BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038N05

Length=912
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011073027.1|  PREDICTED: uncharacterized protein LOC105158...    164   3e-42   
ref|XP_011073026.1|  PREDICTED: uncharacterized protein LOC105158...    164   1e-41   Sesamum indicum [beniseed]
ref|XP_011073024.1|  PREDICTED: uncharacterized protein LOC105158...    164   1e-41   Sesamum indicum [beniseed]
ref|XP_009595703.1|  PREDICTED: uncharacterized protein LOC104091...    162   2e-41   Nicotiana tomentosiformis
gb|KJB19807.1|  hypothetical protein B456_003G119600                    160   8e-41   Gossypium raimondii
dbj|BAB08808.1|  unnamed protein product                                155   9e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009595697.1|  PREDICTED: uncharacterized protein LOC104091...    161   1e-40   Nicotiana tomentosiformis
ref|XP_009595689.1|  PREDICTED: uncharacterized protein LOC104091...    161   1e-40   
ref|XP_011463282.1|  PREDICTED: uncharacterized protein LOC105351207    152   2e-40   Fragaria vesca subsp. vesca
gb|KHG13818.1|  Ribonuclease J                                          159   6e-40   Gossypium arboreum [tree cotton]
emb|CDP10033.1|  unnamed protein product                                159   7e-40   Coffea canephora [robusta coffee]
ref|XP_011044176.1|  PREDICTED: uncharacterized protein LOC105139...    158   7e-40   Populus euphratica
gb|KJB19806.1|  hypothetical protein B456_003G119600                    159   8e-40   Gossypium raimondii
ref|XP_009774848.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    159   8e-40   Nicotiana sylvestris
ref|XP_011044175.1|  PREDICTED: uncharacterized protein LOC105139...    157   3e-39   Populus euphratica
ref|XP_010663736.1|  PREDICTED: uncharacterized protein LOC100268...    155   6e-39   Vitis vinifera
ref|XP_007037950.1|  RNA-metabolising metallo-beta-lactamase fami...    156   9e-39   
ref|XP_006279731.1|  hypothetical protein CARUB_v10027519mg             156   9e-39   Capsella rubella
ref|XP_010519514.1|  PREDICTED: uncharacterized protein LOC104798...    155   1e-38   Tarenaya hassleriana [spider flower]
ref|NP_201147.2|  RNase J                                               155   1e-38   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44310.1|  putative protein                                       155   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007210498.1|  hypothetical protein PRUPE_ppa001238mg             155   2e-38   
ref|XP_007210499.1|  hypothetical protein PRUPE_ppa001238mg             155   2e-38   
ref|XP_002318122.2|  hypothetical protein POPTR_0012s09780g             155   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_002279798.1|  PREDICTED: uncharacterized protein LOC100268...    155   2e-38   Vitis vinifera
ref|XP_006351477.1|  PREDICTED: uncharacterized protein LOC102586834    154   5e-38   Solanum tuberosum [potatoes]
ref|XP_009150395.1|  PREDICTED: uncharacterized protein LOC103873754    154   6e-38   Brassica rapa
ref|XP_006394279.1|  hypothetical protein EUTSA_v10003624mg             154   6e-38   Eutrema salsugineum [saltwater cress]
emb|CBI15641.3|  unnamed protein product                                155   6e-38   Vitis vinifera
emb|CAN81787.1|  hypothetical protein VITISV_026006                     154   8e-38   Vitis vinifera
gb|EYU23119.1|  hypothetical protein MIMGU_mgv1a0011951mg               152   9e-38   Erythranthe guttata [common monkey flower]
ref|XP_010319058.1|  PREDICTED: uncharacterized protein LOC101264...    153   1e-37   
ref|XP_010319060.1|  PREDICTED: uncharacterized protein LOC101264...    152   1e-37   Solanum lycopersicum
ref|XP_008239449.1|  PREDICTED: uncharacterized protein LOC103338047    153   1e-37   Prunus mume [ume]
ref|XP_010319059.1|  PREDICTED: uncharacterized protein LOC101264...    152   1e-37   Solanum lycopersicum
emb|CDX84407.1|  BnaC03g50930D                                          152   2e-37   
ref|XP_004297533.1|  PREDICTED: uncharacterized protein LOC101299666    152   2e-37   Fragaria vesca subsp. vesca
emb|CDY41516.1|  BnaA06g22690D                                          152   3e-37   Brassica napus [oilseed rape]
ref|XP_002864846.1|  EMB2746                                            152   3e-37   
ref|XP_010045503.1|  PREDICTED: uncharacterized protein LOC104434227    151   3e-37   
gb|KCW83176.1|  hypothetical protein EUGRSUZ_B00129                     151   3e-37   Eucalyptus grandis [rose gum]
gb|KJB08022.1|  hypothetical protein B456_001G059600                    150   6e-37   Gossypium raimondii
ref|XP_010444239.1|  PREDICTED: uncharacterized protein LOC104726958    150   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009375228.1|  PREDICTED: uncharacterized protein LOC103964...    149   2e-36   Pyrus x bretschneideri [bai li]
gb|KDP30936.1|  hypothetical protein JCGZ_11312                         149   2e-36   Jatropha curcas
ref|XP_008374253.1|  PREDICTED: uncharacterized protein LOC103437...    148   3e-36   
ref|XP_010484076.1|  PREDICTED: uncharacterized protein LOC104762480    149   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010460357.1|  PREDICTED: uncharacterized protein LOC104741250    149   3e-36   
ref|XP_009375227.1|  PREDICTED: uncharacterized protein LOC103964...    148   5e-36   Pyrus x bretschneideri [bai li]
ref|XP_009346516.1|  PREDICTED: uncharacterized protein LOC103938240    148   5e-36   Pyrus x bretschneideri [bai li]
gb|KHG17441.1|  Ribonuclease J                                          147   7e-36   Gossypium arboreum [tree cotton]
ref|XP_008374252.1|  PREDICTED: uncharacterized protein LOC103437...    148   7e-36   
ref|XP_010519515.1|  PREDICTED: uncharacterized protein LOC104798...    147   8e-36   Tarenaya hassleriana [spider flower]
ref|XP_008351741.1|  PREDICTED: uncharacterized protein LOC103415168    144   2e-35   
gb|KFK28054.1|  hypothetical protein AALP_AA8G465700                    146   3e-35   Arabis alpina [alpine rockcress]
ref|XP_008392827.1|  PREDICTED: uncharacterized protein LOC103455...    144   9e-35   
ref|NP_001047058.1|  Os02g0539600                                       139   1e-34   
ref|XP_008392826.1|  PREDICTED: uncharacterized protein LOC103455...    143   2e-34   
ref|XP_009359454.1|  PREDICTED: uncharacterized protein LOC103950...    143   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_006578698.1|  PREDICTED: uncharacterized protein LOC100783...    142   4e-34   Glycine max [soybeans]
ref|XP_009359453.1|  PREDICTED: uncharacterized protein LOC103950...    142   5e-34   Pyrus x bretschneideri [bai li]
ref|XP_006578697.1|  PREDICTED: uncharacterized protein LOC100783...    141   1e-33   Glycine max [soybeans]
ref|XP_003522430.1|  PREDICTED: uncharacterized protein LOC100783...    141   1e-33   Glycine max [soybeans]
ref|XP_006647353.1|  PREDICTED: uncharacterized protein LOC102710...    140   1e-33   Oryza brachyantha
ref|XP_010250772.1|  PREDICTED: uncharacterized protein LOC104592...    140   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006647352.1|  PREDICTED: uncharacterized protein LOC102710...    140   2e-33   
ref|XP_002511207.1|  conserved hypothetical protein                     140   3e-33   
gb|EEE57142.1|  hypothetical protein OsJ_07047                          139   4e-33   Oryza sativa Japonica Group [Japonica rice]
gb|KHN31905.1|  Ribonuclease J                                          139   4e-33   Glycine soja [wild soybean]
gb|EEC73354.1|  hypothetical protein OsI_07566                          139   4e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_004952680.1|  PREDICTED: uncharacterized protein LOC101761...    138   1e-32   Setaria italica
gb|KDO37738.1|  hypothetical protein CISIN_1g016319mg                   134   1e-32   Citrus sinensis [apfelsine]
ref|XP_010677899.1|  PREDICTED: uncharacterized protein LOC104893...    137   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004952679.1|  PREDICTED: uncharacterized protein LOC101761...    137   2e-32   Setaria italica
ref|XP_010460300.1|  PREDICTED: trihelix transcription factor GT-...    125   2e-32   
ref|XP_010105237.1|  Ribonuclease J                                     137   3e-32   
gb|KDO52627.1|  hypothetical protein CISIN_1g040954mg                   132   3e-32   Citrus sinensis [apfelsine]
ref|XP_010250773.1|  PREDICTED: uncharacterized protein LOC104592...    136   4e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010677898.1|  PREDICTED: uncharacterized protein LOC104893...    136   5e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006477011.1|  PREDICTED: uncharacterized protein LOC102606...    135   7e-32   Citrus sinensis [apfelsine]
ref|XP_010250771.1|  PREDICTED: uncharacterized protein LOC104592...    136   8e-32   Nelumbo nucifera [Indian lotus]
ref|XP_002451689.1|  hypothetical protein SORBIDRAFT_04g005900          135   9e-32   Sorghum bicolor [broomcorn]
ref|XP_006477010.1|  PREDICTED: uncharacterized protein LOC102606...    135   2e-31   
gb|KHN14093.1|  Ribonuclease J                                          134   2e-31   Glycine soja [wild soybean]
ref|XP_006600801.1|  PREDICTED: uncharacterized protein LOC100814...    134   3e-31   Glycine max [soybeans]
ref|XP_003575091.2|  PREDICTED: uncharacterized protein LOC100825...    134   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_006600800.1|  PREDICTED: uncharacterized protein LOC100814...    134   4e-31   Glycine max [soybeans]
ref|XP_007137930.1|  hypothetical protein PHAVU_009G167400g             133   6e-31   Phaseolus vulgaris [French bean]
ref|XP_010235506.1|  PREDICTED: uncharacterized protein LOC100825...    133   6e-31   Brachypodium distachyon [annual false brome]
ref|XP_006440090.1|  hypothetical protein CICLE_v10018763mg             133   7e-31   Citrus clementina [clementine]
ref|XP_008464474.1|  PREDICTED: uncharacterized protein LOC103502...    133   7e-31   Cucumis melo [Oriental melon]
ref|XP_008661157.1|  PREDICTED: uncharacterized protein LOC103640333    129   7e-31   
ref|XP_007155529.1|  hypothetical protein PHAVU_003G209600g             133   7e-31   Phaseolus vulgaris [French bean]
gb|AFW70511.1|  putative metallo-beta-lactamase homeodomain-conta...    130   8e-31   
ref|XP_008464475.1|  PREDICTED: uncharacterized protein LOC103502...    132   1e-30   
ref|XP_002321691.2|  hypothetical protein POPTR_0015s10570g             132   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_004138055.1|  PREDICTED: ribonuclease J-like                     132   1e-30   Cucumis sativus [cucumbers]
ref|XP_008464473.1|  PREDICTED: uncharacterized protein LOC103502...    131   3e-30   Cucumis melo [Oriental melon]
ref|XP_006581876.1|  PREDICTED: uncharacterized protein LOC100779...    131   3e-30   Glycine max [soybeans]
ref|XP_008645345.1|  PREDICTED: uncharacterized protein LOC103626...    130   4e-30   Zea mays [maize]
gb|EPS67461.1|  hypothetical protein M569_07313                         130   4e-30   Genlisea aurea
ref|XP_008645344.1|  PREDICTED: uncharacterized protein LOC103626...    130   6e-30   Zea mays [maize]
gb|KHN23276.1|  Ribonuclease J                                          130   6e-30   Glycine soja [wild soybean]
ref|XP_011024044.1|  PREDICTED: uncharacterized protein LOC105125338    130   7e-30   Populus euphratica
ref|XP_004161356.1|  PREDICTED: LOW QUALITY PROTEIN: ribonuclease...    130   1e-29   
ref|XP_010909139.1|  PREDICTED: uncharacterized protein LOC105035...    129   1e-29   Elaeis guineensis
ref|XP_009419383.1|  PREDICTED: uncharacterized protein LOC103999...    128   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007155530.1|  hypothetical protein PHAVU_003G209600g             128   3e-29   Phaseolus vulgaris [French bean]
ref|XP_010909136.1|  PREDICTED: uncharacterized protein LOC105035...    128   3e-29   
ref|XP_010909137.1|  PREDICTED: uncharacterized protein LOC105035...    128   3e-29   Elaeis guineensis
gb|KGN63492.1|  hypothetical protein Csa_1G002120                       128   5e-29   Cucumis sativus [cucumbers]
gb|EMT12329.1|  Ribonuclease J                                          127   7e-29   
ref|XP_009419382.1|  PREDICTED: uncharacterized protein LOC103999...    127   7e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008811802.1|  PREDICTED: uncharacterized protein LOC103722...    126   1e-28   
ref|XP_008811801.1|  PREDICTED: uncharacterized protein LOC103722...    125   3e-28   Phoenix dactylifera
ref|XP_003602090.1|  Ribonuclease J                                     125   4e-28   
gb|AES72341.2|  RNA-metabolising metallo-beta-lactamase                 125   4e-28   Medicago truncatula
ref|XP_006827615.1|  hypothetical protein AMTR_s00009p00241540          124   9e-28   Amborella trichopoda
ref|XP_004500653.1|  PREDICTED: ribonuclease J-like isoform X2          122   2e-27   
ref|XP_004500652.1|  PREDICTED: ribonuclease J-like isoform X1          122   4e-27   Cicer arietinum [garbanzo]
ref|XP_002451690.1|  hypothetical protein SORBIDRAFT_04g005902          108   7e-24   
ref|XP_006581877.1|  PREDICTED: uncharacterized protein LOC100779...    109   6e-23   Glycine max [soybeans]
ref|NP_001142485.1|  uncharacterized protein LOC100274709               102   6e-22   
ref|XP_010909138.1|  PREDICTED: uncharacterized protein LOC105035...    106   7e-22   
gb|AFW88531.1|  putative homeodomain containing protein                 105   1e-21   
ref|XP_002975019.1|  hypothetical protein SELMODRAFT_102611           78.6    9e-13   
ref|XP_002977440.1|  hypothetical protein SELMODRAFT_107166           78.2    1e-12   
ref|XP_001757788.1|  predicted protein                                68.9    1e-09   
ref|XP_010933052.1|  PREDICTED: trihelix transcription factor GT-...  64.3    2e-08   Elaeis guineensis
gb|KFK36721.1|  hypothetical protein AALP_AA4G160800                  64.3    2e-08   Arabis alpina [alpine rockcress]
ref|XP_004300404.1|  PREDICTED: trihelix transcription factor GT-...  63.5    3e-08   Fragaria vesca subsp. vesca
gb|KJB16900.1|  hypothetical protein B456_002G262900                  63.2    4e-08   Gossypium raimondii
ref|XP_007040932.1|  Homeodomain-like superfamily protein             63.5    4e-08   Theobroma cacao [chocolate]
tpg|DAA54212.1|  TPA: putative homeodomain containing protein         64.3    4e-08   
ref|XP_006845458.1|  hypothetical protein AMTR_s00019p00124000        63.9    4e-08   
gb|KDP39741.1|  hypothetical protein JCGZ_02761                       63.2    5e-08   Jatropha curcas
emb|CDX91438.1|  BnaC04g07120D                                        63.2    5e-08   
ref|XP_010937854.1|  PREDICTED: trihelix transcription factor GT-...  62.8    6e-08   Elaeis guineensis
ref|XP_010677518.1|  PREDICTED: trihelix transcription factor GT-...  63.2    6e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007209432.1|  hypothetical protein PRUPE_ppa009580mg           62.8    6e-08   Prunus persica
gb|EYU25943.1|  hypothetical protein MIMGU_mgv1a019626mg              63.2    7e-08   Erythranthe guttata [common monkey flower]
gb|ABR92761.1|  transcription factor TF2                              62.4    8e-08   Gossypium hirsutum [American cotton]
gb|KHG28745.1|  Trihelix transcription factor GT-3b -like protein     62.0    8e-08   Gossypium arboreum [tree cotton]
gb|AAP13348.1|  transcription factor GT-3b                            62.4    9e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KJB25060.1|  hypothetical protein B456_004G174900                  62.0    9e-08   Gossypium raimondii
ref|NP_181360.1|  trihelix transcription factor GT-3b                 62.4    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505443.1|  PREDICTED: trihelix transcription factor GT-...  62.0    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_002879733.1|  predicted protein                                61.6    2e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_002519887.1|  transcription factor, putative                   61.6    2e-07   Ricinus communis
ref|XP_002989909.1|  hypothetical protein SELMODRAFT_428458           62.0    2e-07   
emb|CDY07745.1|  BnaA03g17660D                                        61.2    2e-07   Brassica napus [oilseed rape]
ref|XP_002968660.1|  hypothetical protein SELMODRAFT_409669           62.0    3e-07   
ref|XP_010517113.1|  PREDICTED: trihelix transcription factor GT-...  60.8    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_009130657.1|  PREDICTED: trihelix transcription factor GT-...  61.2    3e-07   Brassica rapa
ref|XP_008802948.1|  PREDICTED: trihelix transcription factor GT-...  60.8    3e-07   Phoenix dactylifera
emb|CDY11203.1|  BnaA03g00390D                                        61.2    3e-07   Brassica napus [oilseed rape]
ref|XP_009143406.1|  PREDICTED: trihelix transcription factor GT-...  60.8    3e-07   Brassica rapa
ref|XP_010509204.1|  PREDICTED: trihelix transcription factor GT-...  60.8    3e-07   Camelina sativa [gold-of-pleasure]
emb|CDX74901.1|  BnaA05g06470D                                        60.5    4e-07   
ref|XP_010268546.1|  PREDICTED: trihelix transcription factor GTL...  60.8    4e-07   Nelumbo nucifera [Indian lotus]
emb|CDY14474.1|  BnaC03g21210D                                        60.5    4e-07   Brassica napus [oilseed rape]
ref|XP_009133240.1|  PREDICTED: trihelix transcription factor GT-...  60.5    4e-07   Brassica rapa
ref|XP_004172573.1|  PREDICTED: uncharacterized LOC101212243          60.1    7e-07   
ref|XP_006356744.1|  PREDICTED: trihelix transcription factor GT-...  60.1    7e-07   Solanum tuberosum [potatoes]
ref|XP_004252697.1|  PREDICTED: trihelix transcription factor GT-...  60.1    7e-07   Solanum lycopersicum
ref|XP_006356745.1|  PREDICTED: trihelix transcription factor GT-...  60.1    7e-07   Solanum tuberosum [potatoes]
ref|XP_010314571.1|  PREDICTED: trihelix transcription factor GT-...  59.7    7e-07   
ref|XP_006845117.1|  hypothetical protein AMTR_s00005p00185670        60.1    7e-07   
ref|XP_004145967.1|  PREDICTED: uncharacterized protein LOC101212243  60.5    8e-07   
gb|ABK23202.1|  unknown                                               60.1    9e-07   Picea sitchensis
ref|XP_008437493.1|  PREDICTED: trihelix transcription factor GTL...  60.1    1e-06   Cucumis melo [Oriental melon]
ref|XP_010044755.1|  PREDICTED: trihelix transcription factor GT-...  59.7    1e-06   Eucalyptus grandis [rose gum]
ref|XP_008437492.1|  PREDICTED: trihelix transcription factor GTL...  60.1    1e-06   Cucumis melo [Oriental melon]
ref|XP_010314570.1|  PREDICTED: trihelix transcription factor GT-...  59.3    1e-06   
gb|KFK24646.1|  hypothetical protein AALP_AA8G006700                  59.3    1e-06   Arabis alpina [alpine rockcress]
emb|CDY10496.1|  BnaCnng03970D                                        58.9    1e-06   Brassica napus [oilseed rape]
ref|XP_007158125.1|  hypothetical protein PHAVU_002G126400g           58.9    2e-06   Phaseolus vulgaris [French bean]
ref|XP_004302587.1|  PREDICTED: trihelix transcription factor GT-3b   58.9    2e-06   Fragaria vesca subsp. vesca
ref|XP_003612572.1|  Zinc finger and SCAN domain-containing protein   58.5    2e-06   Medicago truncatula
ref|XP_009129574.1|  PREDICTED: trihelix transcription factor GT-4    58.9    2e-06   Brassica rapa
ref|XP_007133883.1|  hypothetical protein PHAVU_010G000200g           58.2    2e-06   Phaseolus vulgaris [French bean]
emb|CDX99735.1|  BnaC02g35850D                                        58.9    2e-06   
ref|XP_010423949.1|  PREDICTED: trihelix transcription factor GT-...  58.5    2e-06   Camelina sativa [gold-of-pleasure]
emb|CDY40984.1|  BnaA02g27740D                                        58.5    2e-06   Brassica napus [oilseed rape]
ref|XP_010490572.1|  PREDICTED: trihelix transcription factor GT-3a   58.5    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_001777670.1|  predicted protein                                58.9    2e-06   
ref|XP_010104264.1|  Trihelix transcription factor GT-3b              57.8    3e-06   
ref|XP_006854232.1|  hypothetical protein AMTR_s00048p00225900        57.8    3e-06   Amborella trichopoda
ref|XP_004512362.1|  PREDICTED: trihelix transcription factor GT-...  57.8    3e-06   Cicer arietinum [garbanzo]
ref|XP_010056151.1|  PREDICTED: trihelix transcription factor GT-...  57.8    3e-06   Eucalyptus grandis [rose gum]
ref|XP_004951198.1|  PREDICTED: trihelix transcription factor GTL...  58.5    4e-06   Setaria italica
ref|XP_010553239.1|  PREDICTED: trihelix transcription factor GT-...  57.8    4e-06   Tarenaya hassleriana [spider flower]
gb|KCW72754.1|  hypothetical protein EUGRSUZ_E01205                   57.8    4e-06   Eucalyptus grandis [rose gum]
ref|XP_010553241.1|  PREDICTED: trihelix transcription factor GT-...  57.4    4e-06   Tarenaya hassleriana [spider flower]
ref|XP_003516496.1|  PREDICTED: trihelix transcription factor GT-...  57.8    4e-06   Glycine max [soybeans]
emb|CDX80775.1|  BnaC03g00290D                                        57.8    4e-06   
ref|XP_006398620.1|  hypothetical protein EUTSA_v10015815mg           57.4    5e-06   Eutrema salsugineum [saltwater cress]
ref|XP_010276957.1|  PREDICTED: trihelix transcription factor GT-...  57.4    5e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010644782.1|  PREDICTED: trihelix transcription factor GT-...  57.4    5e-06   Vitis vinifera
ref|XP_010920848.1|  PREDICTED: trihelix transcription factor GT-...  57.0    5e-06   
gb|AFW66827.1|  hypothetical protein ZEAMMB73_815554                  57.0    6e-06   
ref|NP_195758.1|  trihelix transcription factor GT-3a                 57.0    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002966488.1|  hypothetical protein SELMODRAFT_24518            55.8    6e-06   
ref|XP_003522067.2|  PREDICTED: trihelix transcription factor GT-...  56.6    6e-06   Glycine max [soybeans]
ref|XP_008789108.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...  56.6    6e-06   Phoenix dactylifera
emb|CDP13296.1|  unnamed protein product                              57.4    7e-06   Coffea canephora [robusta coffee]
ref|XP_007143537.1|  hypothetical protein PHAVU_007G079800g           57.4    7e-06   Phaseolus vulgaris [French bean]
ref|XP_010031401.1|  PREDICTED: trihelix transcription factor GT-3b   57.0    7e-06   Eucalyptus grandis [rose gum]
ref|XP_002870925.1|  hypothetical protein ARALYDRAFT_486939           57.0    7e-06   
ref|XP_009380688.1|  PREDICTED: trihelix transcription factor GT-...  56.2    7e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803970.1|  PREDICTED: trihelix transcription factor GT-...  56.6    8e-06   Phoenix dactylifera
gb|KJB36923.1|  hypothetical protein B456_006G183000                  56.6    9e-06   Gossypium raimondii
ref|XP_011018396.1|  PREDICTED: trihelix transcription factor GT-...  56.6    9e-06   Populus euphratica
ref|XP_010528062.1|  PREDICTED: trihelix transcription factor GT-...  57.0    9e-06   Tarenaya hassleriana [spider flower]
ref|XP_010528063.1|  PREDICTED: trihelix transcription factor GT-...  56.6    9e-06   Tarenaya hassleriana [spider flower]
ref|XP_008373496.1|  PREDICTED: trihelix transcription factor GT-...  56.2    9e-06   Malus domestica [apple tree]
gb|KHN34752.1|  Trihelix transcription factor GT-3a                   55.8    1e-05   Glycine soja [wild soybean]
gb|AFW66826.1|  hypothetical protein ZEAMMB73_815554                  57.0    1e-05   
ref|XP_002279929.1|  PREDICTED: trihelix transcription factor GTL...  57.0    1e-05   Vitis vinifera
ref|XP_007019487.1|  Duplicated homeodomain-like superfamily prot...  57.0    1e-05   
ref|XP_003516961.1|  PREDICTED: trihelix transcription factor GT-...  55.8    1e-05   Glycine max [soybeans]
ref|XP_006288194.1|  hypothetical protein CARUB_v10001432mg           56.2    1e-05   Capsella rubella
ref|XP_010250844.1|  PREDICTED: trihelix transcription factor GT-1    56.2    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_006432827.1|  hypothetical protein CICLE_v10002156mg           55.8    1e-05   Citrus clementina [clementine]
ref|XP_010451994.1|  PREDICTED: trihelix transcription factor GT-3a   55.8    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002315635.2|  DNA-binding protein GT-1                         56.2    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010278875.1|  PREDICTED: trihelix transcription factor GT-...  55.8    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_004514215.1|  PREDICTED: trihelix transcription factor GT-...  55.8    2e-05   Cicer arietinum [garbanzo]
ref|XP_008795368.1|  PREDICTED: trihelix transcription factor GT-3b   55.5    2e-05   
ref|XP_008681430.1|  PREDICTED: uncharacterized protein LOC100273...  56.2    2e-05   Zea mays [maize]
ref|XP_002453128.1|  hypothetical protein SORBIDRAFT_04g000520        56.2    2e-05   Sorghum bicolor [broomcorn]
ref|XP_006291280.1|  hypothetical protein CARUB_v10017413mg           55.8    2e-05   
ref|XP_004506754.1|  PREDICTED: trihelix transcription factor GT-...  55.5    2e-05   Cicer arietinum [garbanzo]
ref|NP_001236549.1|  GT-1                                             55.8    2e-05   Glycine max [soybeans]
emb|CDY04841.1|  BnaAnng00230D                                        55.5    2e-05   
ref|XP_006601714.1|  PREDICTED: GT-1 isoform X1                       55.5    2e-05   
ref|XP_009125422.1|  PREDICTED: trihelix transcription factor GT-...  55.5    2e-05   Brassica rapa
ref|XP_009414373.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...  55.1    2e-05   
ref|XP_006368276.1|  hypothetical protein POPTR_0001s01210g           55.5    2e-05   Populus trichocarpa [western balsam poplar]
gb|AFG69715.1|  hypothetical protein 2_8611_01                        52.4    2e-05   Pinus taeda
ref|XP_008794787.1|  PREDICTED: trihelix transcription factor GTL...  55.8    2e-05   Phoenix dactylifera
gb|KDP26752.1|  hypothetical protein JCGZ_17910                       55.5    3e-05   Jatropha curcas
ref|XP_010250883.1|  PREDICTED: trihelix transcription factor GTL...  55.8    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010250890.1|  PREDICTED: trihelix transcription factor GTL...  55.8    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_011029630.1|  PREDICTED: trihelix transcription factor GT-...  55.5    3e-05   Populus euphratica
ref|XP_011029631.1|  PREDICTED: trihelix transcription factor GT-...  55.5    3e-05   Populus euphratica
ref|XP_011029633.1|  PREDICTED: trihelix transcription factor GT-...  55.1    3e-05   Populus euphratica
ref|XP_004496473.1|  PREDICTED: trihelix transcription factor GT-...  55.8    3e-05   Cicer arietinum [garbanzo]
ref|XP_010248872.1|  PREDICTED: trihelix transcription factor GT-...  55.5    3e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010062115.1|  PREDICTED: trihelix transcription factor GT-...  55.5    3e-05   Eucalyptus grandis [rose gum]
ref|XP_006474486.1|  PREDICTED: trihelix transcription factor GT-...  55.5    3e-05   
gb|KHG07895.1|  Trihelix transcription factor GT-2 -like protein      55.5    3e-05   Gossypium arboreum [tree cotton]
ref|XP_011029632.1|  PREDICTED: trihelix transcription factor GT-...  55.1    3e-05   Populus euphratica
gb|KDO73612.1|  hypothetical protein CISIN_1g009174mg                 55.5    3e-05   Citrus sinensis [apfelsine]
gb|KDO56661.1|  hypothetical protein CISIN_1g022743mg                 54.7    3e-05   Citrus sinensis [apfelsine]
gb|KCW69185.1|  hypothetical protein EUGRSUZ_F02707                   55.5    3e-05   Eucalyptus grandis [rose gum]
ref|XP_002266062.1|  PREDICTED: trihelix transcription factor GT-1    55.1    3e-05   Vitis vinifera
ref|XP_010686620.1|  PREDICTED: trihelix transcription factor GT-2    55.1    3e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002312646.1|  DNA-binding protein GT-1                         55.1    3e-05   Populus trichocarpa [western balsam poplar]
ref|XP_008389795.1|  PREDICTED: trihelix transcription factor GT-...  55.1    3e-05   
ref|XP_007026681.1|  Homeodomain-like superfamily protein             54.7    3e-05   Theobroma cacao [chocolate]
ref|XP_008389796.1|  PREDICTED: trihelix transcription factor GT-...  55.1    3e-05   
ref|XP_010062114.1|  PREDICTED: trihelix transcription factor GT-...  55.5    3e-05   Eucalyptus grandis [rose gum]
ref|XP_006453007.1|  hypothetical protein CICLE_v10010595mg           55.5    3e-05   
ref|XP_008812415.1|  PREDICTED: trihelix transcription factor GT-...  55.1    3e-05   
ref|XP_008812414.1|  PREDICTED: trihelix transcription factor GT-...  55.1    4e-05   Phoenix dactylifera
gb|EPS68755.1|  hypothetical protein M569_06010                       55.1    4e-05   Genlisea aurea
ref|XP_011042307.1|  PREDICTED: trihelix transcription factor GT-...  55.1    4e-05   Populus euphratica
ref|XP_003538569.1|  PREDICTED: trihelix transcription factor GT-...  55.1    4e-05   Glycine max [soybeans]
emb|CBI22801.3|  unnamed protein product                              53.1    4e-05   Vitis vinifera
ref|XP_003538570.1|  PREDICTED: trihelix transcription factor GT-...  54.7    4e-05   Glycine max [soybeans]
ref|XP_009799172.1|  PREDICTED: trihelix transcription factor GT-...  54.7    4e-05   Nicotiana sylvestris
ref|XP_006481050.1|  PREDICTED: trihelix transcription factor GT-...  54.3    4e-05   Citrus sinensis [apfelsine]
ref|XP_006429405.1|  hypothetical protein CICLE_v10012342mg           54.3    4e-05   Citrus clementina [clementine]
ref|XP_011081349.1|  PREDICTED: trihelix transcription factor GTL...  55.1    4e-05   Sesamum indicum [beniseed]
ref|XP_006367516.1|  PREDICTED: trihelix transcription factor GT-...  54.7    4e-05   Solanum tuberosum [potatoes]
ref|NP_001167728.1|  hypothetical protein                             55.1    4e-05   Zea mays [maize]
ref|XP_010941058.1|  PREDICTED: trihelix transcription factor GT-...  54.3    5e-05   Elaeis guineensis
ref|XP_009408117.1|  PREDICTED: trihelix transcription factor GTL...  55.1    5e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003547291.1|  PREDICTED: trihelix transcription factor GTL...  54.3    5e-05   
ref|XP_002452839.1|  hypothetical protein SORBIDRAFT_04g033390        55.1    5e-05   
ref|XP_010646634.1|  PREDICTED: trihelix transcription factor GT-2    53.9    5e-05   
ref|XP_010553113.1|  PREDICTED: trihelix transcription factor GT-3a   54.3    5e-05   
ref|XP_010912856.1|  PREDICTED: trihelix transcription factor GT-...  54.7    5e-05   
ref|XP_011081350.1|  PREDICTED: trihelix transcription factor GTL...  55.1    5e-05   
ref|XP_002516129.1|  conserved hypothetical protein                   54.7    5e-05   
gb|EYU26672.1|  hypothetical protein MIMGU_mgv1a018358mg              53.9    5e-05   
ref|XP_006583658.1|  PREDICTED: trihelix transcription factor GT-...  54.3    5e-05   
ref|XP_006590202.1|  PREDICTED: trihelix transcription factor GT-...  54.7    5e-05   
ref|XP_010934944.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...  54.7    5e-05   
ref|XP_010912857.1|  PREDICTED: trihelix transcription factor GT-...  54.3    5e-05   
ref|XP_002464376.1|  hypothetical protein SORBIDRAFT_01g017120        55.1    5e-05   
ref|XP_006473053.1|  PREDICTED: trihelix transcription factor GT-...  54.7    5e-05   
gb|KHN17009.1|  Trihelix transcription factor GT-2                    54.7    5e-05   
ref|XP_003551560.1|  PREDICTED: trihelix transcription factor GT-...  53.9    6e-05   
ref|XP_006648208.1|  PREDICTED: trihelix transcription factor GTL...  54.3    6e-05   
ref|XP_004173056.1|  PREDICTED: trihelix transcription factor GT-...  52.4    6e-05   
gb|KDO83726.1|  hypothetical protein CISIN_1g006925mg                 54.7    6e-05   
gb|KHN20305.1|  Trihelix transcription factor GT-3a                   53.9    6e-05   
ref|XP_010253755.1|  PREDICTED: trihelix transcription factor GT-...  53.9    6e-05   
ref|XP_011086729.1|  PREDICTED: trihelix transcription factor GT-...  54.3    6e-05   
ref|XP_011086728.1|  PREDICTED: trihelix transcription factor GT-...  54.3    6e-05   
ref|XP_003635505.1|  PREDICTED: trihelix transcription factor GT-...  54.3    6e-05   
ref|XP_006434455.1|  hypothetical protein CICLE_v10000593mg           54.7    6e-05   
ref|XP_009401154.1|  PREDICTED: trihelix transcription factor GT-...  54.3    6e-05   
gb|KJB68533.1|  hypothetical protein B456_010G248600                  54.3    6e-05   
gb|KDO82035.1|  hypothetical protein CISIN_1g015940mg                 54.3    6e-05   
gb|KJB68534.1|  hypothetical protein B456_010G248600                  54.3    6e-05   
ref|XP_006438124.1|  hypothetical protein CICLE_v10031750mg           54.3    7e-05   
gb|KDO82036.1|  hypothetical protein CISIN_1g015940mg                 54.3    7e-05   
ref|XP_006484032.1|  PREDICTED: trihelix transcription factor GT-...  54.3    7e-05   
ref|XP_006484030.1|  PREDICTED: trihelix transcription factor GT-...  54.3    7e-05   
gb|KJB50297.1|  hypothetical protein B456_008G163200                  53.1    7e-05   
gb|KDO82037.1|  hypothetical protein CISIN_1g015940mg                 54.3    7e-05   
ref|XP_009401153.1|  PREDICTED: trihelix transcription factor GT-...  54.3    7e-05   
ref|XP_008222027.1|  PREDICTED: trihelix transcription factor GT-...  53.9    7e-05   
ref|XP_009393773.1|  PREDICTED: trihelix transcription factor GT-...  54.3    7e-05   
gb|ABK27014.1|  unknown                                               53.9    7e-05   
ref|XP_002308224.1|  hypothetical protein POPTR_0006s10240g           53.5    7e-05   
ref|XP_011019100.1|  PREDICTED: trihelix transcription factor GT-...  53.5    7e-05   
ref|XP_010676752.1|  PREDICTED: trihelix transcription factor GT-...  53.9    7e-05   
gb|KEH23184.1|  trihelix transcription factor GT-3a, putative         53.9    7e-05   
ref|XP_003534745.1|  PREDICTED: trihelix transcription factor GTL...  53.9    7e-05   
ref|XP_008222025.1|  PREDICTED: trihelix transcription factor GT-...  53.9    7e-05   
ref|XP_009588979.1|  PREDICTED: trihelix transcription factor GT-...  53.5    7e-05   
ref|XP_010264622.1|  PREDICTED: trihelix transcription factor GT-...  53.5    8e-05   
ref|XP_010919359.1|  PREDICTED: trihelix transcription factor GTL...  54.3    8e-05   
gb|EYU41909.1|  hypothetical protein MIMGU_mgv1a019052mg              53.5    8e-05   
gb|KJB50295.1|  hypothetical protein B456_008G163200                  53.9    8e-05   
ref|XP_010456719.1|  PREDICTED: trihelix transcription factor GT-...  52.4    8e-05   
gb|EYU23825.1|  hypothetical protein MIMGU_mgv1a002587mg              54.3    8e-05   
ref|XP_010919360.1|  PREDICTED: trihelix transcription factor GTL...  54.3    9e-05   
gb|KDO82038.1|  hypothetical protein CISIN_1g015940mg                 53.5    9e-05   
ref|XP_006606164.1|  PREDICTED: trihelix transcription factor GT-...  54.3    9e-05   
ref|XP_008678885.1|  PREDICTED: trihelix transcription factor GTL1    54.3    9e-05   
ref|XP_004246753.1|  PREDICTED: trihelix transcription factor GT-3b   53.5    9e-05   
gb|KHN40789.1|  Trihelix transcription factor GT-2                    53.5    9e-05   
ref|XP_007044983.1|  Homeodomain-like superfamily protein             53.5    1e-04   
ref|XP_002264016.1|  PREDICTED: trihelix transcription factor GT-3b   53.1    1e-04   
ref|XP_009768581.1|  PREDICTED: trihelix transcription factor GT-...  53.1    1e-04   
gb|AFW63214.1|  putative homeodomain-like transcription factor su...  53.9    1e-04   
gb|KJB50298.1|  hypothetical protein B456_008G163200                  53.5    1e-04   
gb|AIB05523.1|  trihelix transcription factor                         53.9    1e-04   
prf||2103313A  GT1a protein                                           53.5    1e-04
gb|KHN46418.1|  Trihelix transcription factor GT-2                    53.9    1e-04   
gb|KJB59418.1|  hypothetical protein B456_009G253900                  53.9    1e-04   
emb|CDP06473.1|  unnamed protein product                              53.1    1e-04   
ref|XP_002439215.1|  hypothetical protein SORBIDRAFT_09g002370        53.5    1e-04   
ref|XP_010930054.1|  PREDICTED: trihelix transcription factor GT-...  53.5    1e-04   
gb|AAA34085.1|  DNA-binding protein                                   53.5    1e-04   
gb|KJB50296.1|  hypothetical protein B456_008G163200                  53.5    1e-04   
ref|XP_010930053.1|  PREDICTED: trihelix transcription factor GT-...  53.5    1e-04   
ref|XP_010930052.1|  PREDICTED: trihelix transcription factor GT-...  53.5    1e-04   
ref|XP_008796930.1|  PREDICTED: trihelix transcription factor GTL...  53.9    1e-04   
ref|XP_002993558.1|  hypothetical protein SELMODRAFT_48639            52.4    1e-04   
ref|XP_004310030.1|  PREDICTED: trihelix transcription factor GT-1    53.5    1e-04   
gb|KJB15678.1|  hypothetical protein B456_002G1906002                 52.4    1e-04   
ref|XP_007147613.1|  hypothetical protein PHAVU_006G139200g           53.1    1e-04   
ref|XP_008464203.1|  PREDICTED: trihelix transcription factor GT-...  52.8    1e-04   
ref|XP_009599397.1|  PREDICTED: trihelix transcription factor GT-...  53.5    1e-04   
ref|XP_002972103.1|  hypothetical protein SELMODRAFT_66294            52.4    1e-04   
ref|XP_002300534.2|  hypothetical protein POPTR_0001s45870g           53.9    1e-04   
ref|XP_011038063.1|  PREDICTED: trihelix transcription factor GTL...  53.9    1e-04   
ref|XP_007163722.1|  hypothetical protein PHAVU_001G258700g           53.5    1e-04   
gb|AAB23811.1|  Box II Factor                                         53.5    1e-04   
ref|XP_008243583.1|  PREDICTED: trihelix transcription factor GT-3b   53.1    1e-04   
ref|XP_009784713.1|  PREDICTED: trihelix transcription factor GT-4    53.1    1e-04   
ref|XP_011038059.1|  PREDICTED: trihelix transcription factor GTL...  53.9    1e-04   
ref|XP_011038057.1|  PREDICTED: trihelix transcription factor GTL...  53.9    1e-04   
ref|XP_011038056.1|  PREDICTED: trihelix transcription factor GTL...  53.9    1e-04   
gb|KHG04250.1|  Trihelix transcription factor GT-2 -like protein      53.5    1e-04   
ref|XP_011038058.1|  PREDICTED: trihelix transcription factor GTL...  53.5    1e-04   
ref|XP_004244448.1|  PREDICTED: trihelix transcription factor GT-...  53.1    1e-04   
ref|XP_010531649.1|  PREDICTED: trihelix transcription factor GT-...  53.5    1e-04   
gb|KDP42994.1|  hypothetical protein JCGZ_25180                       53.5    1e-04   
gb|EMS61816.1|  Trihelix transcription factor GT-2                    52.0    1e-04   
ref|XP_011038062.1|  PREDICTED: trihelix transcription factor GTL...  53.5    1e-04   
ref|XP_010243802.1|  PREDICTED: trihelix transcription factor PTL     53.5    1e-04   
gb|KDP42995.1|  hypothetical protein JCGZ_25181                       53.5    1e-04   
ref|XP_010941148.1|  PREDICTED: trihelix transcription factor GT-...  53.5    1e-04   
gb|KHG00449.1|  Trihelix transcription factor GT-1 -like protein      53.5    1e-04   
gb|AER42647.1|  GTL1                                                  53.5    1e-04   
gb|KJB60970.1|  hypothetical protein B456_009G333800                  53.1    1e-04   
ref|XP_011470851.1|  PREDICTED: trihelix transcription factor GTL...  53.5    1e-04   
gb|KJB15679.1|  hypothetical protein B456_002G1906002                 52.4    1e-04   
ref|XP_009338169.1|  PREDICTED: trihelix transcription factor GT-...  52.8    1e-04   
ref|XP_009415425.1|  PREDICTED: trihelix transcription factor GTL...  53.5    1e-04   
ref|XP_009599396.1|  PREDICTED: trihelix transcription factor GT-...  53.1    1e-04   
ref|XP_008648569.1|  PREDICTED: trihelix transcription factor GT-...  52.8    1e-04   
ref|XP_009370297.1|  PREDICTED: trihelix transcription factor GT-...  53.1    1e-04   
ref|XP_004309494.1|  PREDICTED: trihelix transcription factor GTL...  53.5    2e-04   
ref|XP_011095020.1|  PREDICTED: trihelix transcription factor GT-3b   52.8    2e-04   
ref|XP_008390687.1|  PREDICTED: trihelix transcription factor GT-3b   52.8    2e-04   
ref|XP_010539733.1|  PREDICTED: trihelix transcription factor GT-2    53.5    2e-04   
ref|XP_009371706.1|  PREDICTED: trihelix transcription factor GT-...  53.1    2e-04   
ref|XP_011015753.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
gb|KGN54384.1|  hypothetical protein Csa_4G310210                     52.4    2e-04   
emb|CAE02791.2|  OSJNBa0011L07.15                                     53.5    2e-04   
gb|KDP24439.1|  hypothetical protein JCGZ_25003                       52.8    2e-04   
ref|XP_008370106.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
emb|CDP13459.1|  unnamed protein product                              53.1    2e-04   
ref|XP_008341347.1|  PREDICTED: trihelix transcription factor GT-...  53.1    2e-04   
ref|XP_009377750.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
ref|XP_004960373.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...  52.8    2e-04   
ref|XP_009398096.1|  PREDICTED: trihelix transcription factor GTL...  53.5    2e-04   
ref|XP_002984536.1|  hypothetical protein SELMODRAFT_120369           52.8    2e-04   
emb|CAA48328.1|  gt-2                                                 53.5    2e-04   
ref|XP_010529094.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
gb|EEE61422.1|  hypothetical protein OsJ_15631                        53.1    2e-04   
ref|XP_002317033.2|  hypothetical protein POPTR_0011s15050g           53.1    2e-04   
ref|XP_009401789.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
ref|XP_002965455.1|  hypothetical protein SELMODRAFT_85122            52.8    2e-04   
ref|XP_007201190.1|  hypothetical protein PRUPE_ppa002848mg           53.1    2e-04   
gb|KDO83728.1|  hypothetical protein CISIN_1g007316mg                 53.1    2e-04   
ref|XP_010240190.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
gb|AAP54624.2|  expressed protein                                     53.1    2e-04   
ref|XP_007140273.1|  hypothetical protein PHAVU_008G098300g           52.4    2e-04   
ref|XP_009401788.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
ref|XP_006473055.1|  PREDICTED: trihelix transcription factor GT-...  53.1    2e-04   
ref|XP_011028011.1|  PREDICTED: trihelix transcription factor GT-...  52.4    2e-04   
ref|XP_009359291.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
ref|XP_009398094.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
ref|XP_004137715.1|  PREDICTED: trihelix transcription factor GT-...  52.4    2e-04   
ref|XP_009359290.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
ref|XP_008237583.1|  PREDICTED: trihelix transcription factor GT-...  53.1    2e-04   
ref|NP_001053444.1|  Os04g0541100                                     53.1    2e-04   
ref|XP_011004381.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
ref|XP_009398095.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
ref|XP_010502488.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
ref|XP_006856891.1|  hypothetical protein AMTR_s00055p00209070        52.8    2e-04   
ref|XP_009411482.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
gb|EEC67312.1|  hypothetical protein OsI_34323                        53.1    2e-04   
gb|KGN58751.1|  hypothetical protein Csa_3G731130                     52.4    2e-04   
ref|XP_004172460.1|  PREDICTED: trihelix transcription factor GT-...  52.4    2e-04   
ref|XP_009411483.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
gb|ABK22975.1|  unknown                                               52.8    2e-04   
ref|XP_006434456.1|  hypothetical protein CICLE_v10000627mg           53.1    2e-04   
ref|XP_011004382.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
ref|XP_011004380.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
ref|XP_002514968.1|  transcription factor, putative                   52.8    2e-04   
ref|XP_002984666.1|  hypothetical protein SELMODRAFT_120690           52.4    2e-04   
ref|XP_009630607.1|  PREDICTED: trihelix transcription factor GT-...  52.0    2e-04   
ref|XP_009359289.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
ref|XP_008231180.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
gb|AAK39576.1|AC025296_11  putative transcription factor              53.1    2e-04   
ref|XP_009398097.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
ref|XP_010534754.1|  PREDICTED: trihelix transcription factor GT-...  52.4    2e-04   
ref|NP_001045613.1|  Os02g0104500                                     52.8    2e-04   
ref|XP_004290519.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
ref|XP_008442411.1|  PREDICTED: trihelix transcription factor GT-3b   52.4    2e-04   
ref|XP_010240191.1|  PREDICTED: trihelix transcription factor GTL...  53.1    2e-04   
ref|XP_007215404.1|  hypothetical protein PRUPE_ppa005942mg           52.8    2e-04   
ref|XP_010554223.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
ref|XP_006473054.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
ref|XP_002978753.1|  hypothetical protein SELMODRAFT_109349           52.4    2e-04   
ref|XP_010554225.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
ref|XP_010554224.1|  PREDICTED: trihelix transcription factor GT-...  52.8    2e-04   
gb|KDO83729.1|  hypothetical protein CISIN_1g007316mg                 52.8    2e-04   
gb|EAZ21411.1|  hypothetical protein OsJ_05016                        52.8    2e-04   
ref|XP_010554226.1|  PREDICTED: trihelix transcription factor GT-...  52.4    2e-04   
gb|EAY84097.1|  hypothetical protein OsI_05480                        52.8    2e-04   
ref|XP_002972506.1|  hypothetical protein SELMODRAFT_412944           52.0    3e-04   
ref|XP_008792161.1|  PREDICTED: trihelix transcription factor GT-...  52.4    3e-04   
ref|XP_008791631.1|  PREDICTED: trihelix transcription factor GTL...  52.8    3e-04   
ref|XP_006829028.1|  hypothetical protein AMTR_s00001p00251940        52.8    3e-04   
ref|NP_001288865.1|  trihelix transcription factor GT-1-like          52.4    3e-04   
emb|CAN73236.1|  hypothetical protein VITISV_030092                   52.4    3e-04   
ref|XP_004984957.1|  PREDICTED: trihelix transcription factor GT-...  52.4    3e-04   
ref|XP_002270945.3|  PREDICTED: trihelix transcription factor GT-...  52.4    3e-04   
ref|XP_010514227.1|  PREDICTED: trihelix transcription factor GT-...  52.4    3e-04   
ref|XP_002992563.1|  hypothetical protein SELMODRAFT_430743           52.0    3e-04   
ref|XP_010454952.1|  PREDICTED: trihelix transcription factor GT-...  52.0    3e-04   
ref|XP_008791630.1|  PREDICTED: trihelix transcription factor GTL...  52.8    3e-04   
ref|XP_008358288.1|  PREDICTED: trihelix transcription factor GT-...  52.4    3e-04   
ref|XP_009408085.1|  PREDICTED: trihelix transcription factor GT-...  52.0    3e-04   
ref|XP_010454951.1|  PREDICTED: trihelix transcription factor GT-...  52.0    3e-04   
ref|XP_002532428.1|  hypothetical protein RCOM_0453340                52.4    3e-04   
emb|CDX98101.1|  BnaA06g08520D                                        52.4    3e-04   
ref|XP_009385847.1|  PREDICTED: trihelix transcription factor GTL...  52.4    3e-04   
ref|XP_010495319.1|  PREDICTED: trihelix transcription factor GT-...  52.0    3e-04   
ref|XP_010054910.1|  PREDICTED: trihelix transcription factor GTL1    52.4    3e-04   
ref|XP_004304014.1|  PREDICTED: trihelix transcription factor GT-...  52.0    3e-04   
ref|XP_010495310.1|  PREDICTED: trihelix transcription factor GT-...  52.0    3e-04   
ref|XP_009380043.1|  PREDICTED: trihelix transcription factor GTL...  52.4    3e-04   
ref|XP_010655169.1|  PREDICTED: trihelix transcription factor GT-...  52.0    3e-04   
gb|EEE51268.1|  hypothetical protein OsJ_32161                        52.4    3e-04   
emb|CDY30031.1|  BnaC05g09890D                                        52.0    3e-04   
emb|CDP11393.1|  unnamed protein product                              52.4    3e-04   
ref|XP_004173409.1|  PREDICTED: trihelix transcription factor GT-...  52.4    3e-04   
ref|XP_003604663.1|  Zinc finger and SCAN domain-containing protein   51.6    3e-04   
ref|XP_001781369.1|  predicted protein                                51.6    3e-04   
ref|XP_010236837.1|  PREDICTED: LOW QUALITY PROTEIN: trihelix tra...  52.4    3e-04   
ref|XP_010495313.1|  PREDICTED: trihelix transcription factor GT-...  52.0    3e-04   
gb|KCW78368.1|  hypothetical protein EUGRSUZ_D02541                   52.4    3e-04   
ref|XP_003570777.1|  PREDICTED: trihelix transcription factor GTL...  52.4    3e-04   
ref|XP_004140891.1|  PREDICTED: uncharacterized protein LOC101205810  52.4    3e-04   
ref|XP_010933773.1|  PREDICTED: trihelix transcription factor GTL...  52.4    4e-04   
ref|XP_007143536.1|  hypothetical protein PHAVU_007G079700g           52.4    4e-04   
ref|XP_009385878.1|  PREDICTED: trihelix transcription factor GT-...  51.6    4e-04   
ref|XP_007152025.1|  hypothetical protein PHAVU_004G095200g           52.0    4e-04   



>ref|XP_011073027.1| PREDICTED: uncharacterized protein LOC105158090 isoform X3 [Sesamum 
indicum]
Length=729

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklksskSMT-RN  735
            SDDF K  ++ S +  SE  GD  LL    H    K  +     +     +++     RN
Sbjct  579  SDDFWKSFISPSGLKQSE--GDSDLLPAAAHREKAKEESSELDSVLPKSRQTTSKTAKRN  636

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            KWKPEEV+KLIK+RG+L+S+FQVLKGRMALW+EISS+LL DGI RSPGQCKSLWASLVQK
Sbjct  637  KWKPEEVRKLIKLRGKLHSRFQVLKGRMALWEEISSSLLLDGIGRSPGQCKSLWASLVQK  696

Query  554  YEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            YEESK+D KSQ+ WPYF+D++ ILS+LE   SK
Sbjct  697  YEESKRDTKSQKSWPYFEDLDKILSNLETNASK  729



>ref|XP_011073026.1| PREDICTED: uncharacterized protein LOC105158090 isoform X2 [Sesamum 
indicum]
Length=857

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklksskSMT-RN  735
            SDDF K  ++ S +  SE  GD  LL    H    K  +     +     +++     RN
Sbjct  707  SDDFWKSFISPSGLKQSE--GDSDLLPAAAHREKAKEESSELDSVLPKSRQTTSKTAKRN  764

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            KWKPEEV+KLIK+RG+L+S+FQVLKGRMALW+EISS+LL DGI RSPGQCKSLWASLVQK
Sbjct  765  KWKPEEVRKLIKLRGKLHSRFQVLKGRMALWEEISSSLLLDGIGRSPGQCKSLWASLVQK  824

Query  554  YEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            YEESK+D KSQ+ WPYF+D++ ILS+LE   SK
Sbjct  825  YEESKRDTKSQKSWPYFEDLDKILSNLETNASK  857



>ref|XP_011073024.1| PREDICTED: uncharacterized protein LOC105158090 isoform X1 [Sesamum 
indicum]
Length=878

 Score =   164 bits (415),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 109/153 (71%), Gaps = 3/153 (2%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklksskSMT-RN  735
            SDDF K  ++ S +  SE  GD  LL    H    K  +     +     +++     RN
Sbjct  728  SDDFWKSFISPSGLKQSE--GDSDLLPAAAHREKAKEESSELDSVLPKSRQTTSKTAKRN  785

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            KWKPEEV+KLIK+RG+L+S+FQVLKGRMALW+EISS+LL DGI RSPGQCKSLWASLVQK
Sbjct  786  KWKPEEVRKLIKLRGKLHSRFQVLKGRMALWEEISSSLLLDGIGRSPGQCKSLWASLVQK  845

Query  554  YEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            YEESK+D KSQ+ WPYF+D++ ILS+LE   SK
Sbjct  846  YEESKRDTKSQKSWPYFEDLDKILSNLETNASK  878



>ref|XP_009595703.1| PREDICTED: uncharacterized protein LOC104091946 isoform X3 [Nicotiana 
tomentosiformis]
Length=705

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RN+WK +E+KKLIK+RGEL+S+FQV++GRMALW+EISSNLLS G++RSP QCKSLWAS
Sbjct  609  LKRNRWKHDEMKKLIKLRGELHSRFQVVRGRMALWEEISSNLLSTGVNRSPAQCKSLWAS  668

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            LVQKYEESK D+KSQEKWPYF++MN ILSDLEA   K
Sbjct  669  LVQKYEESKSDKKSQEKWPYFEEMNEILSDLEATAQK  705



>gb|KJB19807.1| hypothetical protein B456_003G119600 [Gossypium raimondii]
Length=622

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEVKKLIKMRG+L+S+FQV+KGRMALW+EIS++LL DGI+RSP QCKSLWASLV
Sbjct  528  RNKWKPEEVKKLIKMRGDLHSRFQVVKGRMALWEEISTSLLEDGITRSPAQCKSLWASLV  587

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTS  459
            QKYEESK +++S + WPYF+DMN +LSD EA  +
Sbjct  588  QKYEESKNEKRSHKSWPYFEDMNKVLSDFEATAT  621



>dbj|BAB08808.1| unnamed protein product [Arabidopsis thaliana]
Length=330

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + +NKWKPEE+KK+I+MRGEL+S+FQV+KGRMALW+EISSNL ++GI+RSPGQCKSLWAS
Sbjct  235  VRKNKWKPEEIKKVIRMRGELHSRFQVVKGRMALWEEISSNLSAEGINRSPGQCKSLWAS  294

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTS  459
            L+QKYEESK D +S+  WP+F+DMN+ILS+L  P S
Sbjct  295  LIQKYEESKADERSKTSWPHFEDMNNILSELGTPAS  330



>ref|XP_009595697.1| PREDICTED: uncharacterized protein LOC104091946 isoform X2 [Nicotiana 
tomentosiformis]
Length=851

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RN+WK +E+KKLIK+RGEL+S+FQV++GRMALW+EISSNLLS G++RSP QCKSLWAS
Sbjct  755  LKRNRWKHDEMKKLIKLRGELHSRFQVVRGRMALWEEISSNLLSTGVNRSPAQCKSLWAS  814

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            LVQKYEESK D+KSQEKWPYF++MN ILSDLEA   K
Sbjct  815  LVQKYEESKSDKKSQEKWPYFEEMNEILSDLEATAQK  851



>ref|XP_009595689.1| PREDICTED: uncharacterized protein LOC104091946 isoform X1 [Nicotiana 
tomentosiformis]
Length=880

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RN+WK +E+KKLIK+RGEL+S+FQV++GRMALW+EISSNLLS G++RSP QCKSLWAS
Sbjct  784  LKRNRWKHDEMKKLIKLRGELHSRFQVVRGRMALWEEISSNLLSTGVNRSPAQCKSLWAS  843

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            LVQKYEESK D+KSQEKWPYF++MN ILSDLEA   K
Sbjct  844  LVQKYEESKSDKKSQEKWPYFEEMNEILSDLEATAQK  880



>ref|XP_011463282.1| PREDICTED: uncharacterized protein LOC105351207 [Fragaria vesca 
subsp. vesca]
Length=239

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RNKWKPEEVKK IKMRG+L+S+FQV+KGRMALW+EIS NLL++GI+RSPGQCKSLWAS
Sbjct  143  VKRNKWKPEEVKKFIKMRGKLHSRFQVVKGRMALWEEISRNLLAEGINRSPGQCKSLWAS  202

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            LVQKYEESK  ++SQ+ WPY+++M+  LSD EA  +K
Sbjct  203  LVQKYEESKSGKRSQKSWPYYEEMDGALSDSEAMATK  239



>gb|KHG13818.1| Ribonuclease J [Gossypium arboreum]
Length=790

 Score =   159 bits (401),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEVKKLIKMRG+L+S+FQV+KGRMALW+EIS++LL DGI+RSP QCKSLWASLV
Sbjct  696  RNKWKPEEVKKLIKMRGDLHSRFQVVKGRMALWEEISTSLLEDGITRSPAQCKSLWASLV  755

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTS  459
            QKYEESK +++S + WPYF+DMN +LSD EA  +
Sbjct  756  QKYEESKNEKRSHKSWPYFEDMNKVLSDFEATAT  789



>emb|CDP10033.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   159 bits (402),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklksskSMTRNK  732
            SD+F K  V   T +  EE      LQ++ +++S   + +L S L KS+LKSSKS+ RNK
Sbjct  743  SDNFWKSFVQIPTNNVVEEGNTSLQLQKEHYENSEIDSGELDSGLPKSELKSSKSVKRNK  802

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            WKPEE+KKLI+MRGEL+++FQV+KGRMALW+EISSNLLS GISRSPGQCKSLWASLVQKY
Sbjct  803  WKPEEIKKLIRMRGELHNRFQVVKGRMALWEEISSNLLSGGISRSPGQCKSLWASLVQKY  862

Query  551  EESKKDRKSQEKWPYFKDMNSIL  483
            EESK D KS+E WPYF DMN+I 
Sbjct  863  EESKTDSKSREMWPYFDDMNTIF  885



>ref|XP_011044176.1| PREDICTED: uncharacterized protein LOC105139443 isoform X2 [Populus 
euphratica]
Length=738

 Score =   158 bits (399),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -2

Query  743  TRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASL  564
            +RNKWKPEEVK LIKMRGELNS+FQV++GRMALW+EIS+NL++DGI+RSPGQCKSLW SL
Sbjct  643  SRNKWKPEEVKSLIKMRGELNSRFQVVRGRMALWEEISTNLMADGINRSPGQCKSLWTSL  702

Query  563  VQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            VQKYEESK  +K ++ WPYF+DM++ILSD E   +K
Sbjct  703  VQKYEESKNGKKGKKAWPYFEDMDNILSDSETMATK  738



>gb|KJB19806.1| hypothetical protein B456_003G119600 [Gossypium raimondii]
Length=860

 Score =   159 bits (401),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEVKKLIKMRG+L+S+FQV+KGRMALW+EIS++LL DGI+RSP QCKSLWASLV
Sbjct  766  RNKWKPEEVKKLIKMRGDLHSRFQVVKGRMALWEEISTSLLEDGITRSPAQCKSLWASLV  825

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEA  468
            QKYEESK +++S + WPYF+DMN +LSD EA
Sbjct  826  QKYEESKNEKRSHKSWPYFEDMNKVLSDFEA  856



>ref|XP_009774848.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104224837 
[Nicotiana sylvestris]
Length=880

 Score =   159 bits (402),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -2

Query  908  DDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklksskSMTRNKW  729
            DD  KP V+S  +   +E   GAL QE+   S  + + ++ S   +S +KSSK + RN+W
Sbjct  731  DDSLKPFVSSXLLAQLQEGSFGALTQEESESSREE-SIQIDSGFPESMMKSSKPLKRNRW  789

Query  728  KPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKYE  549
            K +E+KKLIK+RGEL+S+FQV++GRMALW+EISSNLLS  ++RSP QCKSLWASLVQKYE
Sbjct  790  KHDEIKKLIKLRGELHSRFQVVRGRMALWEEISSNLLSTEVNRSPAQCKSLWASLVQKYE  849

Query  548  ESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            ESK D+KSQEKWPYF++MN ILSDLEA   K
Sbjct  850  ESKSDKKSQEKWPYFEEMNEILSDLEATAQK  880



>ref|XP_011044175.1| PREDICTED: uncharacterized protein LOC105139443 isoform X1 [Populus 
euphratica]
Length=914

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = -2

Query  743  TRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASL  564
            +RNKWKPEEVK LIKMRGELNS+FQV++GRMALW+EIS+NL++DGI+RSPGQCKSLW SL
Sbjct  819  SRNKWKPEEVKSLIKMRGELNSRFQVVRGRMALWEEISTNLMADGINRSPGQCKSLWTSL  878

Query  563  VQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            VQKYEESK  +K ++ WPYF+DM++ILSD E   +K
Sbjct  879  VQKYEESKNGKKGKKAWPYFEDMDNILSDSETMATK  914



>ref|XP_010663736.1| PREDICTED: uncharacterized protein LOC100268000 isoform X2 [Vitis 
vinifera]
Length=739

 Score =   155 bits (392),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            M RNKWKPEEVKKLI MRGEL+SKFQV+K RMALW+EI++NLL+DGI R+PGQCKSLW S
Sbjct  643  MKRNKWKPEEVKKLISMRGELHSKFQVVKRRMALWEEIATNLLADGIDRTPGQCKSLWTS  702

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLE  471
            LVQKY+E K D+KS++ WP+F+DMN ILSDLE
Sbjct  703  LVQKYQEIKGDKKSRKSWPHFEDMNEILSDLE  734



>ref|XP_007037950.1| RNA-metabolising metallo-beta-lactamase family protein [Theobroma 
cacao]
 gb|EOY22451.1| RNA-metabolising metallo-beta-lactamase family protein [Theobroma 
cacao]
Length=1004

 Score =   156 bits (395),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = -2

Query  740   RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
             RNKWKPEEVKKLIKMRG+L+S+FQV+KGRMALW+EIS++L+++GISRSPGQCKSLW SLV
Sbjct  910   RNKWKPEEVKKLIKMRGKLHSRFQVVKGRMALWEEISTSLMAEGISRSPGQCKSLWTSLV  969

Query  560   QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
             QKYEESK ++KS ++WPYF+DM+ + SD EA  +K
Sbjct  970   QKYEESKGEKKSHKEWPYFEDMSKVFSDFEATATK  1004



>ref|XP_006279731.1| hypothetical protein CARUB_v10027519mg [Capsella rubella]
 gb|EOA12629.1| hypothetical protein CARUB_v10027519mg [Capsella rubella]
Length=908

 Score =   156 bits (394),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+KK+I+MRGEL+S+FQV+KGRMALW+EISSNL ++GI+RSPGQCKSLWASLV
Sbjct  815  KNKWKPEEIKKVIRMRGELHSRFQVVKGRMALWEEISSNLSAEGINRSPGQCKSLWASLV  874

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTS  459
            QKYEE K D +S+  WP+F+DMN+ILS+L+ P S
Sbjct  875  QKYEECKADERSKTSWPHFEDMNNILSELDTPAS  908



>ref|XP_010519514.1| PREDICTED: uncharacterized protein LOC104798948 isoform X1 [Tarenaya 
hassleriana]
Length=904

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RNKWKPEEVKKLI+ RGEL+S+FQV+KGRMALW+EIS+NL++DGI RSPGQCKSLWAS
Sbjct  808  IKRNKWKPEEVKKLIRTRGELHSRFQVVKGRMALWEEISTNLMADGIIRSPGQCKSLWAS  867

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            L+QKYEE K D + +  WP+F+DM++ILS+L AP +K
Sbjct  868  LIQKYEECKADTEGKNSWPHFEDMDNILSELGAPAAK  904



>ref|NP_201147.2| RNase J [Arabidopsis thaliana]
 gb|AAO42228.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD93952.1| putative protein [Arabidopsis thaliana]
 gb|AED97746.1| RNA-metabolising metallo-beta-lactamase family protein [Arabidopsis 
thaliana]
Length=911

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+KK+I+MRGEL+S+FQV+KGRMALW+EISSNL ++GI+RSPGQCKSLWASL+
Sbjct  818  KNKWKPEEIKKVIRMRGELHSRFQVVKGRMALWEEISSNLSAEGINRSPGQCKSLWASLI  877

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTS  459
            QKYEESK D +S+  WP+F+DMN+ILS+L  P S
Sbjct  878  QKYEESKADERSKTSWPHFEDMNNILSELGTPAS  911



>dbj|BAD44310.1| putative protein [Arabidopsis thaliana]
Length=911

 Score =   155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+KK+I+MRGEL+S+FQV+KGRMALW+EISSNL ++GI+RSPGQCKSLWASL+
Sbjct  818  KNKWKPEEIKKVIRMRGELHSRFQVVKGRMALWEEISSNLSAEGINRSPGQCKSLWASLI  877

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTS  459
            QKYEESK D +S+  WP+F+DMN+ILS+L  P S
Sbjct  878  QKYEESKADERSKTSWPHFEDMNNILSELGTPAS  911



>ref|XP_007210498.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
 gb|EMJ11697.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
Length=875

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 107/152 (70%), Gaps = 9/152 (6%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklksskSMTRNK  732
            SDDF    V  ST+  S E+ +G  +Q++        N+++ S            + RNK
Sbjct  733  SDDFWNAIVGLSTVDKSVEDKNGLAVQQEHLKKDGPDNSEIPSSKP---------VKRNK  783

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            WKPEEV+KLIKMRG+L S+FQV+KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLVQKY
Sbjct  784  WKPEEVEKLIKMRGKLRSRFQVVKGRMALWEEISRNLLADGINRSPGQCKSLWASLVQKY  843

Query  551  EESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            EESK  ++SQ+ WPYF++M+  LSD E   +K
Sbjct  844  EESKSGKRSQKSWPYFEEMDGALSDSEEMATK  875



>ref|XP_007210499.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
 gb|EMJ11698.1| hypothetical protein PRUPE_ppa001238mg [Prunus persica]
Length=875

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 107/152 (70%), Gaps = 9/152 (6%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklksskSMTRNK  732
            SDDF    V  ST+  S E+ +G  +Q++        N+++ S            + RNK
Sbjct  733  SDDFWNAIVGLSTVDKSVEDKNGLAVQQEHLKKDGPDNSEIPSSKP---------VKRNK  783

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            WKPEEV+KLIKMRG+L S+FQV+KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLVQKY
Sbjct  784  WKPEEVEKLIKMRGKLRSRFQVVKGRMALWEEISRNLLADGINRSPGQCKSLWASLVQKY  843

Query  551  EESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            EESK  ++SQ+ WPYF++M+  LSD E   +K
Sbjct  844  EESKSGKRSQKSWPYFEEMDGALSDSEEMATK  875



>ref|XP_002318122.2| hypothetical protein POPTR_0012s09780g [Populus trichocarpa]
 gb|EEE96342.2| hypothetical protein POPTR_0012s09780g [Populus trichocarpa]
Length=916

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEVK LIKMRGEL+S+FQV++GRMALW+EIS+NL++DGI+RSPGQCKSLW SLV
Sbjct  822  RNKWKPEEVKSLIKMRGELHSRFQVVRGRMALWEEISTNLMADGINRSPGQCKSLWTSLV  881

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEESK  +K ++ WPYF+DM++ILSD E   +K
Sbjct  882  QKYEESKNGKKGKKAWPYFEDMDNILSDSETMATK  916



>ref|XP_002279798.1| PREDICTED: uncharacterized protein LOC100268000 isoform X1 [Vitis 
vinifera]
Length=886

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            M RNKWKPEEVKKLI MRGEL+SKFQV+K RMALW+EI++NLL+DGI R+PGQCKSLW S
Sbjct  790  MKRNKWKPEEVKKLISMRGELHSKFQVVKRRMALWEEIATNLLADGIDRTPGQCKSLWTS  849

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLE  471
            LVQKY+E K D+KS++ WP+F+DMN ILSDLE
Sbjct  850  LVQKYQEIKGDKKSRKSWPHFEDMNEILSDLE  881



>ref|XP_006351477.1| PREDICTED: uncharacterized protein LOC102586834 [Solanum tuberosum]
Length=852

 Score =   154 bits (388),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RN+WK +E+KKLI +RGEL+SKFQV++GRMALW+EISSNLLS G+ RSPGQCKSLWAS
Sbjct  756  LKRNRWKHDEIKKLITLRGELHSKFQVVRGRMALWEEISSNLLSIGVDRSPGQCKSLWAS  815

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            LVQKYEE+K D K+Q+KWPY+++M+ ILSDLEA   K
Sbjct  816  LVQKYEENKSDEKNQDKWPYYEEMSKILSDLEATAQK  852



>ref|XP_009150395.1| PREDICTED: uncharacterized protein LOC103873754 [Brassica rapa]
Length=907

 Score =   154 bits (388),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEVKK+I+MRGEL+S+FQV+KGRMALW+EISSNL ++GI+RSPGQCKSLWASL+
Sbjct  813  RNKWKPEEVKKVIRMRGELHSRFQVVKGRMALWEEISSNLSAEGINRSPGQCKSLWASLI  872

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEE K D +S+  W +++DMNSILS+L+ P  K
Sbjct  873  QKYEECKADERSKTSWSHYEDMNSILSELDTPAPK  907



>ref|XP_006394279.1| hypothetical protein EUTSA_v10003624mg [Eutrema salsugineum]
 gb|ESQ31565.1| hypothetical protein EUTSA_v10003624mg [Eutrema salsugineum]
Length=916

 Score =   154 bits (388),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEVKK+I+MRGEL+S+FQV+KGRMALW+EISSNL ++GI+RSPGQCKSLWASL+
Sbjct  822  RNKWKPEEVKKVIRMRGELHSRFQVVKGRMALWEEISSNLSAEGINRSPGQCKSLWASLI  881

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEE K D +S+  W +F+DMN+ILS+L+ P  K
Sbjct  882  QKYEECKADERSKTSWSHFEDMNNILSELDTPAPK  916



>emb|CBI15641.3| unnamed protein product [Vitis vinifera]
Length=1659

 Score =   155 bits (391),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  746   MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
             M RNKWKPEEVKKLI MRGEL+SKFQV+K RMALW+EI++NLL+DGI R+PGQCKSLW S
Sbjct  1563  MKRNKWKPEEVKKLISMRGELHSKFQVVKRRMALWEEIATNLLADGIDRTPGQCKSLWTS  1622

Query  566   LVQKYEESKKDRKSQEKWPYFKDMNSILSDLE  471
             LVQKY+E K D+KS++ WP+F+DMN ILSDLE
Sbjct  1623  LVQKYQEIKGDKKSRKSWPHFEDMNEILSDLE  1654



>emb|CAN81787.1| hypothetical protein VITISV_026006 [Vitis vinifera]
Length=1616

 Score =   154 bits (390),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -2

Query  746   MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
             M RNKWKPEEVKKLI MRGEL+SKFQV+K RMALW+EI++NLL+DGI R+PGQCKSLW S
Sbjct  1520  MKRNKWKPEEVKKLISMRGELHSKFQVVKRRMALWEEIATNLLADGIDRTPGQCKSLWTS  1579

Query  566   LVQKYEESKKDRKSQEKWPYFKDMNSILSDLE  471
             LVQKY+E K D+KS++ WP+F+DMN ILSDLE
Sbjct  1580  LVQKYQEIKGDKKSRKSWPHFEDMNEILSDLE  1611



>gb|EYU23119.1| hypothetical protein MIMGU_mgv1a0011951mg, partial [Erythranthe 
guttata]
Length=694

 Score =   152 bits (383),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  737  NKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQ  558
            NKWKPEEV+KLIK+RGEL+S+FQVLKGRMALW+EISS LL DGI+RSP QCKSLW SL+Q
Sbjct  601  NKWKPEEVQKLIKLRGELHSRFQVLKGRMALWEEISSTLLLDGITRSPAQCKSLWTSLLQ  660

Query  557  KYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            KYEE K D K+Q+ WPYF+D+N+IL +LE+  SK
Sbjct  661  KYEECKGDTKTQKSWPYFEDVNNILLNLESNASK  694



>ref|XP_010319058.1| PREDICTED: uncharacterized protein LOC101264202 isoform X1 [Solanum 
lycopersicum]
Length=881

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RN+WK +E+KKLI +RGEL+SKFQV++GRMALW+EISSNLLS G+ RSPGQCKSLWAS
Sbjct  785  LKRNRWKHDEIKKLIMLRGELHSKFQVVRGRMALWEEISSNLLSIGVDRSPGQCKSLWAS  844

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            LVQKYEE+K D K Q+KWPY+++M  ILSDLEA   K
Sbjct  845  LVQKYEENKSDEKRQDKWPYYEEMRKILSDLEATAHK  881



>ref|XP_010319060.1| PREDICTED: uncharacterized protein LOC101264202 isoform X3 [Solanum 
lycopersicum]
Length=851

 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RN+WK +E+KKLI +RGEL+SKFQV++GRMALW+EISSNLLS G+ RSPGQCKSLWAS
Sbjct  755  LKRNRWKHDEIKKLIMLRGELHSKFQVVRGRMALWEEISSNLLSIGVDRSPGQCKSLWAS  814

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            LVQKYEE+K D K Q+KWPY+++M  ILSDLEA   K
Sbjct  815  LVQKYEENKSDEKRQDKWPYYEEMRKILSDLEATAHK  851



>ref|XP_008239449.1| PREDICTED: uncharacterized protein LOC103338047 [Prunus mume]
Length=903

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 108/157 (69%), Gaps = 18/157 (11%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDG-ALLQEQLH----DSSVKGNNklfsdlsksklksskS  747
            SDDF    V  ST+  S  + +G A+ QE L     DSS   N              SK 
Sbjct  760  SDDFWNAIVRLSTVDKSVVDKNGLAVQQEHLKKDGPDSSEIPN-------------PSKP  806

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RNKWKPEEV+KLIKMRG+L S+FQV+KGRMALW+EIS NLL+DGI+RSPGQCKSLWAS
Sbjct  807  VKRNKWKPEEVEKLIKMRGKLRSRFQVVKGRMALWEEISRNLLADGINRSPGQCKSLWAS  866

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            LVQKYEESK  ++SQ+ WPYF++M+  LSD E   +K
Sbjct  867  LVQKYEESKSGKRSQKSWPYFEEMDGALSDSEEMATK  903



>ref|XP_010319059.1| PREDICTED: uncharacterized protein LOC101264202 isoform X2 [Solanum 
lycopersicum]
Length=852

 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RN+WK +E+KKLI +RGEL+SKFQV++GRMALW+EISSNLLS G+ RSPGQCKSLWAS
Sbjct  756  LKRNRWKHDEIKKLIMLRGELHSKFQVVRGRMALWEEISSNLLSIGVDRSPGQCKSLWAS  815

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            LVQKYEE+K D K Q+KWPY+++M  ILSDLEA   K
Sbjct  816  LVQKYEENKSDEKRQDKWPYYEEMRKILSDLEATAHK  852



>emb|CDX84407.1| BnaC03g50930D [Brassica napus]
Length=893

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEVKK+I+MRGEL+S+FQV+KGRMALW+EISSNL ++GI+RSPGQCKSLWASL+
Sbjct  799  RNKWKPEEVKKVIRMRGELHSRFQVVKGRMALWEEISSNLSAEGINRSPGQCKSLWASLI  858

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEE K D +S+  W +++DMN+ILS+L+ P  K
Sbjct  859  QKYEECKADERSKTSWSHYEDMNNILSELDTPAPK  893



>ref|XP_004297533.1| PREDICTED: uncharacterized protein LOC101299666 [Fragaria vesca 
subsp. vesca]
Length=897

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEVKK IKMRG+L+S+FQV+KGRMALW+EIS NLL++G++RSPGQCKSLWASLV
Sbjct  803  RNKWKPEEVKKFIKMRGKLHSRFQVVKGRMALWEEISRNLLAEGVNRSPGQCKSLWASLV  862

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEESK  ++SQ+ WPY+++M+  LSD EA  +K
Sbjct  863  QKYEESKSGKRSQKSWPYYEEMDGALSDSEAMATK  897



>emb|CDY41516.1| BnaA06g22690D [Brassica napus]
Length=1149

 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEVKK+I+MRGEL+S+FQV+KGRMALW+EISSNL ++GI+RSPGQCKSLWASL+
Sbjct  809  RNKWKPEEVKKVIRMRGELHSRFQVVKGRMALWEEISSNLSAEGINRSPGQCKSLWASLI  868

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEE K D +S+  W +++DMN+ILS+L+ P  K
Sbjct  869  QKYEECKADERSKTSWSHYEDMNNILSELDTPAPK  903



>ref|XP_002864846.1| EMB2746 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41105.1| EMB2746 [Arabidopsis lyrata subsp. lyrata]
Length=927

 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+KK+I+MRGEL+S+FQV+KGRMALW+EISSNL ++GI+RSPG+CKSLWASL+
Sbjct  833  KNKWKPEEIKKVIRMRGELHSRFQVVKGRMALWEEISSNLSAEGINRSPGKCKSLWASLI  892

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEE K D +S+  WP+F+DMN+ILS+L+   SK
Sbjct  893  QKYEECKADERSKTSWPHFEDMNNILSELDTSASK  927



>ref|XP_010045503.1| PREDICTED: uncharacterized protein LOC104434227 [Eucalyptus grandis]
Length=867

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RNKWKPEE+K+LIK+RG+L+ KFQV+KGRMALW+EIS+NLL DGI+RSP QCKSLW S
Sbjct  771  LKRNKWKPEEIKELIKLRGQLHGKFQVVKGRMALWEEISTNLLGDGITRSPAQCKSLWTS  830

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            LVQKYE+SK   +S+  WPYF++M+ ILS +EA TSK
Sbjct  831  LVQKYEQSKSGERSRTSWPYFEEMDEILSVVEATTSK  867



>gb|KCW83176.1| hypothetical protein EUGRSUZ_B00129 [Eucalyptus grandis]
Length=861

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RNKWKPEE+K+LIK+RG+L+ KFQV+KGRMALW+EIS+NLL DGI+RSP QCKSLW S
Sbjct  765  LKRNKWKPEEIKELIKLRGQLHGKFQVVKGRMALWEEISTNLLGDGITRSPAQCKSLWTS  824

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            LVQKYE+SK   +S+  WPYF++M+ ILS +EA TSK
Sbjct  825  LVQKYEQSKSGERSRTSWPYFEEMDEILSVVEATTSK  861



>gb|KJB08022.1| hypothetical protein B456_001G059600 [Gossypium raimondii]
 gb|KJB08023.1| hypothetical protein B456_001G059600 [Gossypium raimondii]
 gb|KJB08024.1| hypothetical protein B456_001G059600 [Gossypium raimondii]
Length=884

 Score =   150 bits (380),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 105/149 (70%), Gaps = 4/149 (3%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklksskSMT---  741
            SD+F KP + SS+   + EN +   +  + H S +K ++   S      L S    +   
Sbjct  729  SDEFWKPFIKSSSPIDNLENDNNGFIPIEEHKSELKSDDATSSGDVSELLSSQLKSSKPA  788

Query  740  -RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASL  564
             RNKW  EEVKKLIKMRGEL+S+FQVLKGRMALW+EIS++LL+DGISRSP QCKS WASL
Sbjct  789  KRNKWTSEEVKKLIKMRGELHSRFQVLKGRMALWEEISASLLADGISRSPVQCKSRWASL  848

Query  563  VQKYEESKKDRKSQEKWPYFKDMNSILSD  477
            VQKYEE + ++KS + WPYF++MN ILSD
Sbjct  849  VQKYEEIRSEKKSHKDWPYFEEMNKILSD  877



>ref|XP_010444239.1| PREDICTED: uncharacterized protein LOC104726958 [Camelina sativa]
Length=899

 Score =   150 bits (380),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+KK+I+MRGEL+S+FQV+KGRMALW+EISSNL ++G +RSPGQCKSLWASL+
Sbjct  806  KNKWKPEEIKKVIRMRGELHSRFQVVKGRMALWEEISSNLSAEGFNRSPGQCKSLWASLI  865

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTS  459
            QKYEE K + +S+  WP+F+DMN+ILS+L  P S
Sbjct  866  QKYEECKAEERSKTSWPHFEDMNNILSELGTPAS  899



>ref|XP_009375228.1| PREDICTED: uncharacterized protein LOC103964064 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009375237.1| PREDICTED: uncharacterized protein LOC103964071 isoform X2 [Pyrus 
x bretschneideri]
Length=786

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RN+WKPEEVKKLI MRG+L+ +FQV KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLV
Sbjct  692  RNRWKPEEVKKLITMRGKLHGRFQVAKGRMALWEEISRNLLADGINRSPGQCKSLWASLV  751

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEESK  ++S++ WPYF++M+  LSD E   +K
Sbjct  752  QKYEESKSGKRSRKSWPYFEEMDGALSDSEELATK  786



>gb|KDP30936.1| hypothetical protein JCGZ_11312 [Jatropha curcas]
Length=879

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + +NKWKPEEVKKLIKMRG+L+ +FQV KGRM LW+EIS++L+ DGI+RSP QCKSLWAS
Sbjct  783  LKKNKWKPEEVKKLIKMRGKLHDRFQVAKGRMILWEEISNSLIIDGINRSPAQCKSLWAS  842

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            L+QKYEESK + +SQ+ WPYF+DMN ILS  EA T+K
Sbjct  843  LLQKYEESKTEEESQKSWPYFEDMNKILSAYEATTTK  879



>ref|XP_008374253.1| PREDICTED: uncharacterized protein LOC103437549 isoform X2 [Malus 
domestica]
Length=783

 Score =   148 bits (374),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RN+WKPEEVKKLI MRG+L+ +FQV KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLV
Sbjct  689  RNRWKPEEVKKLITMRGKLHGRFQVAKGRMALWEEISRNLLADGINRSPGQCKSLWASLV  748

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEESK  ++S++ WPYF +M+  LSD E   +K
Sbjct  749  QKYEESKSGKRSRKSWPYFDEMDGALSDSEELATK  783



>ref|XP_010484076.1| PREDICTED: uncharacterized protein LOC104762480 [Camelina sativa]
Length=899

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+KK+I+MRGEL+S+FQV+KGRM LW+EISSNL ++G +RSPGQCKSLWASL+
Sbjct  806  KNKWKPEEIKKVIRMRGELHSRFQVVKGRMVLWEEISSNLSAEGFNRSPGQCKSLWASLI  865

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTS  459
            QKYEE K + +S+  WP+F+DMN+ILS+L  P S
Sbjct  866  QKYEECKAEERSKTSWPHFEDMNNILSELGTPAS  899



>ref|XP_010460357.1| PREDICTED: uncharacterized protein LOC104741250 [Camelina sativa]
Length=900

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+KK+I+MRGEL+S+FQV+KGRM LW+EISSNL ++G +RSPGQCKSLWASL+
Sbjct  807  KNKWKPEEIKKVIRMRGELHSRFQVVKGRMVLWEEISSNLSAEGFNRSPGQCKSLWASLI  866

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTS  459
            QKYEE K + +S+  WP+F+DMN+ILS+L  P S
Sbjct  867  QKYEECKAEERSKTSWPHFEDMNNILSELGTPAS  900



>ref|XP_009375227.1| PREDICTED: uncharacterized protein LOC103964064 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009375236.1| PREDICTED: uncharacterized protein LOC103964071 isoform X1 [Pyrus 
x bretschneideri]
Length=920

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RN+WKPEEVKKLI MRG+L+ +FQV KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLV
Sbjct  826  RNRWKPEEVKKLITMRGKLHGRFQVAKGRMALWEEISRNLLADGINRSPGQCKSLWASLV  885

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEESK  ++S++ WPYF++M+  LSD E   +K
Sbjct  886  QKYEESKSGKRSRKSWPYFEEMDGALSDSEELATK  920



>ref|XP_009346516.1| PREDICTED: uncharacterized protein LOC103938240 [Pyrus x bretschneideri]
Length=920

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RN+WKPEEVKKLI MRG+L+ +FQV KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLV
Sbjct  826  RNRWKPEEVKKLITMRGKLHGRFQVAKGRMALWEEISRNLLADGINRSPGQCKSLWASLV  885

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEESK  ++S++ WPYF++M+  LSD E   +K
Sbjct  886  QKYEESKSGKRSRKSWPYFEEMDGALSDSEELATK  920



>gb|KHG17441.1| Ribonuclease J [Gossypium arboreum]
Length=884

 Score =   147 bits (372),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 4/149 (3%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklksskSMT---  741
            SD+F KP + SS+   + EN +   +  + H S +K ++   S        S    +   
Sbjct  729  SDEFWKPFIKSSSPIDNLENDNNGFIPIEEHKSELKSDDAASSGDVSELPSSQLKSSKPA  788

Query  740  -RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASL  564
             RNKW  EEVKKLIKMRGEL+S+F V+KGRMALW+EIS++LL+DGISRSP QCKS WASL
Sbjct  789  KRNKWTSEEVKKLIKMRGELHSRFHVVKGRMALWEEISASLLADGISRSPVQCKSRWASL  848

Query  563  VQKYEESKKDRKSQEKWPYFKDMNSILSD  477
            VQKYEE + ++KS + WPYF++MN ILSD
Sbjct  849  VQKYEEIRSEKKSHKDWPYFEEMNKILSD  877



>ref|XP_008374252.1| PREDICTED: uncharacterized protein LOC103437549 isoform X1 [Malus 
domestica]
Length=917

 Score =   148 bits (373),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RN+WKPEEVKKLI MRG+L+ +FQV KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLV
Sbjct  823  RNRWKPEEVKKLITMRGKLHGRFQVAKGRMALWEEISRNLLADGINRSPGQCKSLWASLV  882

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEESK  ++S++ WPYF +M+  LSD E   +K
Sbjct  883  QKYEESKSGKRSRKSWPYFDEMDGALSDSEELATK  917



>ref|XP_010519515.1| PREDICTED: uncharacterized protein LOC104798948 isoform X2 [Tarenaya 
hassleriana]
Length=904

 Score =   147 bits (372),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RNKWKPEEVKKLI+ RGEL+S+FQV+KGRMALW+EIS+NL++DGI RSPGQCKSLWAS
Sbjct  808  IKRNKWKPEEVKKLIRTRGELHSRFQVVKGRMALWEEISTNLMADGIIRSPGQCKSLWAS  867

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSD  477
            L+QKYEE K D + +  WP+F+DM++ILS+
Sbjct  868  LIQKYEECKADTEGKNSWPHFEDMDNILSE  897



>ref|XP_008351741.1| PREDICTED: uncharacterized protein LOC103415168, partial [Malus 
domestica]
Length=474

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWK +EV+KLI MRG+L S+FQV+KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLV
Sbjct  380  RNKWKTDEVQKLITMRGKLRSRFQVVKGRMALWEEISRNLLADGINRSPGQCKSLWASLV  439

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSD  477
            QKYEESK  ++S++ WPYF++M+  LSD
Sbjct  440  QKYEESKSGKRSRKSWPYFEEMDXALSD  467



>gb|KFK28054.1| hypothetical protein AALP_AA8G465700 [Arabis alpina]
Length=896

 Score =   146 bits (368),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+KK+I+MRGEL+S+FQV+KGRMALW+EISSNL + GI+RSPGQCKSLWASL+
Sbjct  801  KNKWKPEEIKKVIRMRGELHSRFQVVKGRMALWEEISSNLSNQGINRSPGQCKSLWASLI  860

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPT  462
            QKYEE K + +S+  WP+F+DM++ILS+L   T
Sbjct  861  QKYEECKAEERSKTSWPHFEDMDNILSELGTGT  893



>ref|XP_008392827.1| PREDICTED: uncharacterized protein LOC103455013 isoform X2 [Malus 
domestica]
Length=783

 Score =   144 bits (363),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWK +EV+KLI MRG+L S+FQV+KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLV
Sbjct  689  RNKWKTDEVQKLITMRGKLRSRFQVVKGRMALWEEISRNLLADGINRSPGQCKSLWASLV  748

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSD  477
            QKYEESK  ++S++ WPYF++M+  LSD
Sbjct  749  QKYEESKSGKRSRKSWPYFEEMDXALSD  776



>ref|NP_001047058.1| Os02g0539600 [Oryza sativa Japonica Group]
 dbj|BAD28843.1| metallo-beta-lactamase protein-like [Oryza sativa Japonica Group]
 dbj|BAF08972.1| Os02g0539600 [Oryza sativa Japonica Group]
Length=319

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+MRGE+N +FQ +KGRM LW+EISS++LS GISR+P QCKSLW SLV
Sbjct  225  KNKWKPEEIKSLIQMRGEMNEQFQTVKGRMVLWEEISSSMLSQGISRTPAQCKSLWTSLV  284

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD +S + WPYF DM+ +LS
Sbjct  285  QKYEESKKDEESVKTWPYFLDMDRVLS  311



>ref|XP_008392826.1| PREDICTED: uncharacterized protein LOC103455013 isoform X1 [Malus 
domestica]
Length=917

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWK +EV+KLI MRG+L S+FQV+KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLV
Sbjct  823  RNKWKTDEVQKLITMRGKLRSRFQVVKGRMALWEEISRNLLADGINRSPGQCKSLWASLV  882

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSD  477
            QKYEESK  ++S++ WPYF++M+  LSD
Sbjct  883  QKYEESKSGKRSRKSWPYFEEMDXALSD  910



>ref|XP_009359454.1| PREDICTED: uncharacterized protein LOC103950027 isoform X2 [Pyrus 
x bretschneideri]
Length=786

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWK +EV+KLI MRG+L S+FQV+KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLV
Sbjct  692  RNKWKTDEVQKLITMRGKLRSRFQVVKGRMALWEEISRNLLADGINRSPGQCKSLWASLV  751

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKY+ESK  ++S++ WPYF +M+  LSD E   +K
Sbjct  752  QKYKESKSGKRSRKSWPYFDEMDGALSDSEELATK  786



>ref|XP_006578698.1| PREDICTED: uncharacterized protein LOC100783850 isoform X3 [Glycine 
max]
Length=739

 Score =   142 bits (357),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 109/158 (69%), Gaps = 7/158 (4%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklks------sk  750
            SD+F KP +TS  +  S  + D + + ++   S++K ++    D +KS+  S      SK
Sbjct  583  SDEFWKPFITSLPVEKSI-SADNSYVSQKEQKSNLKKDDSEDIDEAKSEETSNSEPKLSK  641

Query  749  SMTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWA  570
            S+ RNKWK EEVKKLI MRGEL+ +FQV+KGRMALW+EIS  LL+DGISRSPGQCKSLW 
Sbjct  642  SVKRNKWKTEEVKKLIGMRGELSDRFQVVKGRMALWEEISQKLLADGISRSPGQCKSLWT  701

Query  569  SLVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            SLV KYE  K    S++ WPY +DM  I+SD EAP +K
Sbjct  702  SLVVKYEGIKNKNDSKKSWPYIEDMERIMSDKEAPATK  739



>ref|XP_009359453.1| PREDICTED: uncharacterized protein LOC103950027 isoform X1 [Pyrus 
x bretschneideri]
Length=920

 Score =   142 bits (358),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 81/95 (85%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWK +EV+KLI MRG+L S+FQV+KGRMALW+EIS NLL+DGI+RSPGQCKSLWASLV
Sbjct  826  RNKWKTDEVQKLITMRGKLRSRFQVVKGRMALWEEISRNLLADGINRSPGQCKSLWASLV  885

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKY+ESK  ++S++ WPYF +M+  LSD E   +K
Sbjct  886  QKYKESKSGKRSRKSWPYFDEMDGALSDSEELATK  920



>ref|XP_006578697.1| PREDICTED: uncharacterized protein LOC100783850 isoform X2 [Glycine 
max]
Length=886

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 109/158 (69%), Gaps = 7/158 (4%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklks------sk  750
            SD+F KP +TS  +  S  + D + + ++   S++K ++    D +KS+  S      SK
Sbjct  730  SDEFWKPFITSLPVEKSI-SADNSYVSQKEQKSNLKKDDSEDIDEAKSEETSNSEPKLSK  788

Query  749  SMTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWA  570
            S+ RNKWK EEVKKLI MRGEL+ +FQV+KGRMALW+EIS  LL+DGISRSPGQCKSLW 
Sbjct  789  SVKRNKWKTEEVKKLIGMRGELSDRFQVVKGRMALWEEISQKLLADGISRSPGQCKSLWT  848

Query  569  SLVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            SLV KYE  K    S++ WPY +DM  I+SD EAP +K
Sbjct  849  SLVVKYEGIKNKNDSKKSWPYIEDMERIMSDKEAPATK  886



>ref|XP_003522430.1| PREDICTED: uncharacterized protein LOC100783850 isoform X1 [Glycine 
max]
Length=888

 Score =   141 bits (356),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 109/158 (69%), Gaps = 7/158 (4%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNNklfsdlsksklks------sk  750
            SD+F KP +TS  +  S  + D + + ++   S++K ++    D +KS+  S      SK
Sbjct  732  SDEFWKPFITSLPVEKSI-SADNSYVSQKEQKSNLKKDDSEDIDEAKSEETSNSEPKLSK  790

Query  749  SMTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWA  570
            S+ RNKWK EEVKKLI MRGEL+ +FQV+KGRMALW+EIS  LL+DGISRSPGQCKSLW 
Sbjct  791  SVKRNKWKTEEVKKLIGMRGELSDRFQVVKGRMALWEEISQKLLADGISRSPGQCKSLWT  850

Query  569  SLVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            SLV KYE  K    S++ WPY +DM  I+SD EAP +K
Sbjct  851  SLVVKYEGIKNKNDSKKSWPYIEDMERIMSDKEAPATK  888



>ref|XP_006647353.1| PREDICTED: uncharacterized protein LOC102710271 isoform X2 [Oryza 
brachyantha]
Length=721

 Score =   140 bits (353),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+MRGE+N KFQ +KGRM LW+EISS++L+ GISRSP QCKSLW SLV
Sbjct  627  KNKWKPEEIKSLIQMRGEMNEKFQTVKGRMVLWEEISSSMLNQGISRSPAQCKSLWTSLV  686

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD +S + WPYF DM+ +LS
Sbjct  687  QKYEESKKDEESVKTWPYFLDMDRVLS  713



>ref|XP_010250772.1| PREDICTED: uncharacterized protein LOC104592923 isoform X2 [Nelumbo 
nucifera]
Length=886

 Score =   140 bits (354),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQ---LHDSSVKGNNklfsdlsksklksskSMT  741
            SDDF    VT S +    +  +G++ +E+   L+    K   +  ++L+  +  SSK   
Sbjct  732  SDDFWNLFVTPSPLEHLGKVENGSIRKEEHLELNKDGTKSRGEGSAELASPQSASSKPAK  791

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKW PEE+ KLIKMRGEL+S+FQV+KGRM LW+EIS+NLL  GI+R+PGQCKSLWASL+
Sbjct  792  RNKWMPEEIMKLIKMRGELDSRFQVVKGRMVLWKEISANLLVYGINRTPGQCKSLWASLI  851

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEE +  +KS++ WPYF +M  IL   EA ++K
Sbjct  852  QKYEEIRIGKKSKKSWPYFDEMEKILLGREATSTK  886



>ref|XP_006647352.1| PREDICTED: uncharacterized protein LOC102710271 isoform X1 [Oryza 
brachyantha]
Length=778

 Score =   140 bits (353),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+MRGE+N KFQ +KGRM LW+EISS++L+ GISRSP QCKSLW SLV
Sbjct  684  KNKWKPEEIKSLIQMRGEMNEKFQTVKGRMVLWEEISSSMLNQGISRSPAQCKSLWTSLV  743

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD +S + WPYF DM+ +LS
Sbjct  744  QKYEESKKDEESVKTWPYFLDMDRVLS  770



>ref|XP_002511207.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51809.1| conserved hypothetical protein [Ricinus communis]
Length=880

 Score =   140 bits (352),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+KKLIK+RG+L+ +FQV+KGRMALW+E+S+ L+ DGI+RSPGQCKSLWASL 
Sbjct  786  RNKWKPEEIKKLIKVRGKLHDRFQVVKGRMALWEEVSNRLMIDGINRSPGQCKSLWASLN  845

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYEESK D   Q  WP+++DM+ ILS     T+K
Sbjct  846  QKYEESKSDENGQTVWPHYEDMDKILSAFGEMTTK  880



>gb|EEE57142.1| hypothetical protein OsJ_07047 [Oryza sativa Japonica Group]
Length=868

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+MRGE+N +FQ +KGRM LW+EISS++LS GISR+P QCKSLW SLV
Sbjct  774  KNKWKPEEIKSLIQMRGEMNEQFQTVKGRMVLWEEISSSMLSQGISRTPAQCKSLWTSLV  833

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD +S + WPYF DM+ +LS
Sbjct  834  QKYEESKKDEESVKTWPYFLDMDRVLS  860



>gb|KHN31905.1| Ribonuclease J [Glycine soja]
Length=888

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWK EEVKKLI MRGEL+ +FQV+KGRMALW+EIS  LL+DGI RSPGQCKSLW SLV
Sbjct  794  RNKWKTEEVKKLIGMRGELSDRFQVVKGRMALWEEISQKLLADGICRSPGQCKSLWTSLV  853

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
             KYE  K    S++ WPY +DM  I+SD EAP +K
Sbjct  854  VKYEGIKNKNDSKKSWPYIEDMERIMSDKEAPATK  888



>gb|EEC73354.1| hypothetical protein OsI_07566 [Oryza sativa Indica Group]
Length=871

 Score =   139 bits (351),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+MRGE+N +FQ +KGRM LW+EISS++LS GISR+P QCKSLW SLV
Sbjct  777  KNKWKPEEIKSLIQMRGEMNEQFQTVKGRMVLWEEISSSMLSQGISRTPAQCKSLWTSLV  836

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD +S + WPYF DM+ +LS
Sbjct  837  QKYEESKKDEESVKTWPYFLDMDRVLS  863



>ref|XP_004952680.1| PREDICTED: uncharacterized protein LOC101761263 isoform X2 [Setaria 
italica]
Length=718

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+MRGE+N KFQ +KGRM LW+EIS +L++ GISR+P QCKSLW SLV
Sbjct  624  KNKWKPEEIKSLIQMRGEMNEKFQSVKGRMVLWEEISGSLMNQGISRTPAQCKSLWTSLV  683

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD +S + WPYF D++ ILS
Sbjct  684  QKYEESKKDEESMKTWPYFSDIDRILS  710



>gb|KDO37738.1| hypothetical protein CISIN_1g016319mg [Citrus sinensis]
Length=391

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 78/90 (87%), Gaps = 1/90 (1%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RNKW+PEEVKKLIKMRGEL+SKFQV+KGRMALW+EIS++L ++G +R+P QCKS W+S
Sbjct  294  VRRNKWRPEEVKKLIKMRGELHSKFQVVKGRMALWKEISTHLANEGFNRTPSQCKSRWSS  353

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSD  477
            L+QKYEESK    SQ+ WPYF++MN I SD
Sbjct  354  LLQKYEESKSG-NSQKSWPYFEEMNKIFSD  382



>ref|XP_010677899.1| PREDICTED: uncharacterized protein LOC104893494 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=740

 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 103/131 (79%), Gaps = 2/131 (2%)
 Frame = -2

Query  860  EENGDGALLQEQLHDSSVKG--NNklfsdlsksklksskSMTRNKWKPEEVKKLIKMRGE  687
            EE G+ + L E+  D S  G  N     + SK   K SKS TRNKWKPEEVKKLI +RGE
Sbjct  604  EERGEISTLLEEYADRSRGGEVNKDESDEESKHSTKRSKSTTRNKWKPEEVKKLIMLRGE  663

Query  686  LNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKYEESKKDRKSQEKWPY  507
            L+ +FQV+KGRMALW+EISS+LL+DG +R+PGQCKSLWASLVQKYEESK D KS++ WP+
Sbjct  664  LHDRFQVVKGRMALWEEISSSLLNDGFNRTPGQCKSLWASLVQKYEESKSDEKSKKSWPH  723

Query  506  FKDMNSILSDL  474
            +++M++ILS+L
Sbjct  724  YQEMDTILSNL  734



>ref|XP_004952679.1| PREDICTED: uncharacterized protein LOC101761263 isoform X1 [Setaria 
italica]
Length=878

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+MRGE+N KFQ +KGRM LW+EIS +L++ GISR+P QCKSLW SLV
Sbjct  784  KNKWKPEEIKSLIQMRGEMNEKFQSVKGRMVLWEEISGSLMNQGISRTPAQCKSLWTSLV  843

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD +S + WPYF D++ ILS
Sbjct  844  QKYEESKKDEESMKTWPYFSDIDRILS  870



>ref|XP_010460300.1| PREDICTED: trihelix transcription factor GT-3b-like [Camelina 
sativa]
Length=80

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -2

Query  698  MRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKYEESKKDRKSQE  519
            MRGEL+S+FQV+KGRMALW+EISSNL ++G  RSPGQCKSLWASL+QKYEE K + +S+ 
Sbjct  1    MRGELHSRFQVVKGRMALWEEISSNLSAEGFDRSPGQCKSLWASLIQKYEECKAEERSKT  60

Query  518  KWPYFKDMNSILSDLEAPTS  459
             WP+F+DMN+ILS+L  PTS
Sbjct  61   SWPHFEDMNNILSELGTPTS  80



>ref|XP_010105237.1| Ribonuclease J [Morus notabilis]
 gb|EXC04124.1| Ribonuclease J [Morus notabilis]
Length=872

 Score =   137 bits (345),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKW+PEEV KLI+MRGEL+S+F V+KGRMALW+EIS  L++DGI RSPGQCKS WASLV
Sbjct  779  RNKWRPEEVLKLIQMRGELHSQFLVVKGRMALWEEISRELVADGIDRSPGQCKSRWASLV  838

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            Q+YEESK    + + WPYF++MN +LSD EA  +K
Sbjct  839  QEYEESKSG-NNHKNWPYFEEMNKVLSDSEAVAAK  872



>gb|KDO52627.1| hypothetical protein CISIN_1g040954mg [Citrus sinensis]
Length=332

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 78/90 (87%), Gaps = 1/90 (1%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + +NKW+PEEVKKLIKMRGEL+SKFQ++KGRMALW+EIS++L ++G +RSP QCKS W+S
Sbjct  235  VRQNKWRPEEVKKLIKMRGELHSKFQIVKGRMALWKEISTHLANEGFNRSPSQCKSRWSS  294

Query  566  LVQKYEESKKDRKSQEKWPYFKDMNSILSD  477
            L+QKYEESK    SQ+ WPYF++MN I SD
Sbjct  295  LLQKYEESKSG-NSQKSWPYFEEMNKIFSD  323



>ref|XP_010250773.1| PREDICTED: uncharacterized protein LOC104592923 isoform X3 [Nelumbo 
nucifera]
Length=741

 Score =   136 bits (343),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 107/156 (69%), Gaps = 4/156 (3%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQ---LHDSSVKGNNklfsdlsksklksskSMT  741
            SDDF    VT S +    +  +G++ +E+   L+    K   +  ++L+  +  SSK   
Sbjct  586  SDDFWNLFVTPSPLEHLGKVENGSIRKEEHLELNKDGTKSRGEGSAELASPQSASSKPAK  645

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKW PEE+ KLIKMRGEL+S+FQV+KGRM LW+EIS+NLL  GI+R+PGQCKSLWASL+
Sbjct  646  RNKWMPEEIMKLIKMRGELDSRFQVVKGRMVLWKEISANLLVYGINRTPGQCKSLWASLI  705

Query  560  QKYE-ESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYE E +  +KS++ WPYF +M  IL   EA ++K
Sbjct  706  QKYEQEIRIGKKSKKSWPYFDEMEKILLGREATSTK  741



>ref|XP_010677898.1| PREDICTED: uncharacterized protein LOC104893494 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=886

 Score =   136 bits (343),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 103/131 (79%), Gaps = 2/131 (2%)
 Frame = -2

Query  860  EENGDGALLQEQLHDSSVKG--NNklfsdlsksklksskSMTRNKWKPEEVKKLIKMRGE  687
            EE G+ + L E+  D S  G  N     + SK   K SKS TRNKWKPEEVKKLI +RGE
Sbjct  750  EERGEISTLLEEYADRSRGGEVNKDESDEESKHSTKRSKSTTRNKWKPEEVKKLIMLRGE  809

Query  686  LNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKYEESKKDRKSQEKWPY  507
            L+ +FQV+KGRMALW+EISS+LL+DG +R+PGQCKSLWASLVQKYEESK D KS++ WP+
Sbjct  810  LHDRFQVVKGRMALWEEISSSLLNDGFNRTPGQCKSLWASLVQKYEESKSDEKSKKSWPH  869

Query  506  FKDMNSILSDL  474
            +++M++ILS+L
Sbjct  870  YQEMDTILSNL  880



>ref|XP_006477011.1| PREDICTED: uncharacterized protein LOC102606767 isoform X2 [Citrus 
sinensis]
Length=734

 Score =   135 bits (341),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKW+PEEVKKLIKMRGEL+SKFQV+KGRMALW+EIS++L ++G +R+P QCKS W+SL+
Sbjct  639  RNKWRPEEVKKLIKMRGELHSKFQVVKGRMALWKEISTHLANEGFNRTPSQCKSRWSSLL  698

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSD  477
            QKYEESK    SQ+ WPYF++MN I SD
Sbjct  699  QKYEESKSG-NSQKSWPYFEEMNKIFSD  725



>ref|XP_010250771.1| PREDICTED: uncharacterized protein LOC104592923 isoform X1 [Nelumbo 
nucifera]
Length=887

 Score =   136 bits (342),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 107/156 (69%), Gaps = 4/156 (3%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQ---LHDSSVKGNNklfsdlsksklksskSMT  741
            SDDF    VT S +    +  +G++ +E+   L+    K   +  ++L+  +  SSK   
Sbjct  732  SDDFWNLFVTPSPLEHLGKVENGSIRKEEHLELNKDGTKSRGEGSAELASPQSASSKPAK  791

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKW PEE+ KLIKMRGEL+S+FQV+KGRM LW+EIS+NLL  GI+R+PGQCKSLWASL+
Sbjct  792  RNKWMPEEIMKLIKMRGELDSRFQVVKGRMVLWKEISANLLVYGINRTPGQCKSLWASLI  851

Query  560  QKYE-ESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QKYE E +  +KS++ WPYF +M  IL   EA ++K
Sbjct  852  QKYEQEIRIGKKSKKSWPYFDEMEKILLGREATSTK  887



>ref|XP_002451689.1| hypothetical protein SORBIDRAFT_04g005900 [Sorghum bicolor]
 gb|EES04665.1| hypothetical protein SORBIDRAFT_04g005900 [Sorghum bicolor]
Length=875

 Score =   135 bits (341),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+MRGE+N KFQ +KGRM LW+EIS  +L+ GISR+P QCKSLW SLV
Sbjct  780  KNKWKPEEIKSLIQMRGEMNEKFQSVKGRMVLWEEISDTMLNQGISRTPAQCKSLWTSLV  839

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD +S + WPYF  M+ ILS
Sbjct  840  QKYEESKKDMESMKTWPYFSAMDRILS  866



>ref|XP_006477010.1| PREDICTED: uncharacterized protein LOC102606767 isoform X1 [Citrus 
sinensis]
Length=912

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKW+PEEVKKLIKMRGEL+SKFQV+KGRMALW+EIS++L ++G +R+P QCKS W+SL+
Sbjct  817  RNKWRPEEVKKLIKMRGELHSKFQVVKGRMALWKEISTHLANEGFNRTPSQCKSRWSSLL  876

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSD  477
            QKYEESK    SQ+ WPYF++MN I SD
Sbjct  877  QKYEESKSG-NSQKSWPYFEEMNKIFSD  903



>gb|KHN14093.1| Ribonuclease J [Glycine soja]
Length=810

 Score =   134 bits (338),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWK EEVKKLI MRGELN +FQV+KGRMALW+EIS NLL++GISRSPGQCKSLW SL+
Sbjct  716  RNKWKHEEVKKLIDMRGELNDRFQVVKGRMALWEEISQNLLANGISRSPGQCKSLWTSLL  775

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSD  477
            QKYEE K ++K+++KWPYF+DM  IL+D
Sbjct  776  QKYEEVKNEKKNKKKWPYFEDMERILAD  803



>ref|XP_006600801.1| PREDICTED: uncharacterized protein LOC100814619 isoform X2 [Glycine 
max]
Length=869

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWK EEVKKLI MRGELN +FQV+KGRMALW+EIS NLL++GISRSPGQCKSLW SL+
Sbjct  775  RNKWKHEEVKKLIDMRGELNDRFQVVKGRMALWEEISQNLLANGISRSPGQCKSLWTSLL  834

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSD  477
            QKYEE K ++K+++KWPYF+DM  IL+D
Sbjct  835  QKYEEVKNEKKNKKKWPYFEDMERILAD  862



>ref|XP_003575091.2| PREDICTED: uncharacterized protein LOC100825739 isoform X2 [Brachypodium 
distachyon]
Length=721

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI++RGE+N KFQ +KGRM LW+EIS+++L+ GI+R+P QCKSLW SLV
Sbjct  627  KNKWKPEEIKSLIQLRGEMNEKFQTVKGRMVLWEEISASMLNQGITRTPAQCKSLWTSLV  686

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD +  + WPYF  M+S LS
Sbjct  687  QKYEESKKDGEGMKTWPYFSAMDSFLS  713



>ref|XP_006600800.1| PREDICTED: uncharacterized protein LOC100814619 isoform X1 [Glycine 
max]
Length=870

 Score =   134 bits (336),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWK EEVKKLI MRGELN +FQV+KGRMALW+EIS NLL++GISRSPGQCKSLW SL+
Sbjct  775  RNKWKHEEVKKLIDMRGELNDRFQVVKGRMALWEEISQNLLANGISRSPGQCKSLWTSLL  834

Query  560  QKYE-ESKKDRKSQEKWPYFKDMNSILSD  477
            QKYE E K ++K+++KWPYF+DM  IL+D
Sbjct  835  QKYEQEVKNEKKNKKKWPYFEDMERILAD  863



>ref|XP_007137930.1| hypothetical protein PHAVU_009G167400g [Phaseolus vulgaris]
 gb|ESW09924.1| hypothetical protein PHAVU_009G167400g [Phaseolus vulgaris]
Length=871

 Score =   133 bits (335),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWK +EVKKLI +R EL+ +FQ++KGRMALW+EIS  L +DGISRSPGQCKSLW SLV
Sbjct  777  RNKWKTDEVKKLIGIREELHDRFQIVKGRMALWEEISQKLSADGISRSPGQCKSLWTSLV  836

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
             KYE  K ++ S++ WPY +DM  I+SD EAP +K
Sbjct  837  LKYEGIKNEKDSKKSWPYIEDMERIMSDKEAPATK  871



>ref|XP_010235506.1| PREDICTED: uncharacterized protein LOC100825739 isoform X1 [Brachypodium 
distachyon]
Length=875

 Score =   133 bits (335),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI++RGE+N KFQ +KGRM LW+EIS+++L+ GI+R+P QCKSLW SLV
Sbjct  781  KNKWKPEEIKSLIQLRGEMNEKFQTVKGRMVLWEEISASMLNQGITRTPAQCKSLWTSLV  840

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD +  + WPYF  M+S LS
Sbjct  841  QKYEESKKDGEGMKTWPYFSAMDSFLS  867



>ref|XP_006440090.1| hypothetical protein CICLE_v10018763mg [Citrus clementina]
 gb|ESR53330.1| hypothetical protein CICLE_v10018763mg [Citrus clementina]
Length=912

 Score =   133 bits (335),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKW+PEEVKKLIKMRGEL+SKFQ++KGRMALW+EIS++L ++G +RSP QCKS W+SL+
Sbjct  817  QNKWRPEEVKKLIKMRGELHSKFQIVKGRMALWKEISTHLANEGFNRSPSQCKSRWSSLL  876

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSD  477
            QKYEESK    SQ+ WPYF++MN I SD
Sbjct  877  QKYEESKSG-NSQKSWPYFEEMNKIFSD  903



>ref|XP_008464474.1| PREDICTED: uncharacterized protein LOC103502342 isoform X2 [Cucumis 
melo]
Length=909

 Score =   133 bits (335),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+KKLIK+RG+L+++FQV +GRMALW+EIS+ +L+DGI+RSPGQCKSLW SLV
Sbjct  815  RNKWKPEEIKKLIKLRGQLHARFQVTRGRMALWEEISNGMLADGINRSPGQCKSLWTSLV  874

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QK+EESK ++KS++ WPY ++M+ ILSD EA  +K
Sbjct  875  QKFEESKSEKKSKKSWPYLEEMSGILSDSEAVATK  909



>ref|XP_008661157.1| PREDICTED: uncharacterized protein LOC103640333 [Zea mays]
Length=382

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+M GE+N +FQ +KGRM LW+EIS N+L  GISR+P QCKSLW SLV
Sbjct  282  KNKWKPEEIKSLIQMHGEMNERFQSVKGRMVLWEEISDNMLKQGISRTPAQCKSLWTSLV  341

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD +S + W YF  M+ ILS
Sbjct  342  QKYEESKKDAESMKTWLYFSVMDRILS  368



>ref|XP_007155529.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
 gb|ESW27523.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
Length=869

 Score =   133 bits (334),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 105/158 (66%), Gaps = 6/158 (4%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQ----LHDSSVKGNNklfsdlsksklksskSM  744
            SDDF KP V SS +  S +  +G + Q++      D S +   +  + ++ S  +   S 
Sbjct  712  SDDFFKPLVGSSPVEKSIKANNGYVPQKEKPSPFKDGSSEDTEEECNSVNTSNSEPKSSK  771

Query  743  TRNKWKP--EEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWA  570
            +  K K   +EVKKLI MRGE+N +FQV+KGRMALW+EIS NLLS+GISRSPGQCKSLW 
Sbjct  772  SAKKNKWKHDEVKKLIGMRGEMNDRFQVVKGRMALWEEISQNLLSNGISRSPGQCKSLWT  831

Query  569  SLVQKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            SL+QKYEE K ++  ++KWPY ++M  ILSD E   SK
Sbjct  832  SLLQKYEEVKNEKNGKKKWPYLEEMERILSDSETLASK  869



>gb|AFW70511.1| putative metallo-beta-lactamase homeodomain-containing protein 
[Zea mays]
Length=510

 Score =   130 bits (328),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+K LI+MRGE+N KFQ +KGRM LW+EIS  +L+ G+SR+P QCKSLW SLV
Sbjct  416  RNKWKPEEIKSLIQMRGEMNEKFQSVKGRMVLWKEISDTMLNQGVSRTPAQCKSLWTSLV  475

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEES KD +S + WPYF  M+ ILS
Sbjct  476  QKYEES-KDTESMKTWPYFSAMDKILS  501



>ref|XP_008464475.1| PREDICTED: uncharacterized protein LOC103502342 isoform X3 [Cucumis 
melo]
Length=778

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+KKLIK+RG+L+++FQV +GRMALW+EIS+ +L+DGI+RSPGQCKSLW SLV
Sbjct  683  RNKWKPEEIKKLIKLRGQLHARFQVTRGRMALWEEISNGMLADGINRSPGQCKSLWTSLV  742

Query  560  QKYEE-SKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QK+E+ SK ++KS++ WPY ++M+ ILSD EA  +K
Sbjct  743  QKFEQESKSEKKSKKSWPYLEEMSGILSDSEAVATK  778



>ref|XP_002321691.2| hypothetical protein POPTR_0015s10570g [Populus trichocarpa]
 gb|EEF05818.2| hypothetical protein POPTR_0015s10570g [Populus trichocarpa]
Length=890

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEVK LIKMRGEL+S+FQV++GRMALW+EIS+NL++DGI+ SPGQCK LW SL 
Sbjct  796  RNKWKPEEVKSLIKMRGELHSRFQVVRGRMALWEEISTNLMADGINHSPGQCKYLWTSLA  855

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            +KYEESK D+KSQ+ W YF+DM++ILSD E   +K
Sbjct  856  KKYEESKSDKKSQKSWSYFEDMDNILSDSETMATK  890



>ref|XP_004138055.1| PREDICTED: ribonuclease J-like [Cucumis sativus]
Length=909

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+KKLIK+RGEL+ +FQV +GRMALW+EIS+ + +DGI+RSPGQCKSLWASLV
Sbjct  815  RNKWKPEEIKKLIKLRGELHDRFQVARGRMALWEEISNGMSADGINRSPGQCKSLWASLV  874

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QK+EESK ++KS++ WPY ++M+ ILSD EA  +K
Sbjct  875  QKFEESKSEKKSKKGWPYLEEMSGILSDSEAVATK  909



>ref|XP_008464473.1| PREDICTED: uncharacterized protein LOC103502342 isoform X1 [Cucumis 
melo]
Length=910

 Score =   131 bits (330),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 85/96 (89%), Gaps = 1/96 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+KKLIK+RG+L+++FQV +GRMALW+EIS+ +L+DGI+RSPGQCKSLW SLV
Sbjct  815  RNKWKPEEIKKLIKLRGQLHARFQVTRGRMALWEEISNGMLADGINRSPGQCKSLWTSLV  874

Query  560  QKYEE-SKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QK+E+ SK ++KS++ WPY ++M+ ILSD EA  +K
Sbjct  875  QKFEQESKSEKKSKKSWPYLEEMSGILSDSEAVATK  910



>ref|XP_006581876.1| PREDICTED: uncharacterized protein LOC100779771 isoform X1 [Glycine 
max]
Length=884

 Score =   131 bits (330),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 104/157 (66%), Gaps = 10/157 (6%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNN------klfsdlsksklkssk  750
            SD+F KP +TS  +  S  N D   +  +   S++K +           + S S+ KSSK
Sbjct  730  SDEFWKPFITSLPVEKSI-NADNGYVSPKEQKSNLKKDESEDIDEAKSEETSNSEAKSSK  788

Query  749  SMTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWA  570
            S+ RNKWK EEVKKLI MR EL+ +FQV+KGRMALW+EIS  LL+DGI RSPGQCKSLW 
Sbjct  789  SVKRNKWKTEEVKKLIGMREELSERFQVVKGRMALWEEISQKLLADGICRSPGQCKSLWT  848

Query  569  SLVQKYEESK-KDRKSQEKWPYFKDMNSILSDLEAPT  462
            SLV KYE  K +DRK  + WPY +DM  I+SD EAP 
Sbjct  849  SLVVKYEGIKNEDRK--KSWPYIEDMERIMSDKEAPA  883



>ref|XP_008645345.1| PREDICTED: uncharacterized protein LOC103626744 isoform X2 [Zea 
mays]
Length=756

 Score =   130 bits (328),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+K LI+MRGE+N KFQ +KGRM LW+EIS  +L+ G+SR+P QCKSLW SLV
Sbjct  662  RNKWKPEEIKSLIQMRGEMNEKFQSVKGRMVLWKEISDTMLNQGVSRTPAQCKSLWTSLV  721

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEES KD +S + WPYF  M+ ILS
Sbjct  722  QKYEES-KDTESMKTWPYFSAMDKILS  747



>gb|EPS67461.1| hypothetical protein M569_07313, partial [Genlisea aurea]
Length=815

 Score =   130 bits (328),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKW+PEEVKKLI+MR +L+++FQV+KGRMALW+EISS L+ +G +R+PGQCKSLWASLV
Sbjct  721  RNKWRPEEVKKLIEMRRKLHAEFQVVKGRMALWEEISSGLMVNGTTRTPGQCKSLWASLV  780

Query  560  QKYEESKKDRKSQEKWPYFKDMNSIL  483
            QKYEE K D  ++  WPYF+++  IL
Sbjct  781  QKYEEIKNDGSARMAWPYFEEVKGIL  806



>ref|XP_008645344.1| PREDICTED: uncharacterized protein LOC103626744 isoform X1 [Zea 
mays]
Length=874

 Score =   130 bits (327),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+K LI+MRGE+N KFQ +KGRM LW+EIS  +L+ G+SR+P QCKSLW SLV
Sbjct  780  RNKWKPEEIKSLIQMRGEMNEKFQSVKGRMVLWKEISDTMLNQGVSRTPAQCKSLWTSLV  839

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEES KD +S + WPYF  M+ ILS
Sbjct  840  QKYEES-KDTESMKTWPYFSAMDKILS  865



>gb|KHN23276.1| Ribonuclease J [Glycine soja]
Length=884

 Score =   130 bits (327),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 103/156 (66%), Gaps = 8/156 (5%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLH-----DSSVKGNNklfsdlsksklksskS  747
            SD+F KP +TS  +  S    +G +  ++       D S   +     + S S+ KSSKS
Sbjct  730  SDEFWKPFITSLPVEKSISADNGYVSPKEQKSNLKKDDSEDIDEAKSEETSNSEAKSSKS  789

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            + RNKWK EEVKKLI MR EL+ +FQV+KGRMALW+EIS  LL+DGI RSPGQCKSLW S
Sbjct  790  VKRNKWKTEEVKKLIGMREELSERFQVVKGRMALWEEISQKLLADGICRSPGQCKSLWTS  849

Query  566  LVQKYEESK-KDRKSQEKWPYFKDMNSILSDLEAPT  462
            LV KYE  K +DRK  + WPY +DM  I+SD EAP 
Sbjct  850  LVVKYEGIKNEDRK--KSWPYIEDMERIMSDKEAPA  883



>ref|XP_011024044.1| PREDICTED: uncharacterized protein LOC105125338 [Populus euphratica]
Length=890

 Score =   130 bits (327),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEVK LIKMRGEL+S+FQV++GRMALW+EIS+NL++DGI+ SPGQCK LW SL 
Sbjct  796  RNKWKPEEVKSLIKMRGELHSRFQVVRGRMALWEEISANLMADGINHSPGQCKYLWTSLA  855

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            +KY+ESK D+KSQ+ WPYF+DM++ILSD E   +K
Sbjct  856  KKYKESKSDKKSQKSWPYFEDMDNILSDSETMATK  890



>ref|XP_004161356.1| PREDICTED: LOW QUALITY PROTEIN: ribonuclease J-like [Cucumis 
sativus]
Length=909

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+KKLIK+ GEL+ +FQV +GRMALW+EIS+ + +DGI+RSPGQCKSLWASLV
Sbjct  815  RNKWKPEEIKKLIKLXGELHDRFQVARGRMALWEEISNGMSADGINRSPGQCKSLWASLV  874

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            QK+EESK ++KS++ WPY ++M+ ILSD EA  +K
Sbjct  875  QKFEESKSEKKSKKGWPYLEEMSGILSDSEAVATK  909



>ref|XP_010909139.1| PREDICTED: uncharacterized protein LOC105035311 isoform X4 [Elaeis 
guineensis]
Length=731

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+K+LIKMRGEL+++F+ +K RM LW+EIS +LL  G++R+P QCKSLWASLV
Sbjct  638  RNKWKPEEMKQLIKMRGELDNRFRTVKARMILWEEISVSLLKHGVNRTPAQCKSLWASLV  697

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPT  462
            QKYE  K + KS++ WPYF  ++ ILS  E  T
Sbjct  698  QKYEGCKSNEKSRKSWPYFTSLDEILSVHEGAT  730



>ref|XP_009419383.1| PREDICTED: uncharacterized protein LOC103999362 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=740

 Score =   128 bits (321),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEV++LI +R  L+SKF+  K RM LW+EIS+++L+DGI+RSP QCKSLWASLV
Sbjct  647  RNKWKPEEVQRLIILRAGLDSKFRSAKARMVLWEEISTDMLNDGINRSPAQCKSLWASLV  706

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEES+++ KS++ WP+F  M+ +LS
Sbjct  707  QKYEESRRNEKSRKTWPHFAAMDEVLS  733



>ref|XP_007155530.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
 gb|ESW27524.1| hypothetical protein PHAVU_003G209600g [Phaseolus vulgaris]
Length=870

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQ----LHDSSVKGNNklfsdlsksklksskSM  744
            SDDF KP V SS +  S +  +G + Q++      D S +   +  + ++ S  +   S 
Sbjct  712  SDDFFKPLVGSSPVEKSIKANNGYVPQKEKPSPFKDGSSEDTEEECNSVNTSNSEPKSSK  771

Query  743  TRNKWKP--EEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWA  570
            +  K K   +EVKKLI MRGE+N +FQV+KGRMALW+EIS NLLS+GISRSPGQCKSLW 
Sbjct  772  SAKKNKWKHDEVKKLIGMRGEMNDRFQVVKGRMALWEEISQNLLSNGISRSPGQCKSLWT  831

Query  569  SLVQKYE-ESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            SL+QKYE E K ++  ++KWPY ++M  ILSD E   SK
Sbjct  832  SLLQKYEQEVKNEKNGKKKWPYLEEMERILSDSETLASK  870



>ref|XP_010909136.1| PREDICTED: uncharacterized protein LOC105035311 isoform X1 [Elaeis 
guineensis]
Length=884

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+K+LIKMRGEL+++F+ +K RM LW+EIS +LL  G++R+P QCKSLWASLV
Sbjct  791  RNKWKPEEMKQLIKMRGELDNRFRTVKARMILWEEISVSLLKHGVNRTPAQCKSLWASLV  850

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPT  462
            QKYE  K + KS++ WPYF  ++ ILS  E  T
Sbjct  851  QKYEGCKSNEKSRKSWPYFTSLDEILSVHEGAT  883



>ref|XP_010909137.1| PREDICTED: uncharacterized protein LOC105035311 isoform X2 [Elaeis 
guineensis]
Length=879

 Score =   128 bits (322),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+K+LIKMRGEL+++F+ +K RM LW+EIS +LL  G++R+P QCKSLWASLV
Sbjct  786  RNKWKPEEMKQLIKMRGELDNRFRTVKARMILWEEISVSLLKHGVNRTPAQCKSLWASLV  845

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPT  462
            QKYE  K + KS++ WPYF  ++ ILS  E  T
Sbjct  846  QKYEGCKSNEKSRKSWPYFTSLDEILSVHEGAT  878



>gb|KGN63492.1| hypothetical protein Csa_1G002120 [Cucumis sativus]
Length=910

 Score =   128 bits (321),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+KKLIK+RGEL+ +FQV +GRMALW+EIS+ + +DGI+RSPGQCKSLWASLV
Sbjct  815  RNKWKPEEIKKLIKLRGELHDRFQVARGRMALWEEISNGMSADGINRSPGQCKSLWASLV  874

Query  560  QKYEESKKDRKSQEK-WPYFKDMNSILSDLEAPTSK  456
            QK+E+  K  K  +K WPY ++M+ ILSD EA  +K
Sbjct  875  QKFEQESKSEKKSKKGWPYLEEMSGILSDSEAVATK  910



>gb|EMT12329.1| Ribonuclease J [Aegilops tauschii]
Length=851

 Score =   127 bits (319),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI++RGE+N KFQ +KGRM LW+EIS +LL  GI+R+P QCKS+W SL+
Sbjct  757  KNKWKPEEIKSLIQLRGEMNEKFQTVKGRMVLWEEISGSLLKQGITRTPAQCKSVWTSLL  816

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEESKKD ++   W YF  M+S LS
Sbjct  817  QKYEESKKDEENMRTWQYFSAMDSFLS  843



>ref|XP_009419382.1| PREDICTED: uncharacterized protein LOC103999362 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=888

 Score =   127 bits (319),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEEV++LI +R  L+SKF+  K RM LW+EIS+++L+DGI+RSP QCKSLWASLV
Sbjct  795  RNKWKPEEVQRLIILRAGLDSKFRSAKARMVLWEEISTDMLNDGINRSPAQCKSLWASLV  854

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYEES+++ KS++ WP+F  M+ +LS
Sbjct  855  QKYEESRRNEKSRKTWPHFAAMDEVLS  881



>ref|XP_008811802.1| PREDICTED: uncharacterized protein LOC103722876 isoform X2 [Phoenix 
dactylifera]
Length=741

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+K+LIKMRGEL+++FQ +K RM LW+EIS ++L  G++R+P QCKSLWASLV
Sbjct  638  RNKWKPEEIKQLIKMRGELDNRFQTVKARMILWEEISVSMLKHGVNRTPAQCKSLWASLV  697

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKY + K +  S++ WPYF  M+ I+S
Sbjct  698  QKYVDCKSNENSRKSWPYFTSMDEIVS  724



>ref|XP_008811801.1| PREDICTED: uncharacterized protein LOC103722876 isoform X1 [Phoenix 
dactylifera]
Length=889

 Score =   125 bits (314),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+K+LIKMRGEL+++FQ +K RM LW+EIS ++L  G++R+P QCKSLWASLV
Sbjct  786  RNKWKPEEIKQLIKMRGELDNRFQTVKARMILWEEISVSMLKHGVNRTPAQCKSLWASLV  845

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKY + K +  S++ WPYF  M+ I+S
Sbjct  846  QKYVDCKSNENSRKSWPYFTSMDEIVS  872



>ref|XP_003602090.1| Ribonuclease J [Medicago truncatula]
Length=959

 Score =   125 bits (314),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWK EEVKKLI +R +L  +F+V+KGRMALW+EIS +LL+DGISRSPGQCKSLW SL 
Sbjct  784  KNKWKTEEVKKLIDLRSDLRDRFKVVKGRMALWEEISQSLLADGISRSPGQCKSLWTSLA  843

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
             KYEE K  + S++ W Y +DM  ILS  E P+ +
Sbjct  844  LKYEEIKNGKDSRKNWQYLEDMERILSSDETPSDR  878



>gb|AES72341.2| RNA-metabolising metallo-beta-lactamase [Medicago truncatula]
Length=867

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWK EEVKKLI +R +L  +F+V+KGRMALW+EIS +LL+DGISRSPGQCKSLW SL 
Sbjct  773  KNKWKTEEVKKLIDLRSDLRDRFKVVKGRMALWEEISQSLLADGISRSPGQCKSLWTSLA  832

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPTS  459
             KYEE K  + S++ W Y +DM  ILS  E P +
Sbjct  833  LKYEEIKNGKDSRKNWQYLEDMERILSSDETPAT  866



>ref|XP_006827615.1| hypothetical protein AMTR_s00009p00241540 [Amborella trichopoda]
 gb|ERM95031.1| hypothetical protein AMTR_s00009p00241540 [Amborella trichopoda]
Length=866

 Score =   124 bits (311),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKW+PEE+ KLI++RGE++S+F+ +K RM LW+E+SS LL  G+ R+PGQCKS+WASLV
Sbjct  774  RNKWEPEEISKLIQLRGEMDSRFRAVKARMVLWEEVSSKLLESGVKRTPGQCKSIWASLV  833

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
            QKYE+++   K ++ WP+F++M+ ILS
Sbjct  834  QKYEDNRVGNKGKKGWPFFEEMDKILS  860



>ref|XP_004500653.1| PREDICTED: ribonuclease J-like isoform X2 [Cicer arietinum]
Length=720

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWK EEVKKLI +R +L  +F+V+KGRM LW+EIS +LL+DGI RSP QCKSLW SLV
Sbjct  626  KNKWKAEEVKKLIGLRSDLRDRFKVVKGRMILWEEISQSLLADGIRRSPAQCKSLWRSLV  685

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPT  462
              YEE K  + S++ W Y +DM  ILS+ EAPT
Sbjct  686  LTYEEIKNGKDSRKNWQYLEDMERILSNDEAPT  718



>ref|XP_004500652.1| PREDICTED: ribonuclease J-like isoform X1 [Cicer arietinum]
Length=863

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWK EEVKKLI +R +L  +F+V+KGRM LW+EIS +LL+DGI RSP QCKSLW SLV
Sbjct  769  KNKWKAEEVKKLIGLRSDLRDRFKVVKGRMILWEEISQSLLADGIRRSPAQCKSLWRSLV  828

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILSDLEAPT  462
              YEE K  + S++ W Y +DM  ILS+ EAPT
Sbjct  829  LTYEEIKNGKDSRKNWQYLEDMERILSNDEAPT  861



>ref|XP_002451690.1| hypothetical protein SORBIDRAFT_04g005902 [Sorghum bicolor]
 gb|EES04666.1| hypothetical protein SORBIDRAFT_04g005902 [Sorghum bicolor]
Length=290

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+MRGE+N KFQ +KGRM LW+EIS  +L+ GISR+P QCKSLW SLV
Sbjct  223  KNKWKPEEIKSLIQMRGEMNEKFQSVKGRMVLWEEISDTMLNQGISRTPAQCKSLWTSLV  282

Query  560  QKYEESKK  537
            QKYE S +
Sbjct  283  QKYEVSHR  290



>ref|XP_006581877.1| PREDICTED: uncharacterized protein LOC100779771 isoform X2 [Glycine 
max]
Length=855

 Score =   109 bits (273),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 85/127 (67%), Gaps = 7/127 (6%)
 Frame = -2

Query  911  SDDFXKPXVTSSTIHPSEENGDGALLQEQLHDSSVKGNN------klfsdlsksklkssk  750
            SD+F KP +TS  +  S  N D   +  +   S++K +           + S S+ KSSK
Sbjct  730  SDEFWKPFITSLPVEKSI-NADNGYVSPKEQKSNLKKDESEDIDEAKSEETSNSEAKSSK  788

Query  749  SMTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWA  570
            S+ RNKWK EEVKKLI MR EL+ +FQV+KGRMALW+EIS  LL+DGI RSPGQCKSLW 
Sbjct  789  SVKRNKWKTEEVKKLIGMREELSERFQVVKGRMALWEEISQKLLADGICRSPGQCKSLWT  848

Query  569  SLVQKYE  549
            SLV KYE
Sbjct  849  SLVVKYE  855



>ref|NP_001142485.1| uncharacterized protein LOC100274709 [Zea mays]
 gb|ACG24323.1| hypothetical protein [Zea mays]
Length=269

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 60/80 (75%), Gaps = 7/80 (9%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+MRGE+N +FQ +KGRM LW+EI  N+L  GISR+  QCKSLW SLV
Sbjct  165  KNKWKPEEIKSLIQMRGEMNGRFQSVKGRMVLWEEIFDNMLKQGISRTLAQCKSLWTSLV  224

Query  560  QKYEESKKDRKSQEKWPYFK  501
            QKYE        ++K+ +F+
Sbjct  225  QKYE-------VRDKFCFFR  237



>ref|XP_010909138.1| PREDICTED: uncharacterized protein LOC105035311 isoform X3 [Elaeis 
guineensis]
Length=865

 Score =   106 bits (265),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 63/82 (77%), Gaps = 7/82 (9%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            RNKWKPEE+K+LIKMRGEL+++F+ +K RM LW+EIS +LL  G++R+P QCKSLWASLV
Sbjct  791  RNKWKPEEMKQLIKMRGELDNRFRTVKARMILWEEISVSLLKHGVNRTPAQCKSLWASLV  850

Query  560  QKYEESKKDRKSQEKWPYFKDM  495
            QKYE          ++P+F  +
Sbjct  851  QKYE-------VLAQFPFFTGL  865



>gb|AFW88531.1| putative homeodomain containing protein [Zea mays]
Length=673

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+M GE+N +FQ +KGRM LW+EIS N+L  GISR+P QCKSLW SLV
Sbjct  481  KNKWKPEEIKSLIQMHGEMNERFQSVKGRMVLWEEISDNMLKQGISRTPAQCKSLWTSLV  540

Query  560  QKYE  549
            QKYE
Sbjct  541  QKYE  544



>ref|XP_002975019.1| hypothetical protein SELMODRAFT_102611, partial [Selaginella 
moellendorffii]
 gb|EFJ23804.1| hypothetical protein SELMODRAFT_102611, partial [Selaginella 
moellendorffii]
Length=829

 Score = 78.6 bits (192),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 58/89 (65%), Gaps = 1/89 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +++WKPE  + LI++R  ++ KF+  K +  LW+EI+S L   G   + GQCK++W++LV
Sbjct  737  KSRWKPEATQVLIRLRTGMDDKFREAKLKTPLWKEIASKLAEHGYEHTHGQCKAMWSTLV  796

Query  560  QKYEESKKDRKSQEK-WPYFKDMNSILSD  477
            ++Y    +D  S  K WP+F  M++ LSD
Sbjct  797  KRYRNIIEDDGSSNKNWPFFDGMHAYLSD  825



>ref|XP_002977440.1| hypothetical protein SELMODRAFT_107166, partial [Selaginella 
moellendorffii]
 gb|EFJ21444.1| hypothetical protein SELMODRAFT_107166, partial [Selaginella 
moellendorffii]
Length=835

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +++WKPE  + LI++R  ++ KF+  K +  LW+EI+S L   G   + GQCK++W++LV
Sbjct  743  KSRWKPEATQVLIRLRTGMDDKFREAKLKTPLWKEIASKLAEHGYEHTHGQCKAMWSTLV  802

Query  560  QKYEESKKDRKSQEK-WPYFKDMNSILSD  477
            ++Y     D  S  K WP+F  M++ LSD
Sbjct  803  KRYRNIIDDDGSSNKNWPFFDGMHAYLSD  831



>ref|XP_001757788.1| predicted protein [Physcomitrella patens]
 gb|EDQ77428.1| predicted protein [Physcomitrella patens]
Length=496

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 53/90 (59%), Gaps = 1/90 (1%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            WK  EV + IK+RGE++S+F     R ALW  ++  LL  GI R   QC+  W  L+ +Y
Sbjct  407  WKRTEVLQFIKLRGEMDSRFAHSTRRAALWDGLAERLLVQGIKRDGKQCREKWDKLMAEY  466

Query  551  EESKKDRKSQEKWPYFKDMNSILS-DLEAP  465
            ++    ++ Q + PY+ ++ +IL   +EAP
Sbjct  467  KDVTDGKRDQRESPYYSELTAILGRPVEAP  496


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W   E  +LI++R +L  +F     +  LW EI+  L     +R   QC+  W  L   Y
Sbjct  135  WTRPESLQLIRLRTQLEPRFSKSGRKTELWDEIAEALHKKNFTRDAQQCRDKWEKLTAGY  194

Query  551  EESKKDRKSQEKWPYFKDMNSILS  480
            +E +   K +E  P++ +++S+LS
Sbjct  195  KEVRDGIKDKEDNPFYDELHSLLS  218



>ref|XP_010933052.1| PREDICTED: trihelix transcription factor GT-3b-like [Elaeis guineensis]
Length=293

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W PEE + LI +RG+L   F V K    +W+ +++ +   G  RSP QCK  W +LV +
Sbjct  45   QWSPEETRDLIAIRGDLERDFSVSKRNKTMWELVATRMREKGYRRSPEQCKCKWKNLVNR  104

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D ++ ++ P+F++++++ ++
Sbjct  105  YKGKETSDPETGKQCPFFEELHAVFTE  131



>gb|KFK36721.1| hypothetical protein AALP_AA4G160800 [Arabis alpina]
Length=299

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI++RGEL+  F   K    LW+ IS+ +      RSP QCK  W +LV +
Sbjct  51   QWSIEETKELIRIRGELDQTFMETKRNKLLWEVISNKMRDKSFPRSPEQCKCKWKNLVTR  110

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +   +++++P++ DM  I S
Sbjct  111  YKGCETMEAEIARQQFPFYDDMQIIFS  137



>ref|XP_004300404.1| PREDICTED: trihelix transcription factor GT-3b-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011465302.1| PREDICTED: trihelix transcription factor GT-3b-like [Fragaria 
vesca subsp. vesca]
Length=279

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = -2

Query  737  NKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQ  558
             +W PEE ++LI +RGEL     V K   ALW+ +SS + + G +R+  QCK  W +L+ 
Sbjct  26   GQWGPEETRELIAIRGELERDSSVAKRSKALWEAVSSRMSARGFNRTSEQCKCKWKNLLI  85

Query  557  KYE-ESKKDRKSQEKWPYFKDMNSILSDLE  471
            +Y+ +   D ++  K P+F+++  + ++ E
Sbjct  86   RYKGKETSDPETGRKCPFFEELQEVFTERE  115



>gb|KJB16900.1| hypothetical protein B456_002G262900 [Gossypium raimondii]
Length=259

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 55/96 (57%), Gaps = 3/96 (3%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+ + +R EL+  F   K    LW+ IS+ L   G +RS  QCK  W +LV +
Sbjct  35   QWSIQETKEFLMIRAELDPSFMETKRNKQLWEFISTTLKEKGYNRSAEQCKCKWKNLVTR  94

Query  554  Y---EESKKDRKSQEKWPYFKDMNSILSDLEAPTSK  456
            Y   E  +++ K Q+++P++ D+ +I S  +  TSK
Sbjct  95   YKGCEMVEEEAKRQQQFPFYNDLQAIFSARKQTTSK  130



>ref|XP_007040932.1| Homeodomain-like superfamily protein [Theobroma cacao]
 gb|EOY25433.1| Homeodomain-like superfamily protein [Theobroma cacao]
Length=284

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W PEE ++LI +RGEL   F   K    LW+ +S+ +   G  R+P QCK  W +L+ +
Sbjct  24   QWGPEETRELILIRGELERDFTAAKRNKTLWEIVSARMRDRGYIRTPDQCKCKWKNLLNR  83

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D ++  ++P+F++++++ ++
Sbjct  84   YKGKETSDPENGRQFPFFEELHAVFTE  110



>tpg|DAA54212.1| TPA: putative homeodomain containing protein [Zea mays]
Length=514

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 44/87 (51%), Gaps = 34/87 (39%)
 Frame = -2

Query  740  RNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLV  561
            +NKWKPEE+K LI+MRGE+N +FQ +KGRM                              
Sbjct  427  KNKWKPEEIKSLIQMRGEMNGRFQSVKGRM------------------------------  456

Query  560  QKYEESKKDRKSQEKWPYFKDMNSILS  480
                ESKKD +S + WPYF  M+ ILS
Sbjct  457  ----ESKKDVESMKTWPYFSAMDRILS  479



>ref|XP_006845458.1| hypothetical protein AMTR_s00019p00124000 [Amborella trichopoda]
 gb|ERN07133.1| hypothetical protein AMTR_s00019p00124000 [Amborella trichopoda]
Length=419

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W   E  KLI +R E+ S+F     +  LW EI+S +  +   R   QC+  W  L   Y
Sbjct  81   WTRTETLKLISLRSEMESRFAKTGRKSELWDEIASEMRRESFCRDSQQCRDKWEKLTAGY  140

Query  551  EESKKDRKSQEKWPYFKDMNSILS  480
            +E++   K++E++P+F+D++ ILS
Sbjct  141  KEARDGVKAKEEFPFFQDLDPILS  164


 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            WK  EV KLIK R E+ S+F     R ALW E+S  L  +G+ R   QC+  W  L+ ++
Sbjct  310  WKRAEVLKLIKARSEMASRFDRCSRRAALWSELSEKLALEGVKRDGKQCREKWDKLMAEF  369

Query  551  EESKKDRKSQEKWPYFKDMNSI  486
            ++    ++ +++ PYF+++ ++
Sbjct  370  KDVTDGKRRKDESPYFQELLAM  391



>gb|KDP39741.1| hypothetical protein JCGZ_02761 [Jatropha curcas]
Length=304

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E K LI +RGEL   F + K   ALW+ +S+ +   G  R+P QCK  W +LV +Y
Sbjct  46   WTEQETKDLIGIRGELEKDFTIAKRNKALWEIVSAKMRERGYRRTPDQCKCKWKNLVNRY  105

Query  551  E-ESKKDRKSQEKWPYFKDMNSILSD  477
            + +   D ++    P+FK+++++ ++
Sbjct  106  KGKETSDPENGLHCPFFKELHTVFNE  131



>emb|CDX91438.1| BnaC04g07120D [Brassica napus]
Length=292

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+++S+ + +    RSP QCK  W +LV +
Sbjct  39   QWSVEETKELIAIRGELDQTFMETKRNKLLWEDVSNKMRNKSFLRSPEQCKCKWKNLVTR  98

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+  +  +++++P++ DM+ I +
Sbjct  99   FKGCETMDEEIAKQQFPFYDDMHIIFA  125



>ref|XP_010937854.1| PREDICTED: trihelix transcription factor GT-3b-like [Elaeis guineensis]
Length=267

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+ + +R EL+  F   K    LWQ IS+ L   G +R+P QCKS W +LV +
Sbjct  38   QWSHDETKEFLAIRAELDGTFMETKRNKPLWQAISARLEHKGFNRTPEQCKSKWKNLVTR  97

Query  554  YEESKK-DRKSQEKWPYFKDMNSILSD  477
            ++ S+  + +S  ++P++++M  I S+
Sbjct  98   FKGSEATEGESSRQFPFYEEMRMIFSE  124



>ref|XP_010677518.1| PREDICTED: trihelix transcription factor GT-3b-like [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 54/87 (62%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E  +LI +RG+L + F   K   ALW+ ++S+L   G  R+P QCKS W +LV +
Sbjct  42   QWGKQETLELINIRGQLETNFSTSKRNKALWESVASSLKQKGFFRTPHQCKSKWKNLVNR  101

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D  + ++ P+F++++ + S+
Sbjct  102  YKGKDTSDAVNGKQCPFFEELHVVFSE  128



>ref|XP_007209432.1| hypothetical protein PRUPE_ppa009580mg [Prunus persica]
 gb|EMJ10631.1| hypothetical protein PRUPE_ppa009580mg [Prunus persica]
Length=286

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGR-MALWQEISSNLLSDGISRSPGQCKSLWASLVQ  558
            +W PEE ++LI +RGEL  +   L  R  ALW+ +SS +   G +R+P QCK  W +L+ 
Sbjct  38   QWAPEETRELIAIRGELEIRNSNLAKRSKALWEAVSSKMAERGFNRTPEQCKCKWKNLLI  97

Query  557  KYE-ESKKDRKSQEKWPYFKDMNSILSD  477
            +Y+ +   D +S  + P+F+++ ++ ++
Sbjct  98   RYKGKETSDPESGRECPFFEELQAVFTE  125



>gb|EYU25943.1| hypothetical protein MIMGU_mgv1a019626mg, partial [Erythranthe 
guttata]
Length=326

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  EE++ LI +R E +S F   K    LW+ IS N+   G  RSP  C   W +L+++Y
Sbjct  25   WVQEEIRALISLRKETDSMFNTSKSNKHLWENISLNMRERGFDRSPTMCTDKWRNLLKEY  84

Query  551  EESKK-DRKSQEKWPYFKDMNSIL  483
            ++SK+ D     K  Y+KD++ IL
Sbjct  85   KKSKQNDGNCYSKMNYYKDIDQIL  108



>gb|ABR92761.1| transcription factor TF2 [Gossypium hirsutum]
Length=261

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE ++LI +RGEL   F   K    LW+ +S+ +   G +R+P QCKS W +L+ +
Sbjct  6    QWGQEETRELIFIRGELERDFTAAKHNKTLWEIVSARMKDRGYTRTPDQCKSKWKNLLNR  65

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D ++  ++P+F++++++ ++
Sbjct  66   YKGKETSDPENGCQFPFFEELHAVFTE  92



>gb|KHG28745.1| Trihelix transcription factor GT-3b -like protein [Gossypium 
arboreum]
Length=261

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE ++LI +RGEL   F   K    LW+ +S+ +   G +R+P QCKS W +L+ +
Sbjct  6    QWGQEETRELIFIRGELERDFTAAKHNKTLWEIVSARMKDRGYTRTPDQCKSKWKNLLNR  65

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D ++  ++P+F++++++ ++
Sbjct  66   YKGKETSDPENGCQFPFFEELDAVFTE  92



>gb|AAP13348.1| transcription factor GT-3b [Arabidopsis thaliana]
Length=289

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+ IS+ +      RSP QCK  W +LV +
Sbjct  41   QWSVEETKELIGIRGELDQTFMETKRNKLLWEVISNKMRDKSFPRSPEQCKCKWKNLVTR  100

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+ +   +++++P++ DM +I +
Sbjct  101  FKGCETMEAETARQQFPFYDDMQNIFT  127



>gb|KJB25060.1| hypothetical protein B456_004G174900 [Gossypium raimondii]
Length=261

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE ++LI +RGEL   F   K    LW+ +S+ +   G +R+P QCKS W +L+ +
Sbjct  6    QWGQEETRELIFIRGELERDFTAAKHNKTLWEIVSARMKDRGYTRTPDQCKSKWKNLLNR  65

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D ++  ++P+F++++++ ++
Sbjct  66   YKGKETSDPENGCQFPFFEELHAVFTE  92



>ref|NP_181360.1| trihelix transcription factor GT-3b [Arabidopsis thaliana]
 sp|O80450.1|TGT3B_ARATH RecName: Full=Trihelix transcription factor GT-3b; AltName: Full=Transcription 
factor GT-1-like; AltName: Full=Trihelix DNA-binding 
protein GT-3b [Arabidopsis thaliana]
 gb|AAL50816.1|AF453582_1 GT-1 like transcription factor [Arabidopsis thaliana]
 gb|AAC27174.1| putative GT-1-like transcription factor [Arabidopsis thaliana]
 gb|AEC09513.1| trihelix transcription factor GT-3b [Arabidopsis thaliana]
Length=289

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+ IS+ +      RSP QCK  W +LV +
Sbjct  41   QWSVEETKELIGIRGELDQTFMETKRNKLLWEVISNKMRDKSFPRSPEQCKCKWKNLVTR  100

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+ +   +++++P++ DM +I +
Sbjct  101  FKGCETMEAETARQQFPFYDDMQNIFT  127



>ref|XP_010505443.1| PREDICTED: trihelix transcription factor GT-3b isoform X1 [Camelina 
sativa]
 ref|XP_010505444.1| PREDICTED: trihelix transcription factor GT-3b isoform X2 [Camelina 
sativa]
Length=296

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+ IS+ +      RSP QCK  W +LV +
Sbjct  46   QWSVEETKELIGIRGELDQTFMETKRNKLLWEVISNKMRDKSFPRSPEQCKCKWKNLVTR  105

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+ +   +++++P++ DM +I +
Sbjct  106  FKGCETMEAEIARQQFPFYDDMQTIFT  132



>ref|XP_002879733.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55992.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=291

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+ IS+ +      RSP QCK  W +LV +
Sbjct  42   QWSVEETKELIGIRGELDQTFMETKRNKLLWEVISNKMRDKSFPRSPEQCKCKWKNLVTR  101

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+ +   +++++P++ DM  I +
Sbjct  102  FKGCETMEAETARQQFPFYDDMQIIFT  128



>ref|XP_002519887.1| transcription factor, putative [Ricinus communis]
 gb|EEF42491.1| transcription factor, putative [Ricinus communis]
Length=286

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL   F V K   ALW+ +S  +   G  R+P QCK  W +L+ +
Sbjct  36   QWGEEETKELIGIRGELEKDFTVAKRNKALWEIVSVKMRERGYHRTPPQCKCKWKNLINR  95

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D  +    P+F++++++ ++
Sbjct  96   YKGKETSDPDNGLHCPFFEELHAVFTE  122



>ref|XP_002989909.1| hypothetical protein SELMODRAFT_428458 [Selaginella moellendorffii]
 gb|EFJ08922.1| hypothetical protein SELMODRAFT_428458 [Selaginella moellendorffii]
Length=553

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            WK  EV +LIK+RGE+ +KF     R ALW E++  L + GI R   QC+  W  L+ +Y
Sbjct  457  WKRTEVLQLIKLRGEMENKFTKSTRRAALWDEVADLLKAQGIKRDGKQCREKWDKLMAEY  516

Query  551  EESKKDRKSQEKWPYFKDMNSILS  480
            ++    ++ + +  YF ++ +I++
Sbjct  517  KDVADGKRERGESHYFAELTAIVT  540


 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 42/84 (50%), Gaps = 0/84 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W   E  KLI++R EL  +F     +  LW EI+ +L  +   R   QC+  W  L   Y
Sbjct  175  WTRPETLKLIRLRTELEPRFARTGRKTELWDEIAESLQRERFCRDAQQCRDKWEKLTAGY  234

Query  551  EESKKDRKSQEKWPYFKDMNSILS  480
            +E +   K +E  P++ ++  +LS
Sbjct  235  KEVRDGVKEREDNPFYDELYPLLS  258



>emb|CDY07745.1| BnaA03g17660D [Brassica napus]
Length=294

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+ +S+ +      RSP QCK  W +LV +
Sbjct  44   QWSLEETKELIAIRGELDQTFMETKRNKLLWEVVSNKMRDKSFLRSPEQCKCKWKNLVTR  103

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+     +++++P++ DM+ I +
Sbjct  104  FKGCETMDAESARQQFPFYDDMDIIFT  130



>ref|XP_002968660.1| hypothetical protein SELMODRAFT_409669 [Selaginella moellendorffii]
 gb|EFJ29776.1| hypothetical protein SELMODRAFT_409669 [Selaginella moellendorffii]
Length=552

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            WK  EV +LIK+RGE+ +KF     R ALW E++  L + GI R   QC+  W  L+ +Y
Sbjct  456  WKRTEVLQLIKLRGEMENKFTKSTRRAALWDEVADLLKAQGIKRDGKQCREKWDKLMAEY  515

Query  551  EESKKDRKSQEKWPYFKDMNSILS  480
            ++    ++ + +  YF ++ +I++
Sbjct  516  KDVADGKRERGESHYFAELTAIVT  539


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 42/84 (50%), Gaps = 0/84 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W   E  KLI++R EL  +F     +  LW EI+ +L  +   R   QC+  W  L   Y
Sbjct  175  WTRPETLKLIRLRTELEPRFARTGRKTELWDEIAESLQRERFCRDAQQCRDKWEKLTAGY  234

Query  551  EESKKDRKSQEKWPYFKDMNSILS  480
            +E +   K +E  P++ ++  +LS
Sbjct  235  KEVRDGVKEREDNPFYDELYPLLS  258



>ref|XP_010517113.1| PREDICTED: trihelix transcription factor GT-3b-like [Camelina 
sativa]
Length=291

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+ IS+ +      RSP QCK  W +LV +
Sbjct  44   QWTVEETKELIGIRGELDQTFMETKRNKLLWEVISNKMRDKSFPRSPEQCKCKWKNLVTR  103

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+ +   +++++P++ DM  I +
Sbjct  104  FKGCETMEAEIARQQFPFYDDMQIIFT  130



>ref|XP_009130657.1| PREDICTED: trihelix transcription factor GT-3a-like [Brassica 
rapa]
Length=319

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+L+ +R EL+  F   K    LW+ +++ +   G +RS  QCKS W +LV +
Sbjct  46   QWSIEETKELLGIREELDQTFMETKRNKLLWEVVAAKMADKGFARSAEQCKSKWKNLVTR  105

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +   S++++P++ ++ SI +
Sbjct  106  YKACETTEPEASRQQFPFYSEIQSIFT  132



>ref|XP_008802948.1| PREDICTED: trihelix transcription factor GT-3b-like [Phoenix 
dactylifera]
Length=296

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W PEE + LI +RG+L   F V K    +W+ +++ +   G  RS  QCK  W +LV +
Sbjct  45   QWSPEETRDLIAIRGDLERDFNVSKRNKTMWEVVAARMRERGYRRSSEQCKCKWKNLVNR  104

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D ++ ++ P+F++++++ ++
Sbjct  105  YKGKETADPETGKQCPFFEELHAVFTE  131



>emb|CDY11203.1| BnaA03g00390D [Brassica napus]
Length=319

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+L+ +R EL+  F   K    LW+ +++ +   G +RS  QCKS W +LV +
Sbjct  46   QWSIEETKELLGIREELDQTFMETKRNKLLWEVVAAKMADKGFARSAEQCKSKWKNLVTR  105

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +   S++++P++ ++ SI +
Sbjct  106  YKACETTEPEASRQQFPFYSEIQSIFT  132



>ref|XP_009143406.1| PREDICTED: trihelix transcription factor GT-3b-like [Brassica 
rapa]
Length=292

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+ +S+ +      RSP QCK  W +LV +
Sbjct  39   QWSLEETKELIAIRGELDQTFMETKRNKLLWEVVSNKMRDKSFLRSPEQCKCKWKNLVTR  98

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+  +  +++++P++ DM  I +
Sbjct  99   FKGCETMDEEIARQQFPFYDDMQIIFA  125



>ref|XP_010509204.1| PREDICTED: trihelix transcription factor GT-3b-like [Camelina 
sativa]
Length=294

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+ IS+ +      RSP QCK  W +LV +
Sbjct  47   QWSVEETKELIGIRGELDQTFMETKRNKLLWEVISNKMRDKSFPRSPEQCKCKWKNLVTR  106

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+ +   +++++P++ DM  I +
Sbjct  107  FKGCETMEAEIARQQFPFYDDMQIIFT  133



>emb|CDX74901.1| BnaA05g06470D [Brassica napus]
Length=295

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+ +S+ +      RSP QCK  W +LV +
Sbjct  39   QWSLEETKELIAIRGELDQTFMETKRNKLLWEVVSNKMRDKNFLRSPEQCKCKWKNLVTR  98

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+  +  +++++P++ DM  I +
Sbjct  99   FKGCETMDEEIARQQFPFYDDMQIIFA  125



>ref|XP_010268546.1| PREDICTED: trihelix transcription factor GTL1-like [Nelumbo nucifera]
Length=457

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            WK  EV  LIK+R E+  KF     R  LW+E++  L ++G+ R   QC+  W  L+ +Y
Sbjct  348  WKRAEVLLLIKLRTEMEGKFAKSTRRAVLWEEVAQLLCAEGVQRDGKQCREKWDKLMAEY  407

Query  551  EESKKDRKSQEKWPYFKDMNSILS  480
            +E    ++ +   PYF D+ + ++
Sbjct  408  KEVSDGKRDRGDSPYFADLLATVT  431


 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W   E  KLI+ R E+  +F     +  LW EIS  L S+GI R   QCK  W  L   Y
Sbjct  78   WTRIETMKLIRFRSEMQPRFLRGGRKSELWDEISEGLRSEGICRDTQQCKDKWEKLTAGY  137

Query  551  EESKKDRKSQEKWPYFKDMNSILS  480
            +E ++  + ++ +P++ +++ +LS
Sbjct  138  KEVREGIRDKDDYPFYDELDPLLS  161



>emb|CDY14474.1| BnaC03g21210D [Brassica napus]
Length=292

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+ +S+ +      RSP QCK  W +LV +
Sbjct  42   QWSLEETKELIAIRGELDQTFMETKRNKLLWEVVSNKMRVKSFLRSPEQCKCKWKNLVTR  101

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+     +++++P++ DM  I +
Sbjct  102  FKGCETTDAESARQQFPFYDDMEIIFT  128



>ref|XP_009133240.1| PREDICTED: trihelix transcription factor GT-3b-like [Brassica 
rapa]
Length=294

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+LI +RGEL+  F   K    LW+ +S+ +      RSP QCK  W +LV +
Sbjct  44   QWSLEETKELIAIRGELDQTFMETKRNKLLWEVVSNKMRDKSFLRSPEQCKCKWKNLVTR  103

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+     +++++P++ DM  I +
Sbjct  104  FKGCETMDAESARQQFPFYDDMEIIFT  130



>ref|XP_004172573.1| PREDICTED: uncharacterized LOC101212243 [Cucumis sativus]
Length=357

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 58/103 (56%), Gaps = 11/103 (11%)
 Frame = -2

Query  737  NKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQ  558
            ++W  +EV  LIK+RG L SK+Q    +  LW+EIS+ ++  G  RS  +CK  W + + 
Sbjct  109  SRWPKQEVLALIKLRGGLESKYQETGPKGPLWEEISAGMIKMGYKRSSKRCKEKWEN-IN  167

Query  557  KY-----EESKKDRKSQEKWPYFKDMNS-----ILSDLEAPTS  459
            KY     E +KK R+  +  PYF ++++     ILS   A T+
Sbjct  168  KYFKKVKESNKKRREDSKTCPYFNELDALYRKKILSTTAAATA  210



>ref|XP_006356744.1| PREDICTED: trihelix transcription factor GT-1-like isoform X1 
[Solanum tuberosum]
Length=358

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  EE + LI +R E++S F   K    LW +IS  +   G  RSP  C   W +L++++
Sbjct  47   WVQEETRVLIGLRREIDSLFNTSKSNKHLWDQISMKMREKGFDRSPTMCTDKWRNLLKEF  106

Query  551  EESK--KDRKSQEKWPYFKDMNSILSD  477
            +++K  +DR    K  Y+K+++ IL D
Sbjct  107  KKAKQNQDRNGSAKMSYYKEIDEILRD  133



>ref|XP_004252697.1| PREDICTED: trihelix transcription factor GT-1-like isoform X2 
[Solanum lycopersicum]
Length=357

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  EE + LI +R E++S F   K    LW +IS  +   G  RSP  C   W +L++++
Sbjct  51   WVQEETRVLIGLRREIDSLFNTSKSNKHLWDQISMKMREKGFDRSPTMCTDKWRNLLKEF  110

Query  551  EESK--KDRKSQEKWPYFKDMNSILSD  477
            +++K  +DR    K  Y+K+++ IL D
Sbjct  111  KKAKQNQDRNGSAKMSYYKEIDEILRD  137



>ref|XP_006356745.1| PREDICTED: trihelix transcription factor GT-1-like isoform X2 
[Solanum tuberosum]
Length=357

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  EE + LI +R E++S F   K    LW +IS  +   G  RSP  C   W +L++++
Sbjct  47   WVQEETRVLIGLRREIDSLFNTSKSNKHLWDQISMKMREKGFDRSPTMCTDKWRNLLKEF  106

Query  551  EESK--KDRKSQEKWPYFKDMNSILSD  477
            +++K  +DR    K  Y+K+++ IL D
Sbjct  107  KKAKQNQDRNGSAKMSYYKEIDEILRD  133



>ref|XP_010314571.1| PREDICTED: trihelix transcription factor GT-1-like isoform X3 
[Solanum lycopersicum]
Length=302

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  EE + LI +R E++S F   K    LW +IS  +   G  RSP  C   W +L++++
Sbjct  51   WVQEETRVLIGLRREIDSLFNTSKSNKHLWDQISMKMREKGFDRSPTMCTDKWRNLLKEF  110

Query  551  EESK--KDRKSQEKWPYFKDMNSILSD  477
            +++K  +DR    K  Y+K+++ IL D
Sbjct  111  KKAKQNQDRNGSAKMSYYKEIDEILRD  137



>ref|XP_006845117.1| hypothetical protein AMTR_s00005p00185670 [Amborella trichopoda]
 gb|ERN06792.1| hypothetical protein AMTR_s00005p00185670 [Amborella trichopoda]
Length=355

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  EE++ LI +R E+++ F   K    LW++ISS +   G  RSP  C   W +L+++Y
Sbjct  46   WIQEEIRTLIGLRREMDTLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEY  105

Query  551  EESK-KDRKSQEKWPYFKDMNSIL  483
            ++S+  DR    K  Y+K++  + 
Sbjct  106  KKSRHHDRGGSAKVSYYKELEDLF  129



>ref|XP_004145967.1| PREDICTED: uncharacterized protein LOC101212243 [Cucumis sativus]
Length=674

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 58/102 (57%), Gaps = 9/102 (9%)
 Frame = -2

Query  737  NKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQ  558
            ++W  +EV  LIK+RG L SK+Q    +  LW+EIS+ ++  G  RS  +CK  W ++ +
Sbjct  426  SRWPKQEVLALIKLRGGLESKYQETGPKGPLWEEISAGMIKMGYKRSSKRCKEKWENINK  485

Query  557  KY----EESKKDRKSQEKWPYFKDMNS-----ILSDLEAPTS  459
             +    E +KK R+  +  PYF ++++     ILS   A T+
Sbjct  486  YFKKVKESNKKRREDSKTCPYFNELDALYRKKILSTTAAATA  527



>gb|ABK23202.1| unknown [Picea sitchensis]
Length=378

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            WK  EV +LIK R E+ S+F     R ALW+E++  L ++GI R   QC+  W  L+ ++
Sbjct  287  WKRAEVLRLIKFRAEMESRFAKSARRAALWEELAELLGAEGIKRDGKQCREKWDKLMAEF  346

Query  551  EESKKDRKSQEKWPYFKDMNSIL  483
            ++    ++ + + PY+ ++ + +
Sbjct  347  KDVSDGKRDRSESPYYAELTATV  369


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W   E  KLI++R E+  +F     +  LW+EI+ +L  + ++R   +C+  W  L   Y
Sbjct  34   WTRAETLKLIRLRAEMEPRFARSGRKSELWEEIAESLRRESVARDAQRCRDKWEKLTASY  93

Query  551  EESKKDRKSQEKWPYFKDMNSILS  480
            +E +  +++++ +P+F +++ +LS
Sbjct  94   KEVRDGQRNRQDFPFFDELDPLLS  117



>ref|XP_008437493.1| PREDICTED: trihelix transcription factor GTL1-like isoform X2 
[Cucumis melo]
Length=523

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = -2

Query  737  NKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQ  558
            ++W  +EV  LIK+RG L SK+Q    +  LW+EIS+ ++  G  RS  +CK  W ++ +
Sbjct  354  SRWPKQEVLALIKLRGGLESKYQETGPKGPLWEEISAGMIKMGYKRSAKRCKEKWENINK  413

Query  557  KY----EESKKDRKSQEKWPYFKDMNSI  486
             +    E +KK R+  +  PYF +++++
Sbjct  414  YFKKVKESNKKRREDSKTCPYFNELDAL  441



>ref|XP_010044755.1| PREDICTED: trihelix transcription factor GT-1-like [Eucalyptus 
grandis]
 gb|KCW86866.1| hypothetical protein EUGRSUZ_B03456 [Eucalyptus grandis]
Length=409

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI +R E++S F   K    LW++ISS +   G  RSP  C   W +L+++Y
Sbjct  101  WVQDETRCLIALRREMDSLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEY  160

Query  551  EESKKDRKSQEKWPYFKDMNSIL  483
            +++K   +   K  Y+K++  IL
Sbjct  161  KKAKYQDRGSAKMSYYKEIEEIL  183



>ref|XP_008437492.1| PREDICTED: trihelix transcription factor GTL1-like isoform X1 
[Cucumis melo]
Length=578

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 53/89 (60%), Gaps = 6/89 (7%)
 Frame = -2

Query  737  NKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQ  558
            ++W  +EV  LIK+RG L SK+Q    +  LW+EIS+ ++  G  RS  +CK  W + + 
Sbjct  354  SRWPKQEVLALIKLRGGLESKYQETGPKGPLWEEISAGMIKMGYKRSAKRCKEKWEN-IN  412

Query  557  KY-----EESKKDRKSQEKWPYFKDMNSI  486
            KY     E +KK R+  +  PYF +++++
Sbjct  413  KYFKKVKESNKKRREDSKTCPYFNELDAL  441



>ref|XP_010314570.1| PREDICTED: trihelix transcription factor GT-1-like isoform X1 
[Solanum lycopersicum]
Length=364

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  EE + LI +R E++S F   K    LW +IS  +   G  RSP  C   W +L++++
Sbjct  51   WVQEETRVLIGLRREIDSLFNTSKSNKHLWDQISMKMREKGFDRSPTMCTDKWRNLLKEF  110

Query  551  EESK--KDRKSQEKWPYFKDMNSILSD  477
            +++K  +DR    K  Y+K+++ IL D
Sbjct  111  KKAKQNQDRNGSAKMSYYKEIDEILRD  137



>gb|KFK24646.1| hypothetical protein AALP_AA8G006700 [Arabis alpina]
Length=325

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+L+ +R EL+  F   K    LW+ +++ +   G  RSP QCKS W +LV +
Sbjct  50   QWSIDETKQLLGIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSPEQCKSKWKNLVTR  109

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +    ++++P++ ++ +I +
Sbjct  110  YKACETTEPEAIRQQFPFYNEIQAIFA  136



>emb|CDY10496.1| BnaCnng03970D [Brassica napus]
Length=317

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+L+ +R EL+  F   K    LW+ +++ +   G +R+  QCKS W +LV +
Sbjct  48   QWSLEETKELLGIREELDQTFMETKRNKLLWEVVAAKMADKGFARTAEQCKSKWKNLVTR  107

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +    ++++PY+ ++ SI +
Sbjct  108  YKACETTEPEAIRQQFPYYNEIQSIFT  134



>ref|XP_007158125.1| hypothetical protein PHAVU_002G126400g [Phaseolus vulgaris]
 gb|ESW30119.1| hypothetical protein PHAVU_002G126400g [Phaseolus vulgaris]
Length=309

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E ++ I +R EL   F   K    LW+ +SS +   G  RSP QCK  W +LV +
Sbjct  48   QWSQQETREFIAIRAELERDFTASKRNKTLWEVVSSKMRERGFRRSPEQCKCKWKNLVNR  107

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILS  480
            Y+ +   D +   + P+F++++++ +
Sbjct  108  YKGKETSDPEHSRQCPFFEELHAVFT  133



>ref|XP_004302587.1| PREDICTED: trihelix transcription factor GT-3b [Fragaria vesca 
subsp. vesca]
 ref|XP_011466470.1| PREDICTED: trihelix transcription factor GT-3b [Fragaria vesca 
subsp. vesca]
Length=315

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+LI +R EL+  F   K    LW+ I++ +   G +RS  QCK  W +LV +
Sbjct  63   QWSLQETKELITIRAELDQTFMETKRNKQLWEVIATQMKDKGHNRSAEQCKCKWKNLVTR  122

Query  554  YE--ESKKDRKSQEKWPYFKDMNSIL  483
            Y+  E+ +    ++++P+F D+ +I+
Sbjct  123  YKGCETAEAETMRQQFPFFNDLATIM  148



>ref|XP_003612572.1| Zinc finger and SCAN domain-containing protein [Medicago truncatula]
 gb|AES95530.1| trihelix transcription factor GT-3a-like protein [Medicago truncatula]
Length=302

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E ++ I +R EL   F   K    LW+ +SS +   G  RSP QCK  W +LV +
Sbjct  45   QWSQQETREFIAIRAELERDFTASKRNKTLWEVVSSKMRERGYRRSPEQCKCKWKNLVNR  104

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D +  ++ P+F++++++ ++
Sbjct  105  YKGKETSDPEHGKQCPFFEELHAVFTE  131



>ref|XP_009129574.1| PREDICTED: trihelix transcription factor GT-4 [Brassica rapa]
Length=393

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI +R E++  F   K    LW+EISS +   G  RSP  C   W +L++++
Sbjct  75   WVQDETRILIALRREMDGLFNTSKSNKHLWEEISSKMREKGFDRSPAMCTDKWRNLLKEF  134

Query  551  EESKKDRKSQEKWPYFKDMNSIL  483
            +++ KD++   K  ++K++  +L
Sbjct  135  KKAAKDQQVSGKMSHYKEIEDLL  157



>ref|XP_007133883.1| hypothetical protein PHAVU_010G000200g [Phaseolus vulgaris]
 gb|ESW05877.1| hypothetical protein PHAVU_010G000200g [Phaseolus vulgaris]
Length=271

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+ + +R EL+  F   K    LW+ IS+ +   G  RS  QCK  W +LV +
Sbjct  34   QWSIQETKEFLVIRAELDQTFMETKRNKQLWEVISTRMKEKGYHRSAEQCKCKWKNLVTR  93

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +   +++++P++ + N+I +
Sbjct  94   YKGFETMEQEATRQQFPFYNEFNAIFT  120



>emb|CDX99735.1| BnaC02g35850D [Brassica napus]
Length=399

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI +R E++  F   K    LW+EISS +   G  RSP  C   W +L++++
Sbjct  79   WVQDETRILIALRREMDGLFNTSKSNKHLWEEISSKMREKGFDRSPAMCTDKWRNLLKEF  138

Query  551  EESKKDRKSQEKWPYFKDMNSIL  483
            +++ KD++   K  ++K++  +L
Sbjct  139  KKAAKDQQVSGKMSHYKEIEDLL  161



>ref|XP_010423949.1| PREDICTED: trihelix transcription factor GT-3a-like [Camelina 
sativa]
Length=325

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+L+ +R EL+  F   K    LW+ +++ +   G  RSP QCKS W +LV +
Sbjct  48   QWSIEETKELLGIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSPEQCKSKWKNLVTR  107

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +    ++++P+  ++ SI +
Sbjct  108  YKACETTEPDAIRQQFPFHNEIQSIFA  134



>emb|CDY40984.1| BnaA02g27740D [Brassica napus]
Length=393

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI +R E++  F   K    LW+EISS +   G  RSP  C   W +L++++
Sbjct  73   WVQDETRILIALRREMDGLFNTSKSNKHLWEEISSKMREKGFDRSPAMCTDKWRNLLKEF  132

Query  551  EESKKDRKSQEKWPYFKDMNSIL  483
            +++ KD++   K  ++K++  +L
Sbjct  133  KKAAKDQQVSGKMSHYKEIEDLL  155



>ref|XP_010490572.1| PREDICTED: trihelix transcription factor GT-3a [Camelina sativa]
Length=323

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+L+ +R EL+  F   K    LW+ +++ +   G  RSP QCKS W +LV +
Sbjct  50   QWSIEETKELLGIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSPEQCKSKWKNLVTR  109

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +    ++++P+  ++ SI +
Sbjct  110  YKACETTEPDAIRQQFPFHNEIQSIFA  136



>ref|XP_001777670.1| predicted protein [Physcomitrella patens]
 gb|EDQ57572.1| predicted protein [Physcomitrella patens]
Length=627

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            WK  EV +LIK+RGE++S+F     R ALW E++  LL  GI R   QC+  W  L+ +Y
Sbjct  425  WKRAEVLQLIKLRGEMDSRFAHSTRRAALWDELAERLLVQGIKRDGKQCREKWDKLMAEY  484

Query  551  EE  546
            ++
Sbjct  485  KD  486


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W   E  +LI++R +L  +F     +  LW EI+  L  +  +R   QC+  W  L   Y
Sbjct  155  WTRPESLQLIRLRTQLEPRFAKSGRKTELWDEIAEALQKENFTRDAQQCRDKWEKLTAGY  214

Query  551  EESKKDRKSQEKWPYFKDMNSILS  480
            +E +   K +E  P++ D++S+LS
Sbjct  215  KEVRDGIKDKEDNPFYDDLHSLLS  238



>ref|XP_010104264.1| Trihelix transcription factor GT-3b [Morus notabilis]
 gb|EXB99431.1| Trihelix transcription factor GT-3b [Morus notabilis]
Length=292

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+L+ +R EL+  F   K    LW+ I++ +   G +RSP QCK  W +LV +
Sbjct  41   QWSMQETKELLMIRAELDQTFMETKRNKLLWEVIANKMKEKGFNRSPEQCKCKWKNLVTR  100

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +    ++++P++ ++ +I +
Sbjct  101  YKGCETMEAETVRQQFPFYNELQAIFT  127



>ref|XP_006854232.1| hypothetical protein AMTR_s00048p00225900 [Amborella trichopoda]
 gb|ERN15699.1| hypothetical protein AMTR_s00048p00225900 [Amborella trichopoda]
Length=307

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E +  I +R EL   F   K    LWQ ++S +   G  RSP QCK  W +LV +
Sbjct  56   QWSHQETRDFIAIRAELERDFTQTKRNKTLWQAVASKMKERGYRRSPEQCKCKWKNLVNR  115

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D +S  + P+++++ +I ++
Sbjct  116  YKGKETSDPESGRQCPFYEELQAIFTE  142



>ref|XP_004512362.1| PREDICTED: trihelix transcription factor GT-3b-like [Cicer arietinum]
Length=304

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E ++ I +R EL   F   K    LW+ +SS +   G  RSP QCK  W +LV +
Sbjct  49   QWSQQETREFIAIRAELERDFTASKRNKTLWEVVSSKMRERGYRRSPEQCKCKWKNLVNR  108

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILS  480
            Y+ +   D +  ++ P+F++++++ +
Sbjct  109  YKGKETSDPEHGKQCPFFEELHAVFT  134



>ref|XP_010056151.1| PREDICTED: trihelix transcription factor GT-3b-like [Eucalyptus 
grandis]
Length=310

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  EE ++ I++R EL   F   K    LW+ +S  +   G  R+P QCK  W +L+ +Y
Sbjct  51   WSQEETREFIRIRAELERDFTAAKRNKNLWEIVSGRMKERGYRRTPEQCKCKWKNLLNRY  110

Query  551  E-ESKKDRKSQEKWPYFKDMNSIL  483
            + +   D  S+ K P+F++++++ 
Sbjct  111  KGKETSDPDSERKCPFFEELHALF  134



>ref|XP_004951198.1| PREDICTED: trihelix transcription factor GTL1-like [Setaria italica]
Length=710

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 53/93 (57%), Gaps = 4/93 (4%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            M+ ++W   EV+ LI++R  L  +FQ    +  LW+E+SS + + G  RS  +CK  W +
Sbjct  521  MSTSRWPKHEVEALIRVRTGLEGRFQEPGLKGPLWEEVSSRMAAAGYGRSAKRCKEKWEN  580

Query  566  L---VQKYEESKKDRKSQEK-WPYFKDMNSILS  480
            +    +K +ES K R +  K  PYF +++ + S
Sbjct  581  INKYFRKAKESGKKRPAHAKTCPYFDELDRLYS  613



>ref|XP_010553239.1| PREDICTED: trihelix transcription factor GT-3b isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010553240.1| PREDICTED: trihelix transcription factor GT-3b isoform X2 [Tarenaya 
hassleriana]
Length=300

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K++I +R EL+  F   K    LW+ +S+ +   G  RSP QCK  W +L  +
Sbjct  39   QWSVEETKEMIGIRAELDQTFMETKRNKLLWEVVSNKMRDKGFLRSPEQCKCKWKNLFTR  98

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+ +   +++++P++ DM  I +
Sbjct  99   FKGCETMEPEMARQQFPFYDDMQVIFT  125



>gb|KCW72754.1| hypothetical protein EUGRSUZ_E01205 [Eucalyptus grandis]
Length=293

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  EE ++ I++R EL   F   K    LW+ +S  +   G  R+P QCK  W +L+ +Y
Sbjct  34   WSQEETREFIRIRAELERDFTAAKRNKNLWEIVSGRMKERGYRRTPEQCKCKWKNLLNRY  93

Query  551  E-ESKKDRKSQEKWPYFKDMNSIL  483
            + +   D  S+ K P+F++++++ 
Sbjct  94   KGKETSDPDSERKCPFFEELHALF  117



>ref|XP_010553241.1| PREDICTED: trihelix transcription factor GT-3b isoform X3 [Tarenaya 
hassleriana]
Length=277

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K++I +R EL+  F   K    LW+ +S+ +   G  RSP QCK  W +L  +
Sbjct  16   QWSVEETKEMIGIRAELDQTFMETKRNKLLWEVVSNKMRDKGFLRSPEQCKCKWKNLFTR  75

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            ++  E+ +   +++++P++ DM  I +
Sbjct  76   FKGCETMEPEMARQQFPFYDDMQVIFT  102



>ref|XP_003516496.1| PREDICTED: trihelix transcription factor GT-3b-like [Glycine 
max]
Length=308

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E ++ I +R EL   F   K    LW+ +S+ +   G  RSP QCK  W +LV +
Sbjct  49   QWSQQETREFIAIRAELERDFTASKRNKTLWEVVSAKMRERGFRRSPEQCKCKWKNLVNR  108

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILS  480
            Y+ +   D +  ++ P+F++++++ +
Sbjct  109  YKGKETSDPEHGKQCPFFEELHAVFT  134



>emb|CDX80775.1| BnaC03g00290D [Brassica napus]
Length=319

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+L+ +R +L+  F   K    LW+ +++ +   G +RS  QCKS W +LV +
Sbjct  46   QWSIEETKELLGIREDLDQTFMETKRNKLLWEVVAAKMADKGFARSAEQCKSKWKNLVTR  105

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +    ++++P++ ++ SI +
Sbjct  106  YKACETTEPEAIRQQFPFYSEIQSIFT  132



>ref|XP_006398620.1| hypothetical protein EUTSA_v10015815mg [Eutrema salsugineum]
 gb|ESQ40073.1| hypothetical protein EUTSA_v10015815mg [Eutrema salsugineum]
Length=321

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 50/88 (57%), Gaps = 3/88 (3%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+L+ +R EL+  F   K    LW+ +++ +   G  RS  QCKS W +LV +
Sbjct  47   QWSIEETKELLGIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSAEQCKSKWKNLVTR  106

Query  554  Y---EESKKDRKSQEKWPYFKDMNSILS  480
            Y   E ++ +   Q ++P++ ++ SI +
Sbjct  107  YKACETTEPEAIRQGQFPFYNEIQSIFT  134



>ref|XP_010276957.1| PREDICTED: trihelix transcription factor GT-3b-like [Nelumbo 
nucifera]
Length=303

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E +  I +R EL   F V K    LW+ +++ +   G  RSP QCK  W +LV +
Sbjct  48   QWGHQETRDFIAIRAELERDFTVAKRNKTLWEIVAAKMKERGYRRSPDQCKCKWKNLVNR  107

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D ++  + P+F++++++ ++
Sbjct  108  YKGKETSDPENGRQCPFFEELHAVFTE  134



>ref|XP_010644782.1| PREDICTED: trihelix transcription factor GT-3b-like [Vitis vinifera]
Length=317

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K  I +R EL   F + K    LW+ ++S +   G  R+P QCK  W +LV +
Sbjct  49   QWSHQETKDFIAIRAELERDFALTKRNKTLWEAVASKMKEMGYKRTPDQCKCKWKNLVNR  108

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D ++  + P+F+++++I  +
Sbjct  109  YKGKETSDPENGRQCPFFEELHAIFEE  135



>ref|XP_010920848.1| PREDICTED: trihelix transcription factor GT-3b-like [Elaeis guineensis]
Length=260

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 52/88 (59%), Gaps = 3/88 (3%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W   E K+ + +R EL+  F   K    LW+ IS+ L   G +R+P QCKS W +LV +
Sbjct  34   QWSNAETKEFLAVRAELDRSFMETKRNKPLWEAISARLQQKGFTRTPEQCKSKWKNLVTR  93

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILSD  477
            ++  E+ +   S++ +P+ ++M +I S+
Sbjct  94   FKGIEAMEGEGSRQ-FPFHEEMRTIFSE  120



>gb|AFW66827.1| hypothetical protein ZEAMMB73_815554 [Zea mays]
Length=288

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            ++ ++W   EV+ LI++R  L  +FQ    +  LW+E+S+ + + G  RS  +CK  W +
Sbjct  109  LSSSRWPKHEVEALIRVRTGLEGRFQEPGLKGPLWEEVSARMAAAGYGRSAKRCKEKWEN  168

Query  566  L---VQKYEESKKDRKSQEK-WPYFKDMNSILSDL  474
            +    +K +ES K R +  K  PYF +++ + S L
Sbjct  169  INKYFRKAKESGKKRPAHAKTCPYFDELDRLYSRL  203



>ref|NP_195758.1| trihelix transcription factor GT-3a [Arabidopsis thaliana]
 sp|Q9SDW0.1|TGT3A_ARATH RecName: Full=Trihelix transcription factor GT-3a; AltName: Full=Trihelix 
DNA-binding protein GT-3a [Arabidopsis thaliana]
 gb|AAF17610.1|AF206715_1 transcription factor GT-3a [Arabidopsis thaliana]
 emb|CAB81921.1| transcription factor GT-3a [Arabidopsis thaliana]
 gb|AAP13347.1| transcription factor GT-3a [Arabidopsis thaliana]
 gb|ABI49473.1| At5g01380 [Arabidopsis thaliana]
 gb|AED90334.1| trihelix transcription factor GT-3a [Arabidopsis thaliana]
Length=323

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+L+ +R EL+  F   K    LW+ +++ +   G  RS  QCKS W +LV +
Sbjct  51   QWSIEETKELLAIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSAEQCKSKWKNLVTR  110

Query  554  YE--ESKKDRKSQEKWPYFKDMNSIL  483
            Y+  E+ +    ++++P++ ++ SI 
Sbjct  111  YKACETTEPDAIRQQFPFYNEIQSIF  136



>ref|XP_002966488.1| hypothetical protein SELMODRAFT_24518, partial [Selaginella moellendorffii]
 ref|XP_002982030.1| hypothetical protein SELMODRAFT_14382, partial [Selaginella moellendorffii]
 gb|EFJ16698.1| hypothetical protein SELMODRAFT_14382, partial [Selaginella moellendorffii]
 gb|EFJ32515.1| hypothetical protein SELMODRAFT_24518, partial [Selaginella moellendorffii]
Length=213

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W   EV+ LI++R  + +KFQ +  +   W+EIS+ L   G SRS  +CK  W ++ + 
Sbjct  126  RWPRAEVQALIQLRAAMETKFQEVGPKGPFWEEISAGLACQGYSRSAKRCKEKWENINKY  185

Query  554  YEE--SKKDRKSQEKWPYFKDMNSI  486
            Y +  +KK  ++ +  PYF++++ +
Sbjct  186  YRKTSTKKRPENTKTCPYFQELDVL  210



>ref|XP_003522067.2| PREDICTED: trihelix transcription factor GT-3b-like isoform X1 
[Glycine max]
 gb|KHN42520.1| Trihelix transcription factor GT-3b [Glycine soja]
Length=273

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+ + +R EL+  F   K    LW+ IS+ +   G  RS  QCK  W +LV +
Sbjct  38   QWSIQETKEFLVIRAELDQTFMETKRNKQLWEVISNRMKEKGYHRSAEQCKCKWKNLVTR  97

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +   +++++P++ + N+I +
Sbjct  98   YKGFETMEQEATRQQFPFYNEFNAIFT  124



>ref|XP_008789108.1| PREDICTED: LOW QUALITY PROTEIN: trihelix transcription factor 
GT-3b-like [Phoenix dactylifera]
Length=268

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W   E K+ + +R EL+  F   K    LW+ IS+ L   G +R+P QCKS W +LV +
Sbjct  40   QWTHAETKEFLAIRAELDRSFMETKRNKPLWRAISARLEQKGFNRTPEQCKSKWKNLVTR  99

Query  554  YEES-KKDRKSQEKWPYFKDMNSILSD  477
            ++ +   + ++  ++P++++M  I S+
Sbjct  100  FKGTEAAEGEAAXQFPFYEEMRMIFSE  126



>emb|CDP13296.1| unnamed protein product [Coffea canephora]
Length=402

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 2/85 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  EE + LI +R E++S F   K    LW +IS  +   G  RSP  C   W +L++++
Sbjct  86   WVQEETRALISLRREIDSLFNTSKSNKHLWDQISLKMREKGFDRSPTMCTDKWRNLLKEF  145

Query  551  EESKK--DRKSQEKWPYFKDMNSIL  483
            ++ K+  DR    K  Y+K++  IL
Sbjct  146  KKVKQNGDRNGSAKMSYYKEIEEIL  170



>ref|XP_007143537.1| hypothetical protein PHAVU_007G079800g [Phaseolus vulgaris]
 gb|ESW15531.1| hypothetical protein PHAVU_007G079800g [Phaseolus vulgaris]
Length=635

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 55/94 (59%), Gaps = 4/94 (4%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            ++ ++W   EV  LI++R  L +K+Q    +  LW++IS+ +L  G +RS  +CK  W +
Sbjct  441  LSSSRWPKAEVHALIRLRTSLETKYQENGPKAPLWEDISAGMLRIGYNRSAKRCKEKWEN  500

Query  566  L---VQKYEESKKDRKSQEK-WPYFKDMNSILSD  477
            +    +K +ES K R+   K  PYF ++++I  +
Sbjct  501  INKYFKKVKESNKHRRENSKTCPYFNELDAIYKE  534



>ref|XP_010031401.1| PREDICTED: trihelix transcription factor GT-3b [Eucalyptus grandis]
 gb|KCW88127.1| hypothetical protein EUGRSUZ_A00520 [Eucalyptus grandis]
Length=293

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+ + +R +L+ +F   K    LW+ IS+ +   G +RS  QCK  W +LV +
Sbjct  47   QWSVQETKEFLMIRADLDRRFMETKRNKQLWEVISTGMRDKGFNRSAEQCKCKWKNLVTR  106

Query  554  YE--ESKKDRKSQEKWPYFKDMNSIL  483
            Y+  E+ +    ++++PY+ +M +I 
Sbjct  107  YKGCETMEPEAMRQQFPYYNEMQAIF  132



>ref|XP_002870925.1| hypothetical protein ARALYDRAFT_486939 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47184.1| hypothetical protein ARALYDRAFT_486939 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+L+ +R EL+  F   K    LW+ +++ +   G  RS  QCKS W +LV +
Sbjct  48   QWSIEETKELLAIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSAEQCKSKWKNLVTR  107

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +    ++++P++ ++ SI +
Sbjct  108  YKACETSEPDAIRQQFPFYNEIQSIFA  134



>ref|XP_009380688.1| PREDICTED: trihelix transcription factor GT-3b-like [Musa acuminata 
subsp. malaccensis]
Length=246

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E    + +R +L+  F   K    LWQ ISS L   G  R+P QCKS W +LV +
Sbjct  21   QWTHDETMVFLAIRAQLDKSFVETKRNKPLWQAISSLLQQRGFFRTPDQCKSKWKNLVTR  80

Query  554  YEESKK-DRKSQEKWPYFKDMNSILSD  477
            ++ S+  + +   ++P++++M  I SD
Sbjct  81   FKGSESVEGEINRQFPFYEEMRKIFSD  107



>ref|XP_008803970.1| PREDICTED: trihelix transcription factor GT-3b-like [Phoenix 
dactylifera]
Length=299

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E ++LI  RG+L     V +    LW+ +++ +   G  R+P QCK  W +LV +
Sbjct  49   QWSEQETRELIGFRGDLERDLTVARWNKTLWEAVAARMRERGYRRTPDQCKCKWKNLVNR  108

Query  554  YEESK-KDRKSQEKWPYFKDMNSIL  483
            Y++++  D ++  + P+F++++++ 
Sbjct  109  YKDTETADPENGRQCPFFEELHAVF  133



>gb|KJB36923.1| hypothetical protein B456_006G183000 [Gossypium raimondii]
Length=285

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+ + +R EL+  F   K    LW+ IS+ +   G +RS  QCK  W +LV +
Sbjct  39   QWSIQETKEFLMIRAELDRSFMETKRNKLLWEVISTRMREKGFNRSTEQCKCKWKNLVTR  98

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ ++   ++++P++ ++ +I S
Sbjct  99   YKGCETMEEEAMRQQFPFYNELQAIFS  125



>ref|XP_011018396.1| PREDICTED: trihelix transcription factor GT-3b-like [Populus 
euphratica]
Length=296

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = -2

Query  719  EVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKYE-ES  543
            E K+ I +R EL   F V K    LW+ +S+ +   G  R+P QCK  W +LV +Y+ + 
Sbjct  46   ETKEFIGIRAELEKDFTVTKRNKTLWEIVSAKMREKGYRRTPEQCKCKWKNLVNRYKGKE  105

Query  542  KKDRKSQEKWPYFKDMNSILSD  477
              D ++  + P+F++++++ ++
Sbjct  106  TSDPETGRQCPFFEELHAVFTE  127



>ref|XP_010528062.1| PREDICTED: trihelix transcription factor GT-1-like isoform X1 
[Tarenaya hassleriana]
Length=395

 Score = 57.0 bits (136),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI  R E++S F   K    LW++ISS +   G  RSP  C   W +L++++
Sbjct  83   WVQDETRSLIAFRREMDSLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEF  142

Query  551  EESK-KDRKS-QEKWPYFKDMNSIL  483
            +++K +DR S   K  Y+K+++ IL
Sbjct  143  KKAKHQDRGSGSTKISYYKEIDEIL  167



>ref|XP_010528063.1| PREDICTED: trihelix transcription factor GT-1-like isoform X2 
[Tarenaya hassleriana]
Length=394

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI  R E++S F   K    LW++ISS +   G  RSP  C   W +L++++
Sbjct  83   WVQDETRSLIAFRREMDSLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEF  142

Query  551  EESK-KDRKS-QEKWPYFKDMNSIL  483
            +++K +DR S   K  Y+K+++ IL
Sbjct  143  KKAKHQDRGSGSTKISYYKEIDEIL  167



>ref|XP_008373496.1| PREDICTED: trihelix transcription factor GT-3b-like [Malus domestica]
Length=288

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = -2

Query  737  NKWKPEEVKKLIKMRGELNSKFQVLKGR-MALWQEISSNLLSDGISRSPGQCKSLWASLV  561
             +W  EE ++LI +RGEL  +  V+  R    W+ +SS +   G +R+P QCK  W +L+
Sbjct  37   GQWASEETRELIAIRGELEIRDSVVSKRSKPQWEAVSSKMTERGFNRTPEQCKCKWKNLL  96

Query  560  QKYE-ESKKDRKSQEKWPYFKDMNSILSD  477
             +Y+ +   D +S  + P+F++++++ ++
Sbjct  97   IRYKGKETSDPESGRECPFFEELHAVFTE  125



>gb|KHN34752.1| Trihelix transcription factor GT-3a [Glycine soja]
Length=246

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+ + +R EL+  F   K    LW+ IS+ +   G  RS  QCK  W +LV +
Sbjct  11   QWSIQETKEFLVIREELDQTFMETKRNKQLWEVISNRMKEKGYHRSAEQCKCKWKNLVTR  70

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +   +++++P++ + N+I +
Sbjct  71   YKGFETMEQEATRQQFPFYNEFNAIFT  97



>gb|AFW66826.1| hypothetical protein ZEAMMB73_815554 [Zea mays]
Length=714

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            ++ ++W   EV+ LI++R  L  +FQ    +  LW+E+S+ + + G  RS  +CK  W +
Sbjct  535  LSSSRWPKHEVEALIRVRTGLEGRFQEPGLKGPLWEEVSARMAAAGYGRSAKRCKEKWEN  594

Query  566  L---VQKYEESKKDRKSQEK-WPYFKDMNSILSDL  474
            +    +K +ES K R +  K  PYF +++ + S L
Sbjct  595  INKYFRKAKESGKKRPAHAKTCPYFDELDRLYSRL  629



>ref|XP_002279929.1| PREDICTED: trihelix transcription factor GTL1-like [Vitis vinifera]
Length=660

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 4/89 (4%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASL---  564
            +W   EV+ LI++R  L S+FQ    +  LW+EISS++ S G  RS  +CK  W ++   
Sbjct  462  RWPKAEVQALIQVRSRLESRFQEPGLKGPLWEEISSSMTSMGYQRSAKRCKEKWENINKY  521

Query  563  VQKYEESKKDRKSQEK-WPYFKDMNSILS  480
             +K ++S K R  Q K  PYF  ++ + S
Sbjct  522  FRKTKDSAKKRSHQSKTCPYFHQLDQLYS  550



>ref|XP_007019487.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY16712.1| Duplicated homeodomain-like superfamily protein, putative [Theobroma 
cacao]
Length=569

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 56/107 (52%), Gaps = 4/107 (4%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W   EV+ LI++R  LN K+Q    +  LW+EIS+ +   G SRS  +CK  W ++ + 
Sbjct  387  RWPKAEVQALIRLRTNLNVKYQENGPKAPLWEEISAGMRKLGYSRSAKRCKEKWENINKY  446

Query  554  Y----EESKKDRKSQEKWPYFKDMNSILSDLEAPTSK**GNVGRAVK  426
            +    E SKK  +  +  PYF  +++I  +  +      G+ G  VK
Sbjct  447  FKKVKESSKKRSEDSKTCPYFHQLDAIYKEKISKNENSVGSSGYGVK  493



>ref|XP_003516961.1| PREDICTED: trihelix transcription factor GT-3b-like [Glycine 
max]
Length=272

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+ + +R EL+  F   K    LW+ IS+ +   G  RS  QCK  W +LV +
Sbjct  37   QWSIQETKEFLVIREELDQTFMETKRNKQLWEVISNRMKEKGYHRSAEQCKCKWKNLVTR  96

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +   +++++P++ + N+I +
Sbjct  97   YKGFETMEQEATRQQFPFYNEFNAIFT  123



>ref|XP_006288194.1| hypothetical protein CARUB_v10001432mg [Capsella rubella]
 gb|EOA21092.1| hypothetical protein CARUB_v10001432mg [Capsella rubella]
Length=328

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+L+ +R EL+  F   K    LW+ +++ +   G  RS  QCKS W +LV +
Sbjct  53   QWSIEETKELLGIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSAEQCKSKWKNLVTR  112

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +    ++ +P++ ++ SI +
Sbjct  113  YKACETTEPDAIRQHFPFYNEIQSIFA  139



>ref|XP_010250844.1| PREDICTED: trihelix transcription factor GT-1 [Nelumbo nucifera]
Length=378

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  EE + LI +R E++S F   K    LW++IS+ +   G  RSP  C   W +L++++
Sbjct  65   WVQEETRSLISLRREMDSLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEF  124

Query  551  EESKKDRK--SQEKWPYFKDMNSILSD  477
            +++K   +     K  Y+K++  +L D
Sbjct  125  KKAKHQERGSGSAKMSYYKELEELLRD  151



>ref|XP_006432827.1| hypothetical protein CICLE_v10002156mg [Citrus clementina]
 ref|XP_006471559.1| PREDICTED: trihelix transcription factor GT-3b-like [Citrus sinensis]
 gb|ESR46067.1| hypothetical protein CICLE_v10002156mg [Citrus clementina]
 gb|KDO47827.1| hypothetical protein CISIN_1g024274mg [Citrus sinensis]
Length=270

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE + LI +RGE       +K    +W+ +S  L   G SR+P QCK  W +LV +
Sbjct  15   QWGNEETRDLIVIRGETERDLVGIKRNKTIWEIVSVKLRERGYSRTPDQCKCKWKNLVNR  74

Query  554  YE-ESKKDRKSQEKWPYFKDMNSILSD  477
            Y+ +   D  S  + P+F +++++ ++
Sbjct  75   YKGKETSDPDSGRQCPFFNELHAVFTE  101



>ref|XP_010451994.1| PREDICTED: trihelix transcription factor GT-3a [Camelina sativa]
Length=322

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K+L+ +R EL+  F   K    LW+ +++ +      RSP QCKS W +LV +
Sbjct  48   QWSIEETKELLGIREELDQTFMETKRNKLLWEVVAAKMADKSFVRSPEQCKSKWKNLVTR  107

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +    ++++P+  ++ SI +
Sbjct  108  YKACETTEPDAIRQQFPFHNEIQSIFA  134



>ref|XP_002315635.2| DNA-binding protein GT-1 [Populus trichocarpa]
 gb|EEF01806.2| DNA-binding protein GT-1 [Populus trichocarpa]
Length=384

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI +R E++  F   K    LW++IS+ +   G  RSP  C   W +L++++
Sbjct  75   WVQDETRSLIGLRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEF  134

Query  551  EESK-KDRKS-QEKWPYFKDMNSIL  483
            +++K KDR S   K  Y+K+++ IL
Sbjct  135  KKAKHKDRGSGSAKMSYYKEIDEIL  159



>ref|XP_010278875.1| PREDICTED: trihelix transcription factor GT-3b-like [Nelumbo 
nucifera]
Length=306

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E +  I +R EL   F V K    LW+ +++ +   G  R+P QCK  W +LV +
Sbjct  47   QWGHQETRDFIAIRAELERDFTVAKRNKTLWEIVAAKMKERGYRRTPDQCKCKWKNLVNR  106

Query  554  YE-ESKKDRKSQEKWPYFKDMNSIL  483
            Y+ +   D ++  + P+F++++++ 
Sbjct  107  YKGKETSDPENGRQCPFFEEIHAVF  131



>ref|XP_004514215.1| PREDICTED: trihelix transcription factor GT-3b-like [Cicer arietinum]
Length=291

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+ + +R EL+  F   K    LW+ IS+ +   G  RSP QCK  W +LV +
Sbjct  48   QWSIQETKEFLMIRSELDQTFMETKRNKLLWEVISNKMKEKGYLRSPEQCKCKWKNLVTR  107

Query  554  YEESKK-DRKSQEKWPYFKDMNSILS  480
            Y+  +  + +S++++P++ ++ +I +
Sbjct  108  YKGCETMELESRQQFPFYNELQAIFT  133



>ref|XP_008795368.1| PREDICTED: trihelix transcription factor GT-3b [Phoenix dactylifera]
Length=256

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W   E K+ + +R E +  F   K    LW+ IS+ L   G +R+P QCKS W +LV +
Sbjct  35   QWTHAETKEFLAVRAEFDRSFMETKRNKPLWEAISARLRQKGFNRTPEQCKSKWKNLVSR  94

Query  554  YEESKK-DRKSQEKWPYFKDMNSILS  480
            ++  +  D +   ++P+ +++ +I S
Sbjct  95   FKGIEAMDGEGSRQFPFLEELRTIFS  120



>ref|XP_008681430.1| PREDICTED: uncharacterized protein LOC100273304 isoform X1 [Zea 
mays]
 gb|AFW69719.1| hypothetical protein ZEAMMB73_999729 [Zea mays]
Length=664

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = -2

Query  737  NKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASL--  564
            ++W   EV+ LI++R  L  +FQ L  +  LW+E+S+ + + G  R+  +CK  W ++  
Sbjct  494  SRWPKHEVEALIRVRTGLEGRFQELGLKGPLWEEVSARMAAAGYGRNAKRCKEKWENINK  553

Query  563  -VQKYEESKKDRKSQEK-WPYFKDMNSILS  480
              +K +ES K R +  K  PYF +++ + S
Sbjct  554  YFRKAKESGKKRPAHAKTCPYFDELDRLYS  583



>ref|XP_002453128.1| hypothetical protein SORBIDRAFT_04g000520 [Sorghum bicolor]
 gb|EES06104.1| hypothetical protein SORBIDRAFT_04g000520 [Sorghum bicolor]
Length=740

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 53/93 (57%), Gaps = 4/93 (4%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            ++ ++W   EV+ LI++R  L  +FQ    +  LW+E+S+ + + G  RS  +CK  W +
Sbjct  551  LSTSRWPKHEVEALIRVRTGLEGRFQEPGLKGPLWEEVSARMAAAGYGRSAKRCKEKWEN  610

Query  566  L---VQKYEESKKDRKSQEK-WPYFKDMNSILS  480
            +    +K +ES K R +  K  PYF +++ + S
Sbjct  611  INKYFRKAKESGKKRPAHAKTCPYFDELDRLYS  643



>ref|XP_006291280.1| hypothetical protein CARUB_v10017413mg, partial [Capsella rubella]
 gb|EOA24178.1| hypothetical protein CARUB_v10017413mg, partial [Capsella rubella]
Length=391

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI +RGE+++ F   K    LW+EIS+ +   G  RSP  C   W ++++++
Sbjct  68   WVQDETRTLISLRGEMDNLFNTSKSNKHLWEEISNKMREKGFDRSPAMCTDKWRNILKEF  127

Query  551  EESK-KDRKSQ----EKWPYFKDMNSIL  483
            +++K +D K+      K  Y+K+++ I 
Sbjct  128  KKAKHQDDKATSGGSAKMSYYKEIDDIF  155



>ref|XP_004506754.1| PREDICTED: trihelix transcription factor GT-3b-like [Cicer arietinum]
Length=276

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  EE K  + +RGEL+  F   K    LW+ I++++  +G  RS  QCK  W +LV +
Sbjct  42   QWSIEETKVFLMLRGELDQAFMETKRNKQLWEVIANHMKENGYYRSAEQCKCKWKNLVTR  101

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+      + ++P++ ++ +I +
Sbjct  102  YKGCETMDTEVLRHQFPFYNELQAIFT  128



>ref|NP_001236549.1| GT-1 [Glycine max]
 gb|ABX79677.1| GT-1 [Glycine max]
Length=376

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI +R E++S F   K    LW++IS+ +   G  RSP  C   W +L++++
Sbjct  66   WVQDETRSLIGLRREMDSLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEF  125

Query  551  EESK-KDRKS-QEKWPYFKDMNSIL  483
            +++K +DR S   K  Y+K+++ IL
Sbjct  126  KKAKHQDRGSGSAKMSYYKEIDEIL  150



>emb|CDY04841.1| BnaAnng00230D [Brassica napus]
Length=310

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+L+ +R EL+  F   K    LW+ + + +   G +RS  QCKS W +LV +
Sbjct  45   QWSIDETKELLGIREELDQTFMETKRNKLLWEVVVAKMADKGFARSAEQCKSKWKNLVSR  104

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +    ++++P++ ++ SI +
Sbjct  105  YKVCETTEPEPIRQQFPFYNEIQSIFT  131



>ref|XP_006601714.1| PREDICTED: GT-1 isoform X1 [Glycine max]
Length=332

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI +R E++S F   K    LW++IS+ +   G  RSP  C   W +L++++
Sbjct  66   WVQDETRSLIGLRREMDSLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEF  125

Query  551  EESK-KDRKS-QEKWPYFKDMNSIL  483
            +++K +DR S   K  Y+K+++ IL
Sbjct  126  KKAKHQDRGSGSAKMSYYKEIDEIL  150



>ref|XP_009125422.1| PREDICTED: trihelix transcription factor GT-3a-like [Brassica 
rapa]
Length=310

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E K+L+ +R EL+  F   K    LW+ + + +   G +RS  QCKS W +LV +
Sbjct  45   QWSIDETKELLGIREELDQTFMETKRNKLLWEVVVAKMADKGFARSAEQCKSKWKNLVSR  104

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILS  480
            Y+  E+ +    ++++P++ ++ SI +
Sbjct  105  YKVCETTEPEPIRQQFPFYNEIQSIFT  131



>ref|XP_009414373.1| PREDICTED: LOW QUALITY PROTEIN: trihelix transcription factor 
GT-3b-like, partial [Musa acuminata subsp. malaccensis]
Length=248

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 51/88 (58%), Gaps = 3/88 (3%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQK  555
            +W  +E ++L+ +R +L+  F   K    LW+  SS L   G  R+P QCKS W +LV +
Sbjct  15   QWTHDETRELLAIRAQLDRSFTETKRNKPLWEATSSMLQQKGFFRTPDQCKSKWKNLVTR  74

Query  554  YE--ESKKDRKSQEKWPYFKDMNSILSD  477
            ++  ES +    ++ +P++++M  I +D
Sbjct  75   FKGIESAEGEIGKQ-FPFYEEMRRIFAD  101



>ref|XP_006368276.1| hypothetical protein POPTR_0001s01210g [Populus trichocarpa]
 gb|ERP64845.1| hypothetical protein POPTR_0001s01210g [Populus trichocarpa]
Length=296

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -2

Query  719  EVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKYE-ES  543
            E K+ I +R EL   F V K    LW+ +S  +   G  R+P QCK  W +LV +Y+ + 
Sbjct  46   ETKEFIGIRAELEKDFTVTKRNKTLWEIVSVKMREKGYRRTPEQCKCKWKNLVNRYKGKE  105

Query  542  KKDRKSQEKWPYFKDMNSILSD  477
              D ++  + P+F++++++ ++
Sbjct  106  TSDPETGRQCPFFEELHAVFTE  127



>gb|AFG69715.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69716.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69717.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69718.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69719.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69720.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69721.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69722.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69723.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69724.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69725.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69726.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69727.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69728.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69729.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69730.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
 gb|AFG69731.1| hypothetical protein 2_8611_01, partial [Pinus taeda]
Length=96

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/79 (32%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = -2

Query  719  EVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKYEESK  540
            EV +LIK+RGE++ +F     R ALW+E++  L   G+ R   QC+  W  L+  Y++  
Sbjct  3    EVLQLIKLRGEMDGRFANSARRAALWEELADMLGRQGVKRDGKQCREKWDKLMAAYKDVI  62

Query  539  KDRKSQEKWPYFKDMNSIL  483
              ++ +    YF ++ +I+
Sbjct  63   DGKREEGDLSYFVELRAIV  81



>ref|XP_008794787.1| PREDICTED: trihelix transcription factor GTL1-like [Phoenix dactylifera]
Length=645

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = -2

Query  746  MTRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWAS  567
            ++ ++W   EV+ LI++R  L S+FQ    +  LW+E+SS + + G  RS  +CK  W +
Sbjct  454  LSTSRWPKPEVEALIQVRSGLESRFQEPGLKAPLWEEVSSTMAAMGYHRSAKRCKEKWEN  513

Query  566  L---VQKYEESKKDR-KSQEKWPYFKDMNSILS  480
            +    +K +ES K R ++ +  PYF+ ++ + S
Sbjct  514  INKYFRKTKESGKKRPRNSKTCPYFQQLDQLYS  546



>gb|KDP26752.1| hypothetical protein JCGZ_17910 [Jatropha curcas]
Length=396

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI +R E++  F   K    LW++IS+ +   G  RSP  C   W +L++++
Sbjct  86   WVQDETRSLIALRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEF  145

Query  551  EESK-KDRKS-QEKWPYFKDMNSIL  483
            +++K +DR S   K  Y+K+++ IL
Sbjct  146  KKAKHQDRGSGSAKMSYYKEIDEIL  170



>ref|XP_010250883.1| PREDICTED: trihelix transcription factor GTL1 isoform X1 [Nelumbo 
nucifera]
Length=777

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 50/90 (56%), Gaps = 4/90 (4%)
 Frame = -2

Query  743  TRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASL  564
            T ++W   EV  LIKMR  L S++Q    +  LW+EIS+ +   G +RS  +CK  W ++
Sbjct  508  TSSRWPKAEVHALIKMRSGLESRYQEAGPKGPLWEEISAGMQRMGYNRSAKRCKEKWENI  567

Query  563  ---VQKYEESKKDRKSQEK-WPYFKDMNSI  486
                +K +ES K R    K  PYF  ++++
Sbjct  568  NKYFKKVKESNKKRPEDAKTCPYFHQLDAL  597



>ref|XP_010250890.1| PREDICTED: trihelix transcription factor GTL1 isoform X2 [Nelumbo 
nucifera]
Length=695

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 50/90 (56%), Gaps = 4/90 (4%)
 Frame = -2

Query  743  TRNKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASL  564
            T ++W   EV  LIKMR  L S++Q    +  LW+EIS+ +   G +RS  +CK  W ++
Sbjct  508  TSSRWPKAEVHALIKMRSGLESRYQEAGPKGPLWEEISAGMQRMGYNRSAKRCKEKWENI  567

Query  563  ---VQKYEESKKDRKSQEK-WPYFKDMNSI  486
                +K +ES K R    K  PYF  ++++
Sbjct  568  NKYFKKVKESNKKRPEDAKTCPYFHQLDAL  597



>ref|XP_011029630.1| PREDICTED: trihelix transcription factor GT-1 isoform X1 [Populus 
euphratica]
Length=385

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 8/100 (8%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI  R E++  F   K    LW++IS+ +   G  RSP  C   W +L++++
Sbjct  77   WVQDETRSLIAFRREMDGLFNTSKSNKHLWEQISTKMREKGFDRSPTMCTDKWRNLLKEF  136

Query  551  EESK-KDRKS-QEKWPYFKDMNSIL------SDLEAPTSK  456
            +++K +DR S   K  Y+K+++ IL      S  + PT K
Sbjct  137  KKAKHQDRGSGSAKMSYYKEIDEILRGRNKNSQYKCPTPK  176



>ref|XP_011029631.1| PREDICTED: trihelix transcription factor GT-1 isoform X2 [Populus 
euphratica]
Length=372

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 8/100 (8%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI  R E++  F   K    LW++IS+ +   G  RSP  C   W +L++++
Sbjct  77   WVQDETRSLIAFRREMDGLFNTSKSNKHLWEQISTKMREKGFDRSPTMCTDKWRNLLKEF  136

Query  551  EESK-KDRKS-QEKWPYFKDMNSIL------SDLEAPTSK  456
            +++K +DR S   K  Y+K+++ IL      S  + PT K
Sbjct  137  KKAKHQDRGSGSAKMSYYKEIDEILRGRNKNSQYKCPTPK  176



>ref|XP_011029633.1| PREDICTED: trihelix transcription factor GT-1 isoform X4 [Populus 
euphratica]
Length=326

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 8/100 (8%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI  R E++  F   K    LW++IS+ +   G  RSP  C   W +L++++
Sbjct  77   WVQDETRSLIAFRREMDGLFNTSKSNKHLWEQISTKMREKGFDRSPTMCTDKWRNLLKEF  136

Query  551  EESK-KDRKS-QEKWPYFKDMNSIL------SDLEAPTSK  456
            +++K +DR S   K  Y+K+++ IL      S  + PT K
Sbjct  137  KKAKHQDRGSGSAKMSYYKEIDEILRGRNKNSQYKCPTPK  176



>ref|XP_004496473.1| PREDICTED: trihelix transcription factor GT-2-like [Cicer arietinum]
Length=626

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 52/87 (60%), Gaps = 4/87 (5%)
 Frame = -2

Query  734  KWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASL---  564
            +W   EV+ LI +R EL++K+Q    +  LW+EISS + + G +R+P +CK  W ++   
Sbjct  449  RWPKVEVQALINLRTELDNKYQENGPKGPLWEEISSAMKNLGYNRNPKRCKEKWENINKY  508

Query  563  VQKYEESKKDRKSQEK-WPYFKDMNSI  486
             +K +ES K R    K  PYF  ++++
Sbjct  509  FKKVKESNKKRPEDSKTCPYFHQLDAL  535



>ref|XP_010248872.1| PREDICTED: trihelix transcription factor GT-1-like [Nelumbo nucifera]
Length=379

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -2

Query  731  WKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASLVQKY  552
            W  +E + LI +R E++S F   K    LW++ISS +   G  RSP  C   W +L++++
Sbjct  65   WVQDETRSLISLRREMDSLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEF  124

Query  551  EESK-KDRKS-QEKWPYFKDMNSIL  483
            +++K +DR S   K  Y+K++  +L
Sbjct  125  KKAKHQDRGSGSAKMSYYKELEELL  149



>ref|XP_010062115.1| PREDICTED: trihelix transcription factor GT-2-like isoform X2 
[Eucalyptus grandis]
Length=516

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 4/91 (4%)
 Frame = -2

Query  737  NKWKPEEVKKLIKMRGELNSKFQVLKGRMALWQEISSNLLSDGISRSPGQCKSLWASL--  564
            ++W   EV+ LIK+R +L SK+Q    +  LW+EIS+ +   G +RS  +CK  W ++  
Sbjct  336  SRWPKLEVEALIKLRTDLESKYQENGPKGPLWEEISAAMRKAGYNRSAKRCKEKWENINK  395

Query  563  -VQKYEESKKDRKSQEK-WPYFKDMNSILSD  477
              +K +ES K R    K  PYF  +++I  +
Sbjct  396  YFKKVKESNKQRPEDSKTCPYFHQLDAIYKE  426



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2061751161600