHECVMDGFERFAQGHL  856

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  857  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELN  916

Query  502  I-qrpptptrgrpqPDLDRNSLAYI  431
              + P          + DR SLA+I
Sbjct  917  ANRPPTPTRGRPQVANNDRGSLAWI  941



>gb|ABF97885.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
Length=1003

 Score =   187 bits (476),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  859   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  918

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  919   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  978

Query  502   IqrpptptrgrpqPDL-DRNSLAYI  431
               RPPTPTRGRPQ    DR SLA+I
Sbjct  979   ANRPPTPTRGRPQVAANDRGSLAWI  1003



>ref|XP_008681503.1| PREDICTED: uncharacterized protein LOC100192777 isoform X2 [Zea 
mays]
Length=995

 Score =   187 bits (476),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  851  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  910

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  911  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  970



>ref|XP_008681453.1| PREDICTED: uncharacterized protein LOC100192777 isoform X1 [Zea 
mays]
 tpg|DAA47544.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=996

 Score =   187 bits (476),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  852  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  911

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  912  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  971



>gb|EEC75832.1| hypothetical protein OsI_12812 [Oryza sativa Indica Group]
Length=1003

 Score =   187 bits (476),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  859   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  918

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  919   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  978

Query  502   IqrpptptrgrpqPDL-DRNSLAYI  431
               RPPTPTRGRPQ    DR SLA+I
Sbjct  979   ANRPPTPTRGRPQVAANDRGSLAWI  1003



>ref|XP_011088984.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Sesamum indicum]
Length=1013

 Score =   187 bits (476),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  872  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  931

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  932  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEHHIEDTWMQELN  991



>gb|EPS70499.1| hypothetical protein M569_04238, partial [Genlisea aurea]
Length=1011

 Score =   187 bits (476),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = -2

Query  862   SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
             SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  867   SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  926

Query  682   ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVN-EDTWMQEL  506
             ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPE  + EDTWMQEL
Sbjct  927   ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPEHHHIEDTWMQEL  986

Query  505   NIqrpptptrgrpqPDLDRNSLAYI  431
             N  RPPTPTRGRPQ   DR SLA++
Sbjct  987   NANRPPTPTRGRPQVTNDRGSLAWM  1011



>ref|XP_009606098.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Nicotiana tomentosiformis]
Length=676

 Score =   185 bits (469),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 102/120 (85%), Gaps = 1/120 (1%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  536  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  595

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN
Sbjct  596  ITLFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELN  654



>ref|XP_006592783.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=998

 Score =   186 bits (473),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  862  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL  683
            SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct  860  SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL  919

Query  682  ITLFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  503
            ITLFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  920  ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEPHIEDTWMQELN  979



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1837073150400