BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038M19

Length=780
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB68026.1|  hypothetical protein B456_010G222500                    305   8e-100   Gossypium raimondii
ref|XP_002527306.1|  ccr4-associated factor, putative                   304   1e-99    Ricinus communis
ref|XP_009605547.1|  PREDICTED: probable CCR4-associated factor 1...    304   1e-99    Nicotiana tomentosiformis
gb|KHG18085.1|  putative CCR4-associated factor 1 -like protein         303   9e-99    Gossypium arboreum [tree cotton]
gb|KDP33530.1|  hypothetical protein JCGZ_07101                         301   1e-98    Jatropha curcas
ref|XP_002515442.1|  ccr4-associated factor, putative                   301   2e-98    
ref|XP_007023404.1|  Polynucleotidyl transferase, ribonuclease H-...    300   2e-98    
ref|XP_011034532.1|  PREDICTED: probable CCR4-associated factor 1...    301   3e-98    Populus euphratica
ref|XP_010089956.1|  putative CCR4-associated factor 1-7-like pro...    301   3e-98    Morus notabilis
gb|KDP41983.1|  hypothetical protein JCGZ_27001                         300   4e-98    Jatropha curcas
ref|XP_007023403.1|  Polynucleotidyl transferase, ribonuclease H-...    300   6e-98    
ref|XP_004235935.1|  PREDICTED: probable CCR4-associated factor 1...    299   9e-98    Solanum lycopersicum
ref|XP_009793121.1|  PREDICTED: probable CCR4-associated factor 1...    299   9e-98    Nicotiana sylvestris
ref|XP_006341359.1|  PREDICTED: probable CCR4-associated factor 1...    298   2e-97    Solanum tuberosum [potatoes]
ref|XP_002272165.1|  PREDICTED: probable CCR4-associated factor 1...    298   3e-97    Vitis vinifera
ref|XP_002324905.2|  hypothetical protein POPTR_0018s02370g             297   6e-97    Populus trichocarpa [western balsam poplar]
gb|KJB68416.1|  hypothetical protein B456_010G244300                    296   1e-96    Gossypium raimondii
ref|XP_011020623.1|  PREDICTED: probable CCR4-associated factor 1...    296   2e-96    Populus euphratica
ref|XP_011036659.1|  PREDICTED: probable CCR4-associated factor 1...    296   3e-96    Populus euphratica
ref|XP_011082241.1|  PREDICTED: probable CCR4-associated factor 1...    295   3e-96    Sesamum indicum [beniseed]
ref|XP_003526204.1|  PREDICTED: probable CCR4-associated factor 1...    295   3e-96    Glycine max [soybeans]
ref|XP_007023407.1|  CCR4-associated factor 1                           298   4e-96    
ref|XP_007023408.1|  Polynucleotidyl transferase, ribonuclease H-...    294   8e-96    Theobroma cacao [chocolate]
gb|KJB66334.1|  hypothetical protein B456_010G136400                    294   8e-96    Gossypium raimondii
ref|XP_007215794.1|  hypothetical protein PRUPE_ppa009874mg             294   8e-96    Prunus persica
ref|XP_009760590.1|  PREDICTED: probable CCR4-associated factor 1...    294   8e-96    Nicotiana sylvestris
ref|XP_007136961.1|  hypothetical protein PHAVU_009G088600g             294   1e-95    Phaseolus vulgaris [French bean]
ref|XP_002309667.1|  hypothetical protein POPTR_0006s27840g             294   1e-95    Populus trichocarpa [western balsam poplar]
gb|KHG16599.1|  putative CCR4-associated factor 1 -like protein         293   1e-95    Gossypium arboreum [tree cotton]
ref|XP_003522433.1|  PREDICTED: probable CCR4-associated factor 1...    293   1e-95    Glycine max [soybeans]
ref|XP_008228784.1|  PREDICTED: probable CCR4-associated factor 1...    293   2e-95    Prunus mume [ume]
gb|KJB55043.1|  hypothetical protein B456_009G061200                    293   2e-95    Gossypium raimondii
ref|XP_002303842.1|  hypothetical protein POPTR_0003s17950g             293   3e-95    
emb|CDO98220.1|  unnamed protein product                                293   4e-95    Coffea canephora [robusta coffee]
ref|XP_010665982.1|  PREDICTED: probable CCR4-associated factor 1...    292   4e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003530297.1|  PREDICTED: probable CCR4-associated factor 1...    292   6e-95    Glycine max [soybeans]
ref|XP_004305482.1|  PREDICTED: probable CCR4-associated factor 1...    292   7e-95    Fragaria vesca subsp. vesca
ref|XP_009594641.1|  PREDICTED: probable CCR4-associated factor 1...    291   9e-95    Nicotiana tomentosiformis
ref|XP_008445259.1|  PREDICTED: probable CCR4-associated factor 1...    291   1e-94    Cucumis melo [Oriental melon]
ref|XP_008375521.1|  PREDICTED: probable CCR4-associated factor 1...    291   2e-94    Malus domestica [apple tree]
ref|XP_010092187.1|  putative CCR4-associated factor 1-7-like pro...    291   2e-94    Morus notabilis
ref|XP_004138705.1|  PREDICTED: probable CCR4-associated factor 1...    289   2e-94    
gb|ACU24625.1|  unknown                                                 290   3e-94    Glycine max [soybeans]
ref|XP_004138704.1|  PREDICTED: probable CCR4-associated factor 1...    290   3e-94    Cucumis sativus [cucumbers]
ref|XP_010648684.1|  PREDICTED: probable CCR4-associated factor 1...    290   3e-94    Vitis vinifera
ref|XP_011039582.1|  PREDICTED: probable CCR4-associated factor 1...    290   4e-94    Populus euphratica
emb|CAN79806.1|  hypothetical protein VITISV_031504                     290   4e-94    Vitis vinifera
gb|EYU24608.1|  hypothetical protein MIMGU_mgv1a011718mg                290   4e-94    Erythranthe guttata [common monkey flower]
ref|XP_009354185.1|  PREDICTED: probable CCR4-associated factor 1...    290   5e-94    Pyrus x bretschneideri [bai li]
ref|XP_007011965.1|  Polynucleotidyl transferase, ribonuclease H-...    290   5e-94    
gb|KJB07590.1|  hypothetical protein B456_001G031500                    290   5e-94    Gossypium raimondii
ref|XP_010265638.1|  PREDICTED: probable CCR4-associated factor 1...    289   9e-94    Nelumbo nucifera [Indian lotus]
ref|XP_010275748.1|  PREDICTED: probable CCR4-associated factor 1...    289   9e-94    Nelumbo nucifera [Indian lotus]
ref|XP_011082251.1|  PREDICTED: probable CCR4-associated factor 1...    289   1e-93    Sesamum indicum [beniseed]
gb|KHN07034.1|  Putative CCR4-associated factor 1 like 7                289   1e-93    Glycine soja [wild soybean]
ref|XP_010532089.1|  PREDICTED: probable CCR4-associated factor 1...    288   1e-93    Tarenaya hassleriana [spider flower]
ref|XP_006356242.1|  PREDICTED: probable CCR4-associated factor 1...    288   1e-93    Solanum tuberosum [potatoes]
ref|XP_004507083.1|  PREDICTED: probable CCR4-associated factor 1...    289   1e-93    Cicer arietinum [garbanzo]
ref|XP_006857184.1|  hypothetical protein AMTR_s00065p00182000          288   2e-93    Amborella trichopoda
ref|XP_009390565.1|  PREDICTED: probable CCR4-associated factor 1...    288   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010532085.1|  PREDICTED: probable CCR4-associated factor 1...    288   2e-93    Tarenaya hassleriana [spider flower]
ref|XP_004241682.1|  PREDICTED: probable CCR4-associated factor 1...    288   2e-93    Solanum lycopersicum
ref|XP_010691601.1|  PREDICTED: probable CCR4-associated factor 1...    288   3e-93    Beta vulgaris subsp. vulgaris [field beet]
gb|KHF99352.1|  putative CCR4-associated factor 1 -like protein         289   4e-93    Gossypium arboreum [tree cotton]
gb|KHG00404.1|  putative CCR4-associated factor 1 -like protein         287   5e-93    Gossypium arboreum [tree cotton]
ref|XP_010048142.1|  PREDICTED: probable CCR4-associated factor 1...    287   6e-93    Eucalyptus grandis [rose gum]
ref|XP_003531734.1|  PREDICTED: probable CCR4-associated factor 1...    287   6e-93    
ref|XP_010929136.1|  PREDICTED: probable CCR4-associated factor 1...    287   7e-93    Elaeis guineensis
ref|XP_004291948.1|  PREDICTED: probable CCR4-associated factor 1...    287   7e-93    Fragaria vesca subsp. vesca
ref|XP_003604226.1|  Ribonuclease CAF1                                  286   1e-92    
ref|XP_010942117.1|  PREDICTED: probable CCR4-associated factor 1...    286   1e-92    Elaeis guineensis
ref|XP_006483458.1|  PREDICTED: probable CCR4-associated factor 1...    286   1e-92    Citrus sinensis [apfelsine]
ref|XP_006427595.1|  hypothetical protein CICLE_v10026260mg             286   2e-92    
ref|XP_006294779.1|  hypothetical protein CARUB_v10023830mg             285   3e-92    Capsella rubella
ref|XP_009801027.1|  PREDICTED: probable CCR4-associated factor 1...    285   3e-92    Nicotiana sylvestris
ref|XP_010510101.1|  PREDICTED: probable CCR4-associated factor 1...    285   4e-92    Camelina sativa [gold-of-pleasure]
ref|XP_006465196.1|  PREDICTED: probable CCR4-associated factor 1...    285   5e-92    Citrus sinensis [apfelsine]
ref|XP_010541577.1|  PREDICTED: probable CCR4-associated factor 1...    283   5e-92    Tarenaya hassleriana [spider flower]
ref|XP_002862886.1|  hypothetical protein ARALYDRAFT_920160             283   6e-92    
gb|ACU20942.1|  unknown                                                 285   7e-92    Glycine max [soybeans]
ref|XP_010469632.1|  PREDICTED: probable CCR4-associated factor 1...    284   8e-92    Camelina sativa [gold-of-pleasure]
gb|AFK43307.1|  unknown                                                 284   8e-92    Lotus japonicus
ref|XP_011073341.1|  PREDICTED: probable CCR4-associated factor 1...    284   8e-92    Sesamum indicum [beniseed]
gb|KDO42998.1|  hypothetical protein CISIN_1g023991mg                   284   9e-92    Citrus sinensis [apfelsine]
ref|XP_010541576.1|  PREDICTED: probable CCR4-associated factor 1...    284   9e-92    Tarenaya hassleriana [spider flower]
ref|XP_007135810.1|  hypothetical protein PHAVU_010G160400g             284   1e-91    Phaseolus vulgaris [French bean]
ref|XP_010532091.1|  PREDICTED: probable CCR4-associated factor 1...    284   1e-91    Tarenaya hassleriana [spider flower]
ref|XP_009417447.1|  PREDICTED: probable CCR4-associated factor 1...    284   1e-91    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP10211.1|  unnamed protein product                                283   1e-91    Coffea canephora [robusta coffee]
ref|XP_008794330.1|  PREDICTED: probable CCR4-associated factor 1...    283   1e-91    Phoenix dactylifera
ref|XP_010414034.1|  PREDICTED: probable CCR4-associated factor 1...    283   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_002881215.1|  hypothetical protein ARALYDRAFT_902256             283   2e-91    Arabidopsis lyrata subsp. lyrata
ref|XP_009128391.1|  PREDICTED: probable CCR4-associated factor 1...    283   2e-91    Brassica rapa
ref|XP_008799630.1|  PREDICTED: probable CCR4-associated factor 1...    283   2e-91    Phoenix dactylifera
ref|XP_009620266.1|  PREDICTED: probable CCR4-associated factor 1...    283   2e-91    Nicotiana tomentosiformis
ref|XP_006450304.1|  hypothetical protein CICLE_v10008276mg             288   3e-91    
ref|XP_006389834.1|  hypothetical protein EUTSA_v10018990mg             282   4e-91    Eutrema salsugineum [saltwater cress]
ref|XP_003603309.1|  Ribonuclease CAF1                                  282   4e-91    
ref|NP_565735.1|  polynucleotidyl transferase, ribonuclease H-lik...    282   4e-91    Arabidopsis thaliana [mouse-ear cress]
emb|CDY63973.1|  BnaC02g46620D                                          282   7e-91    Brassica napus [oilseed rape]
ref|XP_009399558.1|  PREDICTED: probable CCR4-associated factor 1...    281   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006473977.1|  PREDICTED: probable CCR4-associated factor 1...    281   2e-90    Citrus sinensis [apfelsine]
ref|XP_004501372.1|  PREDICTED: probable CCR4-associated factor 1...    280   4e-90    
ref|XP_010472873.1|  PREDICTED: probable CCR4-associated factor 1...    280   5e-90    Camelina sativa [gold-of-pleasure]
ref|XP_009144015.1|  PREDICTED: probable CCR4-associated factor 1...    280   5e-90    Brassica rapa
ref|XP_008445257.1|  PREDICTED: LOW QUALITY PROTEIN: probable CCR...    279   6e-90    Cucumis melo [Oriental melon]
ref|XP_009363839.1|  PREDICTED: probable CCR4-associated factor 1...    279   6e-90    Pyrus x bretschneideri [bai li]
ref|NP_178193.1|  putative CCR4-associated factor 1-like 6              279   9e-90    Arabidopsis thaliana [mouse-ear cress]
gb|EPS71126.1|  hypothetical protein M569_03633                         278   2e-89    Genlisea aurea
ref|XP_006302671.1|  hypothetical protein CARUB_v10020778mg             278   2e-89    Capsella rubella
ref|XP_004138706.1|  PREDICTED: probable CCR4-associated factor 1...    278   2e-89    Cucumis sativus [cucumbers]
ref|XP_008378874.1|  PREDICTED: probable CCR4-associated factor 1...    278   2e-89    Malus domestica [apple tree]
gb|ACJ84891.1|  unknown                                                 278   2e-89    Medicago truncatula
ref|XP_010048831.1|  PREDICTED: probable CCR4-associated factor 1...    278   3e-89    Eucalyptus grandis [rose gum]
ref|XP_011073532.1|  PREDICTED: probable CCR4-associated factor 1...    277   3e-89    Sesamum indicum [beniseed]
gb|KJB06631.1|  hypothetical protein B456_001G037000                    276   4e-89    Gossypium raimondii
ref|XP_006356929.1|  PREDICTED: probable CCR4-associated factor 1...    277   5e-89    Solanum tuberosum [potatoes]
ref|XP_006453661.1|  hypothetical protein CICLE_v10009159mg             276   7e-89    Citrus clementina [clementine]
ref|XP_004160761.1|  PREDICTED: LOW QUALITY PROTEIN: probable CCR...    276   8e-89    
gb|AFK45143.1|  unknown                                                 276   1e-88    Lotus japonicus
gb|KJB06630.1|  hypothetical protein B456_001G037000                    276   1e-88    Gossypium raimondii
ref|XP_010556071.1|  PREDICTED: probable CCR4-associated factor 1...    276   1e-88    Tarenaya hassleriana [spider flower]
ref|XP_009106716.1|  PREDICTED: probable CCR4-associated factor 1...    276   1e-88    Brassica rapa
ref|XP_010429900.1|  PREDICTED: probable CCR4-associated factor 1...    275   3e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010417661.1|  PREDICTED: probable CCR4-associated factor 1...    275   3e-88    Camelina sativa [gold-of-pleasure]
emb|CDY12234.1|  BnaC04g12640D                                          275   4e-88    Brassica napus [oilseed rape]
ref|NP_001185452.1|  putative CCR4-associated factor 1-like 6           275   4e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008377668.1|  PREDICTED: probable CCR4-associated factor 1...    275   5e-88    Malus domestica [apple tree]
ref|XP_008220692.1|  PREDICTED: probable CCR4-associated factor 1...    274   6e-88    Prunus mume [ume]
emb|CDY39943.1|  BnaC06g40210D                                          274   1e-87    Brassica napus [oilseed rape]
ref|XP_004250764.1|  PREDICTED: probable CCR4-associated factor 1...    273   2e-87    Solanum lycopersicum
emb|CAN68032.1|  hypothetical protein VITISV_022019                     273   2e-87    Vitis vinifera
ref|XP_004504674.1|  PREDICTED: probable CCR4-associated factor 1...    273   2e-87    Cicer arietinum [garbanzo]
ref|XP_002279241.1|  PREDICTED: probable CCR4-associated factor 1...    272   4e-87    Vitis vinifera
gb|KHN29617.1|  Putative CCR4-associated factor 1 like 7                271   6e-87    Glycine soja [wild soybean]
gb|ABK24400.1|  unknown                                                 271   1e-86    Picea sitchensis
gb|ABK21469.1|  unknown                                                 268   3e-86    Picea sitchensis
ref|XP_009358471.1|  PREDICTED: probable CCR4-associated factor 1...    270   4e-86    Pyrus x bretschneideri [bai li]
ref|XP_010063560.1|  PREDICTED: probable CCR4-associated factor 1...    270   4e-86    Eucalyptus grandis [rose gum]
ref|XP_008336906.1|  PREDICTED: probable CCR4-associated factor 1...    270   5e-86    
gb|EYU21723.1|  hypothetical protein MIMGU_mgv1a019889mg                269   5e-86    Erythranthe guttata [common monkey flower]
ref|XP_008344039.1|  PREDICTED: probable CCR4-associated factor 1...    269   8e-86    
gb|ACN40154.1|  unknown                                                 268   1e-85    Picea sitchensis
ref|XP_006410344.1|  hypothetical protein EUTSA_v10017059mg             268   1e-85    Eutrema salsugineum [saltwater cress]
ref|XP_009366159.1|  PREDICTED: probable CCR4-associated factor 1...    268   3e-85    Pyrus x bretschneideri [bai li]
ref|XP_008354337.1|  PREDICTED: probable CCR4-associated factor 1...    268   3e-85    
ref|XP_007202386.1|  hypothetical protein PRUPE_ppa009376mg             267   8e-85    Prunus persica
emb|CDX70376.1|  BnaC03g04600D                                          264   5e-84    
ref|XP_007222518.1|  hypothetical protein PRUPE_ppa009848mg             264   5e-84    Prunus persica
ref|XP_008242960.1|  PREDICTED: probable CCR4-associated factor 1...    265   5e-84    Prunus mume [ume]
ref|XP_008242959.1|  PREDICTED: probable CCR4-associated factor 1...    265   1e-83    
gb|EYU32376.1|  hypothetical protein MIMGU_mgv1a026872mg                263   1e-83    Erythranthe guttata [common monkey flower]
ref|XP_010537879.1|  PREDICTED: probable CCR4-associated factor 1...    263   1e-83    Tarenaya hassleriana [spider flower]
ref|XP_004287117.1|  PREDICTED: probable CCR4-associated factor 1...    263   2e-83    Fragaria vesca subsp. vesca
gb|KJB06633.1|  hypothetical protein B456_001G037000                    260   2e-83    Gossypium raimondii
ref|NP_196657.1|  polynucleotidyl transferase, ribonuclease H-lik...    262   4e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871445.1|  hypothetical protein ARALYDRAFT_487926             262   4e-83    
gb|AAK92792.1|  putative CCR4-associated factor                         262   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399590.1|  hypothetical protein EUTSA_v10014350mg             261   6e-83    Eutrema salsugineum [saltwater cress]
gb|ABK22659.1|  unknown                                                 262   6e-83    Picea sitchensis
ref|XP_010453129.1|  PREDICTED: probable CCR4-associated factor 1...    260   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_006286536.1|  hypothetical protein CARUB_v10001652mg             260   3e-82    Capsella rubella
ref|XP_010419649.1|  PREDICTED: probable CCR4-associated factor 1...    259   4e-82    Camelina sativa [gold-of-pleasure]
ref|XP_002309331.1|  hypothetical protein POPTR_0006s20130g             259   5e-82    Populus trichocarpa [western balsam poplar]
ref|XP_010491786.1|  PREDICTED: probable CCR4-associated factor 1...    258   1e-81    Camelina sativa [gold-of-pleasure]
ref|XP_011033459.1|  PREDICTED: probable CCR4-associated factor 1...    258   1e-81    Populus euphratica
emb|CDX97069.1|  BnaC09g45560D                                          258   2e-81    
emb|CDX69796.1|  BnaA10g21450D                                          258   2e-81    
ref|XP_009122009.1|  PREDICTED: probable CCR4-associated factor 1...    258   2e-81    Brassica rapa
ref|NP_001148663.1|  CCR4-NOT transcription complex subunit 7           255   6e-81    Zea mays [maize]
gb|AEN81307.1|  AT1G80780-like protein                                  253   7e-81    Capsella rubella
ref|XP_002452981.1|  hypothetical protein SORBIDRAFT_04g035960          256   1e-80    Sorghum bicolor [broomcorn]
ref|XP_009131188.1|  PREDICTED: probable CCR4-associated factor 1...    255   1e-80    Brassica rapa
gb|ACL53982.1|  unknown                                                 255   2e-80    Zea mays [maize]
ref|XP_004954218.1|  PREDICTED: probable CCR4-associated factor 1...    255   3e-80    Setaria italica
gb|EEC74173.1|  hypothetical protein OsI_09281                          254   9e-80    Oryza sativa Indica Group [Indian rice]
dbj|BAD19081.1|  putative CCR4-NOT transcription complex subunit 7      254   1e-79    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048387.1|  Os02g0796300                                       254   1e-79    
dbj|BAJ92910.1|  predicted protein                                      253   3e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008352217.1|  PREDICTED: probable CCR4-associated factor 1...    248   9e-79    
gb|KHN38030.1|  Putative CCR4-associated factor 1 like 7                249   2e-78    Glycine soja [wild soybean]
ref|XP_003570299.1|  PREDICTED: probable CCR4-associated factor 1...    250   2e-78    Brachypodium distachyon [annual false brome]
gb|EMT24915.1|  Putative CCR4-associated factor 1-7-like protein        246   8e-78    
ref|XP_006648046.1|  PREDICTED: probable CCR4-associated factor 1...    248   2e-77    
gb|EPS59819.1|  hypothetical protein M569_14984                         247   3e-77    Genlisea aurea
ref|XP_001766532.1|  predicted protein                                  246   8e-77    
ref|XP_006368924.1|  hypothetical protein POPTR_0001s14860g             244   8e-77    
ref|XP_001755261.1|  predicted protein                                  245   1e-76    
ref|NP_001136747.1|  uncharacterized protein LOC100216888               245   2e-76    Zea mays [maize]
dbj|BAK01540.1|  predicted protein                                      245   2e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002460215.1|  hypothetical protein SORBIDRAFT_02g024730          244   4e-76    Sorghum bicolor [broomcorn]
ref|XP_006665053.1|  PREDICTED: probable CCR4-associated factor 1...    243   2e-75    Oryza brachyantha
ref|XP_006660627.1|  PREDICTED: probable CCR4-associated factor 1...    241   4e-75    Oryza brachyantha
gb|EMS46974.1|  putative CCR4-associated factor 1-like protein 7        239   8e-75    Triticum urartu
ref|NP_001063181.1|  Os09g0416800                                       239   3e-74    
gb|ACE98441.1|  ribonuclease CAF1                                       234   1e-73    Populus tremula [European aspen]
ref|XP_002965900.1|  hypothetical protein SELMODRAFT_84624              237   3e-73    Selaginella moellendorffii
gb|KCW80614.1|  hypothetical protein EUGRSUZ_C01981                     233   1e-72    Eucalyptus grandis [rose gum]
ref|XP_010048148.1|  PREDICTED: probable CCR4-associated factor 1...    233   6e-72    Eucalyptus grandis [rose gum]
ref|XP_003578122.1|  PREDICTED: probable CCR4-associated factor 1...    233   9e-72    Brachypodium distachyon [annual false brome]
ref|NP_001132298.1|  CCR4-NOT transcription complex subunit 7 iso...    232   2e-71    
gb|KCW62735.1|  hypothetical protein EUGRSUZ_G00324                     228   1e-70    Eucalyptus grandis [rose gum]
ref|XP_006416864.1|  hypothetical protein EUTSA_v10008404mg             230   2e-70    Eutrema salsugineum [saltwater cress]
ref|XP_004956826.1|  PREDICTED: probable CCR4-associated factor 1...    228   8e-70    Setaria italica
gb|KFK43832.1|  hypothetical protein AALP_AA1G179300                    226   4e-69    Arabis alpina [alpine rockcress]
gb|ABY89387.1|  chromatin assembly factor 1                             223   7e-69    Pinus taeda
ref|NP_173044.1|  polynucleotidyl transferase, ribonuclease H-lik...    224   2e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890137.1|  hypothetical protein ARALYDRAFT_312582             223   5e-68    Arabidopsis lyrata subsp. lyrata
ref|XP_002981023.1|  hypothetical protein SELMODRAFT_444748             223   7e-68    Selaginella moellendorffii
ref|XP_002982500.1|  hypothetical protein SELMODRAFT_179583             223   8e-68    Selaginella moellendorffii
ref|XP_009396102.1|  PREDICTED: probable CCR4-associated factor 1...    219   1e-66    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006304066.1|  hypothetical protein CARUB_v10009915mg             220   1e-66    Capsella rubella
ref|XP_003574542.1|  PREDICTED: probable CCR4-associated factor 1...    218   1e-65    Brachypodium distachyon [annual false brome]
ref|XP_010459127.1|  PREDICTED: probable CCR4-associated factor 1...    217   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_009395282.1|  PREDICTED: probable CCR4-associated factor 1...    216   2e-65    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010476692.1|  PREDICTED: probable CCR4-associated factor 1...    217   2e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010497514.1|  PREDICTED: probable CCR4-associated factor 1...    216   3e-65    Camelina sativa [gold-of-pleasure]
ref|XP_009418496.1|  PREDICTED: probable CCR4-associated factor 1...    216   5e-65    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001697447.1|  CCR4-associated factor                             216   1e-64    Chlamydomonas reinhardtii
ref|XP_009395283.1|  PREDICTED: probable CCR4-associated factor 1...    214   2e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002950174.1|  hypothetical protein VOLCADRAFT_80930              214   5e-64    Volvox carteri f. nagariensis
ref|XP_010932239.1|  PREDICTED: probable CCR4-associated factor 1...    212   9e-64    Elaeis guineensis
gb|EAZ07127.1|  hypothetical protein OsI_29374                          210   2e-63    Oryza sativa Indica Group [Indian rice]
emb|CDY12236.1|  BnaC04g12660D                                          214   5e-63    Brassica napus [oilseed rape]
dbj|BAD09890.1|  putative CCR4-NOT transcription complex, subunit 7     211   5e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008796886.1|  PREDICTED: probable CCR4-associated factor 1...    209   1e-62    Phoenix dactylifera
ref|XP_005649974.1|  CCR4-associated factor                             209   2e-62    Coccomyxa subellipsoidea C-169
ref|XP_009149028.1|  PREDICTED: probable CCR4-associated factor 1...    208   4e-62    Brassica rapa
emb|CDY35049.1|  BnaA06g10590D                                          207   9e-62    Brassica napus [oilseed rape]
gb|EYU24605.1|  hypothetical protein MIMGU_mgv1a011876mg                206   2e-61    Erythranthe guttata [common monkey flower]
ref|XP_010469633.1|  PREDICTED: probable CCR4-associated factor 1...    205   3e-61    Camelina sativa [gold-of-pleasure]
ref|XP_003056015.1|  predicted protein                                  205   5e-61    Micromonas pusilla CCMP1545
gb|EMS59499.1|  putative CCR4-associated factor 1-like protein 7        206   5e-61    Triticum urartu
gb|KCW53891.1|  hypothetical protein EUGRSUZ_J03104                     202   2e-60    Eucalyptus grandis [rose gum]
emb|CDY33367.1|  BnaC05g12160D                                          209   2e-60    Brassica napus [oilseed rape]
ref|XP_006659446.1|  PREDICTED: probable CCR4-associated factor 1...    203   4e-60    
ref|XP_005843563.1|  hypothetical protein CHLNCDRAFT_59811              202   9e-60    Chlorella variabilis
gb|KDD75431.1|  CAF1 family ribonuclease                                201   1e-59    Helicosporidium sp. ATCC 50920
ref|XP_010927524.1|  PREDICTED: probable CCR4-associated factor 1...    197   7e-58    Elaeis guineensis
ref|XP_002507260.1|  predicted protein                                  194   1e-56    Micromonas commoda
ref|XP_011395961.1|  putative CCR4-associated factor 1-like prote...    193   4e-56    Auxenochlorella protothecoides
ref|XP_007023405.1|  Polynucleotidyl transferase, ribonuclease H-...    189   6e-56    
ref|XP_008779663.1|  PREDICTED: probable CCR4-associated factor 1...    190   3e-55    Phoenix dactylifera
gb|ACH59934.1|  ccr4-NOT transcription complex protein                  185   8e-55    Pseudotsuga menziesii
ref|XP_009385031.1|  PREDICTED: probable CCR4-associated factor 1...    189   9e-55    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011006693.1|  PREDICTED: probable CCR4-associated factor 1...    189   1e-54    Populus euphratica
gb|AFK36856.1|  unknown                                                 186   1e-54    Medicago truncatula
ref|XP_005707256.1|  CCR4-NOT transcription complex subunit 7/8         189   1e-54    Galdieria sulphuraria
ref|XP_006384784.1|  CCR4-NOT transcription complex family protein      188   2e-54    Populus trichocarpa [western balsam poplar]
ref|XP_011006712.1|  PREDICTED: probable CCR4-associated factor 1...    188   2e-54    Populus euphratica
gb|KDP27391.1|  hypothetical protein JCGZ_20215                         187   3e-54    Jatropha curcas
ref|XP_001416204.1|  polyA tail-shortening ribonuclease, probable       187   5e-54    Ostreococcus lucimarinus CCE9901
ref|XP_007509231.1|  Caf1 CCR4-associated (transcription) factor 1      186   1e-53    Bathycoccus prasinos
ref|XP_002444415.1|  hypothetical protein SORBIDRAFT_07g021610          186   2e-53    Sorghum bicolor [broomcorn]
ref|XP_010510103.1|  PREDICTED: probable CCR4-associated factor 1...    185   2e-53    Camelina sativa [gold-of-pleasure]
ref|NP_001140241.1|  uncharacterized protein LOC100272282               185   4e-53    Zea mays [maize]
gb|AGT16865.1|  transcription complex                                   184   8e-53    Saccharum hybrid cultivar R570
ref|XP_006361099.1|  PREDICTED: probable CCR4-associated factor 1...    184   8e-53    Solanum tuberosum [potatoes]
ref|XP_003521484.1|  PREDICTED: probable CCR4-associated factor 1...    184   9e-53    
ref|XP_002523862.1|  ccr4-associated factor, putative                   184   1e-52    Ricinus communis
ref|XP_007015724.1|  Polynucleotidyl transferase, ribonuclease H-...    184   1e-52    
ref|XP_010104797.1|  putative CCR4-associated factor 1-9-like pro...    184   1e-52    Morus notabilis
gb|AGV54478.1|  CCR4-associated factor 1-like protein 11                183   2e-52    Phaseolus vulgaris [French bean]
ref|XP_007162950.1|  hypothetical protein PHAVU_001G193900g             182   2e-52    Phaseolus vulgaris [French bean]
ref|XP_009369921.1|  PREDICTED: probable CCR4-associated factor 1...    183   3e-52    Pyrus x bretschneideri [bai li]
ref|XP_003554457.1|  PREDICTED: probable CCR4-associated factor 1...    182   6e-52    Glycine max [soybeans]
ref|XP_010246433.1|  PREDICTED: probable CCR4-associated factor 1...    182   6e-52    Nelumbo nucifera [Indian lotus]
emb|CDG58373.1|  putative CCR4-associated factor 1-homolog 6            177   7e-52    Leucadendron flexuosum
gb|KDP38660.1|  hypothetical protein JCGZ_04013                         181   7e-52    Jatropha curcas
emb|CDO45621.1|  Putative CCR4-associated factor 1-homolog 6            176   9e-52    Leucadendron flexuosum
ref|XP_008342289.1|  PREDICTED: probable CCR4-associated factor 1...    182   2e-51    
ref|XP_004337732.1|  ccr4associated factor, putative                    180   2e-51    Acanthamoeba castellanii str. Neff
ref|XP_004494232.1|  PREDICTED: probable CCR4-associated factor 1...    181   2e-51    
emb|CDG58396.1|  putative CCR4-associated factor 1-homolog 6            175   3e-51    Mimetes cucullatus
ref|XP_010262944.1|  PREDICTED: probable CCR4-associated factor 1...    180   3e-51    Nelumbo nucifera [Indian lotus]
emb|CDG58389.1|  putative CCR4-associated factor 1-homolog 6            175   4e-51    Leucadendron sericeum
ref|XP_009804843.1|  PREDICTED: probable CCR4-associated factor 1...    179   4e-51    Nicotiana sylvestris
emb|CDG58367.1|  putative CCR4-associated factor 1-homolog 6            175   4e-51    Leucadendron discolor
ref|XP_009616495.1|  PREDICTED: probable CCR4-associated factor 1...    179   4e-51    Nicotiana tomentosiformis
emb|CDG58360.1|  putative CCR4-associated factor 1-homolog 6            175   4e-51    
emb|CDG58392.1|  putative CCR4-associated factor 1-homolog 6            174   5e-51    
ref|XP_002271636.1|  PREDICTED: probable CCR4-associated factor 1...    179   7e-51    
ref|XP_004241342.1|  PREDICTED: probable CCR4-associated factor 1...    178   9e-51    
gb|KJB09109.1|  hypothetical protein B456_001G123600                    178   1e-50    
ref|XP_006379358.1|  hypothetical protein POPTR_0009s16310g             178   1e-50    
emb|CEG00911.1|  Ribonuclease H-like domain                             177   1e-50    
gb|EMT15436.1|  Putative CCR4-associated factor 1-7-like protein        176   1e-50    
emb|CAN76920.1|  hypothetical protein VITISV_015622                     178   1e-50    
ref|XP_011090316.1|  PREDICTED: probable CCR4-associated factor 1...    177   2e-50    
emb|CDG58377.1|  putative CCR4-associated factor 1-homolog 6            173   2e-50    
ref|XP_002281138.1|  PREDICTED: probable CCR4-associated factor 1...    177   2e-50    
gb|ABG66307.1|  CCR4 associated factor 1-related protein                177   2e-50    
ref|XP_010031548.1|  PREDICTED: probable CCR4-associated factor 1...    177   2e-50    
ref|XP_010045176.1|  PREDICTED: probable CCR4-associated factor 1...    177   3e-50    
gb|KJB35417.1|  hypothetical protein B456_006G114000                    177   3e-50    
emb|CAN61475.1|  hypothetical protein VITISV_021407                     177   3e-50    
ref|NP_001131670.1|  uncharacterized protein LOC100193030               177   3e-50    
ref|XP_003074753.1|  Caf1 CCR4-associated (transcription) factor,...    177   4e-50    
ref|XP_004140166.1|  PREDICTED: probable CCR4-associated factor 1...    177   4e-50    
ref|XP_003540260.1|  PREDICTED: probable CCR4-associated factor 1...    177   5e-50    
gb|KJB46419.1|  hypothetical protein B456_007G366900                    177   6e-50    
ref|XP_004139505.1|  PREDICTED: probable CCR4-associated factor 1...    176   7e-50    
gb|KJB21739.1|  hypothetical protein B456_004G011500                    176   7e-50    
ref|XP_006854719.1|  hypothetical protein AMTR_s00030p00236350          176   8e-50    
ref|XP_011088949.1|  PREDICTED: probable CCR4-associated factor 1...    176   1e-49    
ref|XP_008463638.1|  PREDICTED: probable CCR4-associated factor 1...    176   1e-49    
gb|KDP36143.1|  hypothetical protein JCGZ_08787                         176   2e-49    
ref|XP_010102028.1|  putative CCR4-associated factor 1-11-like pr...    175   2e-49    
gb|ACL52816.1|  unknown                                                 175   3e-49    
emb|CDH53595.1|  caf1 family protein                                    176   3e-49    
ref|XP_005823461.1|  hypothetical protein GUITHDRAFT_97567              176   4e-49    
ref|XP_010059294.1|  PREDICTED: probable CCR4-associated factor 1...    174   5e-49    
ref|XP_007027917.1|  Polynucleotidyl transferase                        174   6e-49    
ref|XP_004251085.1|  PREDICTED: probable CCR4-associated factor 1...    174   6e-49    
gb|ACU19702.1|  unknown                                                 174   8e-49    
gb|KDN37229.1|  CAF1-domain-containing protein                          176   9e-49    
gb|ABP35526.1|  CCR4-associated factor                                  173   1e-48    
dbj|BAM20372.1|  ccr4-associated factor                                 174   1e-48    
ref|XP_006854720.1|  hypothetical protein AMTR_s00030p00236940          173   1e-48    
emb|CDP06864.1|  unnamed protein product                                173   2e-48    
ref|XP_007877414.1|  hypothetical protein PFL1_01713                    174   2e-48    
gb|ELT91034.1|  hypothetical protein CAPTEDRAFT_96823                   174   2e-48    
ref|XP_007205684.1|  hypothetical protein PRUPE_ppa009650mg             173   2e-48    
ref|XP_006400731.1|  hypothetical protein EUTSA_v10014297mg             173   2e-48    
emb|CDS05253.1|  Putative CCR4-NOT transcription complex subunit7       172   2e-48    
ref|XP_006481524.1|  PREDICTED: probable CCR4-associated factor 1...    173   2e-48    
ref|XP_008391953.1|  PREDICTED: probable CCR4-associated factor 1...    172   3e-48    
ref|XP_010493298.1|  PREDICTED: probable CCR4-associated factor 1...    172   3e-48    
gb|KFK26333.1|  hypothetical protein AALP_AA8G234200                    172   4e-48    
emb|CBQ71168.1|  probable CCR4-NOT transcription complex, subunit 7     173   4e-48    
ref|XP_003635867.1|  CCR4-associated factor                             176   4e-48    
dbj|GAC98607.1|  potential mRNA deadenylase and CCR4-NOT complex ...    172   4e-48    
gb|KHN33170.1|  Putative CCR4-associated factor 1 like 11               171   4e-48    
ref|XP_011388715.1|  putative CCR4-NOT core exoribonuclease subun...    173   4e-48    
gb|ETS62597.1|  hypothetical protein PaG_03234                          173   4e-48    
ref|XP_011043248.1|  PREDICTED: probable CCR4-associated factor 1...    172   5e-48    
emb|CDX98586.1|  BnaC05g37890D                                          172   5e-48    
dbj|GAK65069.1|  ribonuclease CAF1                                      172   5e-48    
gb|KFH71636.1|  hypothetical protein MVEG_01932                         172   5e-48    
emb|CDI55400.1|  probable CCR4-NOT transcription complex, subunit 7     172   6e-48    
emb|CDX92371.1|  BnaA10g14100D                                          171   6e-48    
ref|NP_197617.1|  CCR4-associated factor 1B                             171   6e-48    
ref|XP_004354599.1|  CAF1 family protein                                174   7e-48    
ref|XP_002874054.1|  hypothetical protein ARALYDRAFT_489075             171   8e-48    
gb|EPS70860.1|  hypothetical protein M569_03896                         171   8e-48    
ref|XP_006362860.1|  PREDICTED: probable CCR4-associated factor 1...    171   8e-48    
ref|XP_010907244.1|  PREDICTED: probable CCR4-associated factor 1...    171   8e-48    
emb|CEG62914.1|  Putative CCR4-NOT transcription complex subunit 7      171   9e-48    
ref|XP_006424139.1|  hypothetical protein CICLE_v10028965mg             171   9e-48    
emb|CDH54244.1|  ccr4-not transcription complex subunit 7               171   1e-47    
ref|XP_009349767.1|  PREDICTED: probable CCR4-associated factor 1...    171   1e-47    
ref|XP_004927883.1|  PREDICTED: CCR4-NOT transcription complex su...    171   1e-47    
gb|KDO58265.1|  hypothetical protein CISIN_1g022773mg                   171   1e-47    
gb|AFS65102.1|  CCR4-associated factor 1-related protein                171   1e-47    
gb|KDP38659.1|  hypothetical protein JCGZ_04012                         170   1e-47    
gb|EFA83975.1|  CAF1 family protein                                     178   1e-47    
emb|CDX88806.1|  BnaA03g08430D                                          171   1e-47    
emb|CEP13830.1|  hypothetical protein                                   171   2e-47    
emb|CDS11386.1|  Putative CCR4-NOT transcription complex subunit7       169   2e-47    
ref|XP_010454487.1|  PREDICTED: probable CCR4-associated factor 1...    170   2e-47    
ref|XP_003538097.1|  PREDICTED: probable CCR4-associated factor 1...    170   2e-47    
ref|XP_009349269.1|  PREDICTED: probable CCR4-associated factor 1...    170   2e-47    
ref|XP_004291682.1|  PREDICTED: probable CCR4-associated factor 1...    170   2e-47    
emb|CDG58387.1|  putative CCR4-associated factor 1-homolog 6            165   2e-47    
gb|EST05943.1|  CCR4-NOT transcription complex, subunit 7               171   2e-47    
ref|XP_006680570.1|  hypothetical protein BATDEDRAFT_90073              169   3e-47    
ref|XP_009120675.1|  PREDICTED: probable CCR4-associated factor 1...    170   3e-47    
ref|XP_010421012.1|  PREDICTED: probable CCR4-associated factor 1...    169   3e-47    
ref|XP_010685418.1|  PREDICTED: probable CCR4-associated factor 1...    169   3e-47    
gb|ENN82986.1|  hypothetical protein YQE_00650                          168   4e-47    
emb|CEI89573.1|  Putative CCR4-NOT transcription complex subunit 7      169   4e-47    
emb|CCF48047.1|  probable CCR4-NOT transcription complex, subunit 7     170   4e-47    
ref|XP_009419420.1|  PREDICTED: probable CCR4-associated factor 1...    169   4e-47    
ref|XP_009372560.1|  PREDICTED: probable CCR4-associated factor 1...    169   4e-47    
emb|CDY08688.1|  BnaC03g54940D                                          169   4e-47    
gb|EFN64855.1|  CCR4-NOT transcription complex subunit 7                169   5e-47    
gb|KGG51291.1|  subunit 7 of CCR4-NOT transcription complex             169   5e-47    
ref|XP_008246147.1|  PREDICTED: probable CCR4-associated factor 1...    169   5e-47    
gb|EGI59892.1|  CCR4-NOT transcription complex subunit 7                169   5e-47    
ref|XP_009604779.1|  PREDICTED: probable CCR4-associated factor 1...    169   6e-47    
gb|EPB85653.1|  CCR4-NOT transcription complex subunit 7                168   6e-47    
ref|XP_638302.1|  CAF1 family protein                                   169   6e-47    
ref|XP_011160728.1|  PREDICTED: CCR4-NOT transcription complex su...    169   6e-47    
ref|XP_011337289.1|  PREDICTED: CCR4-NOT transcription complex su...    169   7e-47    
gb|ERL90972.1|  hypothetical protein D910_08314                         169   7e-47    
ref|XP_009802120.1|  PREDICTED: probable CCR4-associated factor 1...    169   7e-47    
ref|XP_011160727.1|  PREDICTED: CCR4-NOT transcription complex su...    169   8e-47    
ref|XP_008548221.1|  PREDICTED: CCR4-NOT transcription complex su...    168   9e-47    
ref|XP_011261446.1|  PREDICTED: CCR4-NOT transcription complex su...    169   1e-46    
gb|AEE62054.1|  unknown                                                 169   1e-46    
ref|XP_786386.1|  PREDICTED: CCR4-NOT transcription complex subun...    168   1e-46    
dbj|GAN07390.1|  CCR4 associated factor                                 169   1e-46    
ref|XP_003424661.1|  PREDICTED: CCR4-NOT transcription complex su...    168   1e-46    
ref|XP_008548220.1|  PREDICTED: CCR4-NOT transcription complex su...    168   1e-46    
ref|XP_006568302.1|  PREDICTED: CCR4-NOT transcription complex su...    168   1e-46    
ref|XP_009123303.1|  PREDICTED: probable CCR4-associated factor 1...    167   1e-46    
ref|XP_004927882.1|  PREDICTED: CCR4-NOT transcription complex su...    168   2e-46    
ref|XP_004517160.1|  PREDICTED: probable CCR4-associated factor 1...    168   2e-46    
ref|XP_008548219.1|  PREDICTED: CCR4-NOT transcription complex su...    168   2e-46    
ref|XP_009347151.1|  PREDICTED: probable CCR4-associated factor 1...    167   2e-46    
gb|EYU36042.1|  hypothetical protein MIMGU_mgv1a011524mg                167   2e-46    
ref|XP_009020258.1|  hypothetical protein HELRODRAFT_81531              168   2e-46    
ref|XP_006568301.1|  PREDICTED: CCR4-NOT transcription complex su...    168   2e-46    
ref|XP_003396031.1|  PREDICTED: CCR4-NOT transcription complex su...    168   2e-46    
dbj|BAM20457.1|  ccr4-associated factor                                 168   2e-46    
ref|XP_007150040.1|  hypothetical protein PHAVU_005G121100g             168   2e-46    
ref|XP_001601395.1|  PREDICTED: CCR4-NOT transcription complex su...    168   2e-46    
ref|XP_010683623.1|  PREDICTED: probable CCR4-associated factor 1...    168   2e-46    
ref|XP_009131865.1|  PREDICTED: probable CCR4-associated factor 1...    167   2e-46    
ref|XP_008206873.1|  PREDICTED: CCR4-NOT transcription complex su...    168   2e-46    
gb|EWM25650.1|  ccr4-associated factor                                  169   2e-46    
ref|XP_011501465.1|  PREDICTED: CCR4-NOT transcription complex su...    168   3e-46    
gb|EHJ70264.1|  hypothetical protein KGM_18080                          168   3e-46    
ref|XP_011299715.1|  PREDICTED: CCR4-NOT transcription complex su...    167   3e-46    
ref|XP_003693870.1|  PREDICTED: CCR4-NOT transcription complex su...    168   3e-46    
emb|CDY47299.1|  BnaA06g38950D                                          167   3e-46    
ref|XP_008798872.1|  PREDICTED: probable CCR4-associated factor 1...    167   3e-46    
gb|EHJ70265.1|  ccr4-associated factor                                  167   3e-46    
ref|XP_009126529.1|  PREDICTED: probable CCR4-associated factor 1...    167   3e-46    
ref|NP_001071670.1|  CNOT7/8 protein                                    167   3e-46    
ref|XP_008387054.1|  PREDICTED: probable CCR4-associated factor 1...    167   3e-46    
emb|CCU99951.1|  unnamed protein product                                168   3e-46    
ref|XP_003424663.1|  PREDICTED: CCR4-NOT transcription complex su...    168   3e-46    
ref|XP_001731698.1|  hypothetical protein MGL_0966                      167   3e-46    
ref|XP_011135448.1|  PREDICTED: CCR4-NOT transcription complex su...    167   3e-46    
ref|XP_638651.1|  CAF1 family protein                                   169   4e-46    
ref|XP_008206772.1|  PREDICTED: CCR4-NOT transcription complex su...    167   4e-46    
ref|XP_011501464.1|  PREDICTED: CCR4-NOT transcription complex su...    168   4e-46    
gb|KFM79896.1|  CCR4-NOT transcription complex subunit 7                167   4e-46    
ref|XP_007346111.1|  CAF1-domain-containing protein                     167   4e-46    
ref|XP_003491312.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    168   4e-46    
emb|CDY35673.1|  BnaC02g09390D                                          166   4e-46    
ref|XP_011299712.1|  PREDICTED: CCR4-NOT transcription complex su...    167   4e-46    
ref|XP_002403308.1|  CCR4-associated factor, putative                   168   4e-46    
ref|XP_009405313.1|  PREDICTED: probable CCR4-associated factor 1...    166   5e-46    
ref|XP_009396725.1|  PREDICTED: probable CCR4-associated factor 1...    166   5e-46    
ref|XP_002323399.1|  hypothetical protein POPTR_0016s07390g             167   5e-46    
ref|XP_008449941.1|  PREDICTED: probable CCR4-associated factor 1...    166   5e-46    
emb|CDY09125.1|  BnaA02g05510D                                          166   5e-46    
dbj|BAM18477.1|  ccr4-associated factor                                 167   6e-46    
ref|XP_011044042.1|  PREDICTED: probable CCR4-associated factor 1...    166   6e-46    
ref|XP_006286717.1|  hypothetical protein CARUB_v10002891mg             166   6e-46    
ref|XP_011441179.1|  PREDICTED: CCR4-NOT transcription complex su...    167   7e-46    
ref|XP_008243475.1|  PREDICTED: probable CCR4-associated factor 1...    166   7e-46    
dbj|GAM18889.1|  hypothetical protein SAMD00019534_020640               168   7e-46    
ref|XP_010535711.1|  PREDICTED: probable CCR4-associated factor 1...    166   8e-46    
ref|XP_002061857.1|  GK17222                                            166   9e-46    
ref|XP_010306411.1|  PREDICTED: CCR4-NOT transcription complex su...    166   9e-46    
ref|XP_010932240.1|  PREDICTED: probable CCR4-associated factor 1...    166   1e-45    
ref|XP_006404478.1|  hypothetical protein EUTSA_v10010623mg             166   1e-45    
ref|XP_004488564.1|  PREDICTED: probable CCR4-associated factor 1...    166   1e-45    
ref|XP_006481554.1|  PREDICTED: probable CCR4-associated factor 1...    166   1e-45    
ref|XP_007899528.1|  PREDICTED: CCR4-NOT transcription complex su...    166   1e-45    
ref|XP_011299711.1|  PREDICTED: CCR4-NOT transcription complex su...    167   1e-45    
ref|XP_004497679.1|  PREDICTED: probable CCR4-associated factor 1...    165   1e-45    
ref|XP_003703401.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    167   2e-45    
ref|XP_007379942.1|  ribonuclease CAF1                                  164   2e-45    
ref|XP_002679115.1|  predicted protein                                  166   2e-45    
gb|ENN73721.1|  hypothetical protein YQE_09671                          165   2e-45    
gb|EXX67656.1|  Pop2p                                                   168   2e-45    
ref|XP_007202414.1|  hypothetical protein PRUPE_ppa009651mg             165   2e-45    
ref|XP_002309398.1|  hypothetical protein POPTR_0006s22200g             165   2e-45    
ref|XP_009081324.1|  PREDICTED: CCR4-NOT transcription complex su...    165   2e-45    
gb|EMS21915.1|  CCR4-NOT transcription complex subunit 7/8              165   3e-45    
gb|KFP89058.1|  CCR4-NOT transcription complex subunit 8                165   3e-45    
ref|XP_008930052.1|  PREDICTED: CCR4-NOT transcription complex su...    165   3e-45    
ref|XP_003970132.1|  PREDICTED: CCR4-NOT transcription complex su...    164   3e-45    
ref|XP_005810986.1|  PREDICTED: CCR4-NOT transcription complex su...    164   3e-45    
ref|XP_010525704.1|  PREDICTED: probable CCR4-associated factor 1...    164   3e-45    
ref|XP_007554812.1|  PREDICTED: CCR4-NOT transcription complex su...    164   3e-45    
ref|XP_975202.1|  PREDICTED: CCR4-NOT transcription complex subun...    164   4e-45    
gb|KFM77531.1|  CCR4-NOT transcription complex subunit 7                165   4e-45    
ref|XP_001957405.1|  GF10398                                            164   4e-45    
gb|KDR17086.1|  CCR4-NOT transcription complex subunit 7                166   4e-45    
ref|XP_001985184.1|  GH16922                                            165   4e-45    
ref|XP_008627167.1|  PREDICTED: CCR4-NOT transcription complex su...    164   4e-45    
ref|XP_010009453.1|  PREDICTED: CCR4-NOT transcription complex su...    164   5e-45    
ref|XP_008499798.1|  PREDICTED: CCR4-NOT transcription complex su...    164   5e-45    
ref|XP_002008770.1|  GI13677                                            165   5e-45    
ref|NP_001025789.1|  CCR4-NOT transcription complex subunit 8           164   5e-45    
ref|XP_007132477.1|  hypothetical protein PHAVU_011G097400g             164   5e-45    
ref|XP_005026245.1|  PREDICTED: CCR4-NOT transcription complex su...    164   5e-45    
ref|XP_008944762.1|  PREDICTED: CCR4-NOT transcription complex su...    164   5e-45    
ref|XP_002877329.1|  hypothetical protein ARALYDRAFT_484842             164   5e-45    
ref|XP_009940907.1|  PREDICTED: CCR4-NOT transcription complex su...    164   6e-45    
ref|XP_002024844.1|  GL17886                                            164   6e-45    
ref|NP_001089689.1|  CCR4-NOT transcription complex subunit 7           164   6e-45    
ref|XP_003455861.1|  PREDICTED: CCR4-NOT transcription complex su...    164   7e-45    
ref|XP_002048516.1|  GJ14014                                            164   8e-45    
ref|XP_006021193.1|  PREDICTED: CCR4-NOT transcription complex su...    164   8e-45    
ref|XP_005854806.1|  CCR4-NOT transcription complex subunit 7/8         168   8e-45    
ref|XP_003283707.1|  hypothetical protein DICPUDRAFT_20033              163   9e-45    
gb|ESA18671.1|  hypothetical protein GLOINDRAFT_75970                   162   9e-45    
ref|XP_004487463.1|  PREDICTED: uncharacterized protein LOC101496250    169   9e-45    
ref|XP_008331571.1|  PREDICTED: CCR4-NOT transcription complex su...    163   9e-45    
ref|XP_009484874.1|  PREDICTED: CCR4-NOT transcription complex su...    164   1e-44    
ref|XP_002735118.1|  PREDICTED: CCR4-NOT transcription complex su...    163   1e-44    
ref|XP_001363106.2|  PREDICTED: CCR4-NOT transcription complex su...    164   1e-44    
ref|XP_008490060.1|  PREDICTED: CCR4-NOT transcription complex su...    163   1e-44    
gb|AAF01500.1|L46722_1  BTG1 binding factor 1                           162   1e-44    



>gb|KJB68026.1| hypothetical protein B456_010G222500 [Gossypium raimondii]
Length=274

 Score =   305 bits (780),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 163/207 (79%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKL+QLGLTFSDEKGNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLVQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAMRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF+LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFSLINIYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSLEKYSGVLYGLGVENGQ  271



>ref|XP_002527306.1| ccr4-associated factor, putative [Ricinus communis]
 gb|EEF35058.1| ccr4-associated factor, putative [Ricinus communis]
Length=274

 Score =   304 bits (779),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 162/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNERGIDAMRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQL  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSLEKYAGVLYGLGVENGQ  271



>ref|XP_009605547.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Nicotiana 
tomentosiformis]
Length=275

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 162/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDEKGNLP CGT KYC WQ  FRE +P EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEKGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E GI+ +RFGELL SSGIVLND+V+WV FH GYD GYLLK+    +LP  Q 
Sbjct  125  GIDFTKNIEKGIDAKRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQDLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+N YFP +F IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  DFFTLMNVYFPVIFDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSLEKYAGVLYGLGVENGQ  271



>gb|KHG18085.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=300

 Score =   303 bits (775),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 163/207 (79%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKL+QLGLTFSDEKGNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  91   LKDNVDMLKLVQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQS  150

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  151  GIDFKKNNEKGIDAMRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNLPDTQV  210

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF+LIN YFP ++ IKH M++CNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  211  GFFSLINIYFPTLYDIKHLMKYCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFR  270

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  271  KLKENFFSGSLEKYSGVLYGLGVENGQ  297



>gb|KDP33530.1| hypothetical protein JCGZ_07101 [Jatropha curcas]
Length=275

 Score =   301 bits (772),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  66   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSIELLRQC  125

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSG+VLNDSV+WV FH GYD GYLLK+     LP  Q 
Sbjct  126  GIDFKKNNEKGIDVNRFGELLMSSGVVLNDSVYWVTFHSGYDFGYLLKLLTCRSLPDTQA  185

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  186  GFFDLINMYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  245

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +DNFF+GS E+  GVLYG GVENGQ
Sbjct  246  KLRDNFFNGSAEKYAGVLYGLGVENGQ  272



>ref|XP_002515442.1| ccr4-associated factor, putative [Ricinus communis]
 gb|EEF46891.1| ccr4-associated factor, putative [Ricinus communis]
Length=274

 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 160/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGEL+ SSGIVLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDVNRFGELMMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFDLINTYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +DNFF+GS E+  GVLYG GVENGQ
Sbjct  245  KLRDNFFNGSTEKYAGVLYGLGVENGQ  271



>ref|XP_007023404.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY26026.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 2 [Theobroma cacao]
Length=236

 Score =   300 bits (767),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 162/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  27   LKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQS  86

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  87   GIDFKKNNEKGIDAMRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQV  146

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF+LIN YFP ++ IKH M+FCNSL+G  NKLA LLEVERVG+ HQAGSDSL   CTF 
Sbjct  147  GFFSLINIYFPTLYDIKHLMKFCNSLYGGLNKLAELLEVERVGICHQAGSDSLLTSCTFM  206

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  207  KLKENFFSGSLEKYSGVLYGLGVENGQ  233



>ref|XP_011034532.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=274

 Score =   301 bits (770),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 163/207 (79%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFNLNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E+GI+  RFGELL SSGIVLND+V+WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNENGIDAVRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQNLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSLEKYAGVLYGLGVENGQ  271



>ref|XP_010089956.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
 gb|EXB38652.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
Length=276

 Score =   301 bits (770),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  67   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSIELLRQC  126

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  127  GIDFKKNNEKGIDVNRFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCQSLPDTQA  186

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  187  GFFDLINVYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  246

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FF+GS E+  GVLYG GVENGQ
Sbjct  247  KLRDTFFNGSTEKYAGVLYGLGVENGQ  273



>gb|KDP41983.1| hypothetical protein JCGZ_27001 [Jatropha curcas]
Length=274

 Score =   300 bits (768),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 163/207 (79%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLK+IQLGLTFSDE+GNLPTCGT K+C WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKMIQLGLTFSDEQGNLPTCGTGKFCIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E+GI+  +FGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNENGIDAMQFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSLEKYAGVLYGLGVENGQ  271



>ref|XP_007023403.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26025.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
Length=274

 Score =   300 bits (767),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 162/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAMRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF+LIN YFP ++ IKH M+FCNSL+G  NKLA LLEVERVG+ HQAGSDSL   CTF 
Sbjct  185  GFFSLINIYFPTLYDIKHLMKFCNSLYGGLNKLAELLEVERVGICHQAGSDSLLTSCTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSLEKYSGVLYGLGVENGQ  271



>ref|XP_004235935.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
Length=274

 Score =   299 bits (766),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLP CGT KYC WQ  FRE +P EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+ N E GI+ + F ELL SSGIVLNDSV WV FH GYD GYLLK+    +LP  Q 
Sbjct  125  GIDFKMNNEKGIDAKHFAELLMSSGIVLNDSVSWVTFHSGYDFGYLLKVLTCQDLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP +F IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFTLINVYFPVIFDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSL++  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSLDKYAGVLYGLGVENGQ  271



>ref|XP_009793121.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Nicotiana 
sylvestris]
Length=275

 Score =   299 bits (766),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 160/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDEKGNLP CGT KYC WQ  FRE +P EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEKGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E GI+ +RFGELL SSGIVLND+V+WV FH GYD GYLL +    +LP  Q 
Sbjct  125  GIDFTKNIEKGIDAKRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLNLLTCQDLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+N YFP +F IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  DFFTLMNVYFPVIFDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFS SLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSCSLEKYAGVLYGLGVENGQ  271



>ref|XP_006341359.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=274

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLP CGT KYC WQ  FRE +P EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+ N E G++ + F ELL SSGIVLNDSV WV FH GYD GYLLK+    +LP  Q 
Sbjct  125  GIDFKMNHEKGVDAKHFAELLMSSGIVLNDSVSWVTFHSGYDFGYLLKLLTCQDLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP +F IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFTLINVYFPVIFDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSL++  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSLDKYAGVLYGLGVENGQ  271



>ref|XP_002272165.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
 ref|XP_010655010.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=274

 Score =   298 bits (763),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQ+GLTFSDE+GNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQMGLTFSDEQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E GI+  RFGELL SSGIVLND+V+WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFMKNNEKGIDAVRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCKNLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFNLINMYFPVLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSLEKYAGVLYGLGVENGQ  271



>ref|XP_002324905.2| hypothetical protein POPTR_0018s02370g [Populus trichocarpa]
 gb|EEF03470.2| hypothetical protein POPTR_0018s02370g [Populus trichocarpa]
Length=277

 Score =   297 bits (761),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNVTEDIFASDSIELLRQC  127

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND V+WV FH GYD GYLLK+     LP  Q 
Sbjct  128  GIDFKKNSEMGIDVNRFGELLMSSGIVLNDGVNWVTFHSGYDFGYLLKLLTCRSLPDSQA  187

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVER+GV HQAGSDSL    TF+
Sbjct  188  GFFDLINMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSSTFK  247

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KDNFFSGS E+  GVLYG GVENGQ
Sbjct  248  KLKDNFFSGSTEKYAGVLYGLGVENGQ  274



>gb|KJB68416.1| hypothetical protein B456_010G244300 [Gossypium raimondii]
Length=274

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT  +C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDSFCIWQFNFREFNLSEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSG+VLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDVTRFGELLMSSGVVLNDDVHWVTFHSGYDFGYLLKLLTCRSLPDSQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFDLIKIYFPMVYDIKHMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +DNFF+GS E+  GVLYG GV+NGQ
Sbjct  245  KLRDNFFNGSTEKYAGVLYGLGVQNGQ  271



>ref|XP_011020623.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=274

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VD+LKLIQLGLTFSD++GNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDVLKLIQLGLTFSDDQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G D  KN E+GI+  RFGELL SSGIVLNDSV+WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDLNKNNENGIDAVRFGELLMSSGIVLNDSVYWVTFHSGYDFGYLLKLLTCQNLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVER+G+ HQAGSDSL   CTFR
Sbjct  185  GFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSLEKYAGVLYGLGVENGQ  271



>ref|XP_011036659.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=277

 Score =   296 bits (757),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNVTEDIFASDSIELLRQC  127

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND V+WV FH GYD GYLLK+     LP  Q 
Sbjct  128  GIDFKKNSEMGIDVNRFGELLMSSGIVLNDGVNWVTFHSGYDFGYLLKLLTCRSLPDSQA  187

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVER+GV HQAGSDSL    TF+
Sbjct  188  GFFDLINMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSSTFK  247

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KDNFFSGS ++  GVLYG GVENGQ
Sbjct  248  KLKDNFFSGSTKKYAGVLYGLGVENGQ  274



>ref|XP_011082241.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=272

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 160/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VD+LKLIQLGLTFSDEKGNLP CGT KYC WQ  FRE +P EDV A DSIE LRQ 
Sbjct  65   LKDNVDLLKLIQLGLTFSDEKGNLPDCGTDKYCIWQFNFREFNPNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF +N E GI+ RRF ELL SSGIVLN++V+WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFARNNEKGIDSRRFAELLMSSGIVLNNNVYWVTFHSGYDFGYLLKLLTCQNLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+F NSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFTLINIYFPVLYDIKHLMKFSNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVE+GQ
Sbjct  245  KLKENFFSGSLEKYSGVLYGLGVESGQ  271



>ref|XP_003526204.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Glycine 
max]
Length=273

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT   C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGTESTCIWQFNFREFNISEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNSEKGIDVNRFGELLMSSGIVLNDAVHWVTFHSGYDFGYLLKLLTCRSLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFDLIKMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FFSGS E+  GVLYG GVE+GQ
Sbjct  245  KLRDAFFSGSTEKYAGVLYGLGVESGQ  271



>ref|XP_007023407.1| CCR4-associated factor 1 [Theobroma cacao]
 gb|EOY26029.1| CCR4-associated factor 1 [Theobroma cacao]
Length=356

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GNLPTC T KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEEGNLPTCATDKYCIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAMRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF+LIN YFP ++ IKH M+F NSL+G  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFSLINIYFPTLYDIKHLMKFSNSLYGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSLEKYSGVLYGLGVENGQ  271



>ref|XP_007023408.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007023409.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26030.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26031.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
Length=274

 Score =   294 bits (753),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 160/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLT SD++GNLPTCGT KYC WQ  F E +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTLSDDQGNLPTCGTDKYCIWQFNFCEFNVNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAMRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF+LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  EFFSLINIYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG G+ENGQ
Sbjct  245  KLKENFFSGSLEKYSGVLYGLGIENGQ  271



>gb|KJB66334.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
 gb|KJB66335.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
 gb|KJB66336.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
Length=271

 Score =   294 bits (753),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDEKGNLPTCGT KYC WQ  F E +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFCEFNVDEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLNDSV+WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAMRFGELLISSGIVLNDSVYWVTFHSGYDFGYLLKLLTCQNLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFNLINIYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSG+LE+  GVLYG GVEN  
Sbjct  245  KLKENFFSGTLEKYSGVLYGLGVENAH  271



>ref|XP_007215794.1| hypothetical protein PRUPE_ppa009874mg [Prunus persica]
 gb|EMJ16993.1| hypothetical protein PRUPE_ppa009874mg [Prunus persica]
Length=274

 Score =   294 bits (753),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GNLPTCGT K+C WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKHCIWQFNFREFNLNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAKRFGELLMSSGIVLNDTVHWVTFHSGYDFGYLLKLLTCQNLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  EFFNLINIYFPTIYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            K K++FFSGSLE+  GVLYG GVEN
Sbjct  245  KLKESFFSGSLEKYAGVLYGLGVEN  269



>ref|XP_009760590.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
Length=275

 Score =   294 bits (753),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 161/208 (77%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VD+LKLIQLGLTFSDE GNLP CGT KYC WQ  F + +P EDV A DSIE LRQ 
Sbjct  65   LKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND+V+WV FH GYD GYLLKI    +LP  Q 
Sbjct  125  GIDFKKNIEKGIDATRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKILTCQDLPDTQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP VF IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFNLINMYFPVVFDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXG-VENGQ  155
            K K+NFFSGS+E+  GVLYG G VENGQ
Sbjct  245  KLKENFFSGSMEKYAGVLYGLGVVENGQ  272



>ref|XP_007136961.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 ref|XP_007136962.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 gb|ESW08955.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 gb|ESW08956.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
Length=273

 Score =   294 bits (752),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCG+   C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGSESPCIWQFNFREFNISEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNSEKGIDVNRFGELLMSSGIVLNDAVHWVTFHSGYDFGYLLKLLTCRSLPDTQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFDLIKMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FF+GS E+  GVLYG GVENGQ
Sbjct  245  KLRDTFFNGSTEKYSGVLYGLGVENGQ  271



>ref|XP_002309667.1| hypothetical protein POPTR_0006s27840g [Populus trichocarpa]
 gb|EEE93190.1| hypothetical protein POPTR_0006s27840g [Populus trichocarpa]
Length=277

 Score =   294 bits (752),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  +D+ A DSIE LRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNVTKDIFASDSIELLRQC  127

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+ N E GI+  +FGELL SSGIVLND VHWV FH GYD GYLLK+     LP    
Sbjct  128  GIDFKMNNEKGIDVNQFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDTPA  187

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVER+GV HQAGSDSL   CTFR
Sbjct  188  GFFDLINMYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSCTFR  247

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +DNFF+GS E+  GVLYG GVENGQ
Sbjct  248  KLRDNFFNGSAEKYAGVLYGLGVENGQ  274



>gb|KHG16599.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=270

 Score =   293 bits (751),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 158/206 (77%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT  +C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDSFCIWQFNFREFNLSEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSG+VLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDVKRFGELLMSSGVVLNDDVHWVTFHSGYDFGYLLKLLTCRSLPDSQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFDLIKIYFPMVYDIKHMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K +DNFF+GS ++  GVLYG GV+NG
Sbjct  245  KLRDNFFNGSTKKYAGVLYGLGVQNG  270



>ref|XP_003522433.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Glycine 
max]
Length=273

 Score =   293 bits (751),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT   C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGTESPCIWQFNFREFNVSEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E+GI+  RFGELL SSGIVLNDSV WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNSENGIDVNRFGELLMSSGIVLNDSVRWVTFHSGYDFGYLLKLLTCRSLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFDLIKMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FFSGS E+  GVLYG GVE+GQ
Sbjct  245  KLRDTFFSGSTEKYAGVLYGLGVESGQ  271



>ref|XP_008228784.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
 ref|XP_008228785.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
 ref|XP_008228786.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
Length=274

 Score =   293 bits (751),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 160/206 (78%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GNLPTCGT K+C WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKHCIWQFNFREFNLNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +R GELL SSGIVLNDSVHWV FH GYD GYL+K+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAKRLGELLMSSGIVLNDSVHWVTFHSGYDFGYLIKLLTCHNLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  EFFNLINIYFPTIYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K++FFSGSLE+  GVLYG GVENG
Sbjct  245  KLKESFFSGSLEKYAGVLYGLGVENG  270



>gb|KJB55043.1| hypothetical protein B456_009G061200 [Gossypium raimondii]
Length=274

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT   C WQ  F E +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDSSCIWQFNFCEFNISEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDVKRFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDNQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFDLINMYFPMLYDIKHMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +DNFF+GS E+  GVLYG GVE+GQ
Sbjct  245  KLRDNFFNGSTEKYAGVLYGLGVESGQ  271



>ref|XP_002303842.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa]
 ref|XP_006385927.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
 gb|EEE78821.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa]
 gb|ERP63724.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
Length=274

 Score =   293 bits (749),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 160/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VD+LKLIQLGLTFSD++GNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDVLKLIQLGLTFSDDQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G D  KN E+GI+  RFGELL SSGIVLNDSV+WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDLNKNNENGIDAVRFGELLMSSGIVLNDSVYWVTFHSGYDFGYLLKLLTCQNLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVER+G+ HQAGSDSL   CTFR
Sbjct  185  GFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFS SLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSCSLEKYAGVLYGLGVENGQ  271



>emb|CDO98220.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   293 bits (749),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 159/208 (76%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LKD VD+LKLIQLGLTFSDEKGNLP CG   KYC WQ  FRE +P EDV A DSIE LRQ
Sbjct  65   LKDNVDLLKLIQLGLTFSDEKGNLPKCGVDNKYCTWQFNFREFNPNEDVFANDSIELLRQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN E GI+ + FGELL SSGIVLND+V+WV FH GYD GYLLK+     LP  Q
Sbjct  125  SGFDFAKNNEKGIDAKHFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQNLPDTQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTF
Sbjct  185  AEFFTLINIYFPVIYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  245  RKLKENFFSGSLEKYTGVLYGLGVENGQ  272



>ref|XP_010665982.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Beta 
vulgaris subsp. vulgaris]
Length=272

 Score =   292 bits (748),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 159/206 (77%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VDMLKLIQLGLTFSDEKGNLPTCGT K+C WQ  FRE D  EDV A DSIE L+QC
Sbjct  67   LKENVDMLKLIQLGLTFSDEKGNLPTCGTDKFCIWQFNFREFDVGEDVYASDSIELLKQC  126

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DFEKN E GI+  RF ELL SSGIVLNDS+ WV FH GYD GYLLK+    +LP  Q 
Sbjct  127  GIDFEKNSEMGIDSNRFAELLMSSGIVLNDSIKWVTFHSGYDFGYLLKLLTCRDLPETQS  186

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVER+G+ HQAGSDSL   CTF 
Sbjct  187  GFFNLINIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTCCTFM  246

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+NFF+GS E+  GVLYG GVE+G
Sbjct  247  KLKENFFNGSTEKYAGVLYGLGVEDG  272



>ref|XP_003530297.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Glycine max]
 ref|XP_003530298.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
2 [Glycine max]
 gb|KHN04172.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=277

 Score =   292 bits (748),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 161/209 (77%), Gaps = 2/209 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCG--TXKYCXWQXXFREXDPXEDVXAXDSIEXLR  602
            LKD VDMLKLIQLGLTFSDE GNLPTCG  +   C WQ  FRE +  EDV A DSIE LR
Sbjct  66   LKDNVDMLKLIQLGLTFSDEHGNLPTCGDESGTCCIWQFNFREFNVNEDVFANDSIELLR  125

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            Q G DF++N E+GI+  RFGELL SSGIVLND+VHWV FH GYD GYLLK+    +LP  
Sbjct  126  QSGIDFKRNNENGIDAHRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQDLPDT  185

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
            Q GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CT
Sbjct  186  QVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCT  245

Query  241  FRKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            FRK KDNFFSGSLE+  GVLYG GVENGQ
Sbjct  246  FRKLKDNFFSGSLEKYAGVLYGLGVENGQ  274



>ref|XP_004305482.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   292 bits (747),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 160/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+D VD+LKLIQLGLTFSDE+GNLPTCGT + C WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LRDNVDVLKLIQLGLTFSDEEGNLPTCGTDQQCIWQFNFREFNLNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ + FGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAKLFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKVLTCQNLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFNLINIYFPTIYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENG 
Sbjct  245  KLKENFFSGSLEKYAGVLYGLGVENGH  271



>ref|XP_009594641.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
tomentosiformis]
Length=275

 Score =   291 bits (746),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 161/208 (77%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VD+LKLIQLGLTFSDE GNLP CGT KY  WQ  F + +P EDV A DSIE LRQ 
Sbjct  65   LKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYYIWQFNFCDFNPNEDVYANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLND+V+WV FH GYD GYLLKI    +LP  Q 
Sbjct  125  GIDFKKNIEKGIDAKRFGELLMSSGIVLNDTVYWVTFHSGYDFGYLLKILTCQDLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP VF IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFNLINMYFPVVFDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXG-VENGQ  155
            K K+NFFSGS+E+  GVLYG G VENGQ
Sbjct  245  KLKENFFSGSMEKYAGVLYGLGVVENGQ  272



>ref|XP_008445259.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Cucumis 
melo]
Length=274

 Score =   291 bits (745),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD V+MLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +   D+ A DSIE LRQC
Sbjct  65   LKDNVEMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGSDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSG+VLND V+WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFQKNNEEGIDVNRFGELLMSSGVVLNDDVNWVTFHSGYDFGYLLKLLTCRGLPNDQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVER+GV HQAGSDSL   CTFR
Sbjct  185  GFFELINVYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FF+GS+++  GVLYG GVENGQ
Sbjct  245  KLRDTFFNGSIQKYAGVLYGLGVENGQ  271



>ref|XP_008375521.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
 ref|XP_008375525.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=274

 Score =   291 bits (745),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GN P+CGT K C WQ  FRE +  EDV + DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEQGNFPSCGTDKQCIWQFNFREFNLNEDVFSSDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLND+VHWV FH GYD GYLLK+      P  Q 
Sbjct  125  GIDFKKNNEKGIDAKRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNSPQTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP+++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFNLINIYFPKIYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K++FFSGS+E+  GVLYG GV+NGQ
Sbjct  245  KLKESFFSGSMEKYAGVLYGLGVDNGQ  271



>ref|XP_010092187.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
 gb|EXB50413.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
Length=277

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 158/207 (76%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LKD VDMLKLIQLGLTFSDE GNLP CG   +YC WQ  FRE +  EDV A DSIE LRQ
Sbjct  65   LKDNVDMLKLIQLGLTFSDEHGNLPACGASGEYCIWQFNFREFNVNEDVFANDSIELLRQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G D +KN E GI+ +RFGELL SSGIVLNDSVHWV FH GYD GYLLK+    +LP  Q
Sbjct  125  SGIDLKKNNEEGIDAKRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQDLPDTQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   C F
Sbjct  185  AGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCAF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
            RK K+NFFSGSLE+  GVLYG GVENG
Sbjct  245  RKLKENFFSGSLEKYAGVLYGLGVENG  271



>ref|XP_004138705.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
2 [Cucumis sativus]
 ref|XP_004160760.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
2 [Cucumis sativus]
Length=236

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD V+MLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +   D+ A DSIE LRQC
Sbjct  27   LKDNVEMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGSDIFASDSIELLRQC  86

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSG+VLND V+WV FH GYD GYLLK+     LP  Q 
Sbjct  87   GIDFQKNNEEGIDVNRFGELLMSSGVVLNDDVNWVTFHSGYDFGYLLKLLTCRGLPNDQA  146

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVER+GV HQAGSDSL   CTFR
Sbjct  147  GFFELINVYFPVLYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFR  206

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FF+GS+++  GVLYG GVENGQ
Sbjct  207  KLRDTFFNGSIQKYAGVLYGLGVENGQ  233



>gb|ACU24625.1| unknown [Glycine max]
Length=277

 Score =   290 bits (743),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 160/209 (77%), Gaps = 2/209 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCG--TXKYCXWQXXFREXDPXEDVXAXDSIEXLR  602
            LKD VDMLKLIQLGLTFSDE GNLPTCG  +   C WQ  FRE +  EDV A DSIE LR
Sbjct  66   LKDNVDMLKLIQLGLTFSDEHGNLPTCGDESGTCCIWQFNFREFNVNEDVFANDSIELLR  125

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            Q G DF++N E+GI+  RFGELL SSGIVLND+VHWV FH GYD GYLLK+    +LP  
Sbjct  126  QSGIDFKRNNENGIDAHRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQDLPDT  185

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
            Q GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDS    CT
Sbjct  186  QVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSFLTSCT  245

Query  241  FRKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            FRK KDNFFSGSLE+  GVLYG GVENGQ
Sbjct  246  FRKLKDNFFSGSLEKYAGVLYGLGVENGQ  274



>ref|XP_004138704.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Cucumis sativus]
 ref|XP_004160759.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Cucumis sativus]
 gb|KGN62988.1| hypothetical protein Csa_2G382610 [Cucumis sativus]
Length=274

 Score =   290 bits (743),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD V+MLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +   D+ A DSIE LRQC
Sbjct  65   LKDNVEMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGSDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSG+VLND V+WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFQKNNEEGIDVNRFGELLMSSGVVLNDDVNWVTFHSGYDFGYLLKLLTCRGLPNDQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVER+GV HQAGSDSL   CTFR
Sbjct  185  GFFELINVYFPVLYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FF+GS+++  GVLYG GVENGQ
Sbjct  245  KLRDTFFNGSIQKYAGVLYGLGVENGQ  271



>ref|XP_010648684.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
 ref|XP_010648686.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=273

 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSD  GNLPTCGT K C WQ  FRE D  EDV A DSI+ L++C
Sbjct  65   LKDNVDMLKLIQLGLTFSDANGNLPTCGTDKLCIWQFNFREFDVTEDVFASDSIQMLQEC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  +FGELL SSGIVLND+V WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GMDFKKNNEKGIDVNQFGELLMSSGIVLNDNVSWVTFHSGYDFGYLLKLLTRRSLPGTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFDLINMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D+FF+GS E+  GVLYG GVE GQ
Sbjct  245  KLRDSFFNGSTEKYAGVLYGLGVETGQ  271



>ref|XP_011039582.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=277

 Score =   290 bits (742),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT K C WQ  FRE +  +D+ A DSIE LRQC
Sbjct  68   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKSCIWQFNFREFNVTKDIFASDSIELLRQC  127

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+ N E GI+  +FGELL SSGIVLND VHWV FH GYD GYLLK+     LP    
Sbjct  128  GIDFKMNNEKGIDVNQFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDTPA  187

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVER+GV HQAGSDSL   CTFR
Sbjct  188  GFFDLINMYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSCTFR  247

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +DNFF+GS  +  GVLYG GVENGQ
Sbjct  248  KLRDNFFNGSAVKYAGVLYGLGVENGQ  274



>emb|CAN79806.1| hypothetical protein VITISV_031504 [Vitis vinifera]
Length=270

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSD  GNLPTCGT K C WQ  FRE D  EDV A DSI+ L++C
Sbjct  62   LKDNVDMLKLIQLGLTFSDANGNLPTCGTDKLCIWQFNFREFDVTEDVFASDSIQMLQEC  121

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  +FGELL SSGIVLND+V WV FH GYD GYLLK+     LP  Q 
Sbjct  122  GMDFKKNNEKGIDVNQFGELLMSSGIVLNDNVSWVTFHSGYDFGYLLKLLTRRSLPGTQA  181

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  182  GFFDLINMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  241

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D+FF+GS E+  GVLYG GVE GQ
Sbjct  242  KLRDSFFNGSTEKYAGVLYGLGVETGQ  268



>gb|EYU24608.1| hypothetical protein MIMGU_mgv1a011718mg [Erythranthe guttata]
Length=272

 Score =   290 bits (741),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 158/206 (77%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VD+LKLIQLGLTFSDEKGNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDLLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFNLNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN ++GI+ RRFGELL SSGIVLND+V WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFAKNKDNGIDARRFGELLMSSGIVLNDNVVWVTFHSGYDFGYLLKVLTCQNLPDTQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP ++ IKH M+F NSLHG  NKLA LL+VERVG+ HQAGSDSL   CTFR
Sbjct  185  AFFNLINLYFPVLYDIKHLMKFSNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+NFFSGS++   GVLYG GVENG
Sbjct  245  KLKENFFSGSMDRYSGVLYGLGVENG  270



>ref|XP_009354185.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=274

 Score =   290 bits (741),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 161/207 (78%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GN P+CGT K C WQ  FRE +  +DV + DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEQGNFPSCGTDKQCIWQFNFREFNLNKDVFSSDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLND+VHWV FH GYD GYLLK+      P  Q 
Sbjct  125  GIDFKKNNEKGIDAKRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNSPQTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP+++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFNLINIYFPKIYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K++FFSGS+E+  GVLYG GV+NGQ
Sbjct  245  KLKESFFSGSMEKYAGVLYGLGVDNGQ  271



>ref|XP_007011965.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Theobroma cacao]
 gb|EOY29584.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Theobroma cacao]
Length=274

 Score =   290 bits (741),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSD+KGNLPTCGT K+C WQ  FRE DP EDV A DSIE L Q 
Sbjct  65   LKANVDLLKLIQLGLTFSDDKGNLPTCGTDKFCVWQFNFREFDPNEDVYANDSIELLSQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G+   RF ELL SSG+VLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNKEKGVSAHRFSELLMSSGVVLNDSVHWVTFHSGYDFGYLLKLLTCKNLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF+LI+ YFP ++ IKH M+FCNSLHG  NKLA LL+VER+G+ HQAGSDSL   CTF 
Sbjct  185  EFFSLIDIYFPTLYDIKHLMKFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTSCTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGS E+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSTEKYAGVLYGLGVENGQ  271



>gb|KJB07590.1| hypothetical protein B456_001G031500 [Gossypium raimondii]
Length=274

 Score =   290 bits (741),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSD KGNLPTCGT KYC WQ  FRE DP EDV A DSIE L Q 
Sbjct  65   LKANVDLLKLIQLGLTFSDAKGNLPTCGTDKYCVWQFNFREFDPNEDVYANDSIELLSQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI    F ELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFQKNKEKGISAHDFSELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCKNLPETQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF+LI  YFP ++ IKH M+FCNSLHG  NKLA LLEVER+G+ HQAGSDSL   CTF 
Sbjct  185  GFFSLIKIYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTCCTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGS E+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSAEKYAGVLYGLGVENGQ  271



>ref|XP_010265638.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
 ref|XP_010265639.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
Length=274

 Score =   289 bits (740),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDE GNLPTCGT KYC WQ  FRE +  EDV A DSIE LR+ 
Sbjct  65   LKANVDMLKLIQLGLTFSDEAGNLPTCGTDKYCVWQFNFREFNVSEDVFANDSIELLRES  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLNDSV WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAHRFGELLMSSGIVLNDSVLWVTFHSGYDFGYLLKLLTCQNLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVER+G+ HQAGSDSL   CTFR
Sbjct  185  GFFNLIKMYFPNVYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KD FF+G  E+  GVLYG GVENGQ
Sbjct  245  KLKDAFFNGQTEKYAGVLYGLGVENGQ  271



>ref|XP_010275748.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
Length=274

 Score =   289 bits (740),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSDE GNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKANVDLLKLIQLGLTFSDEAGNLPTCGTDKYCVWQFNFREFNVSEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLNDSV WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAQRFGELLMSSGIVLNDSVLWVTFHSGYDFGYLLKLLTCQNLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVER+G+ HQAGSDSL   CTFR
Sbjct  185  GFFTLIKMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+ FF+G  E+  GVLYG GVENGQ
Sbjct  245  KLKEAFFNGQTEKYAGVLYGLGVENGQ  271



>ref|XP_011082251.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=276

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VD+LKLIQLGLTFSDEKGNLPTCGT K C WQ  F E +P EDV A DS+E LRQ 
Sbjct  65   LKDNVDLLKLIQLGLTFSDEKGNLPTCGTNKQCIWQFNFCEFNPNEDVFANDSVELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E GI+ +RFGELL SSGIVLN+ ++WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFVKNNEKGIDAKRFGELLMSSGIVLNNDMYWVTFHSGYDFGYLLKLLTRQNLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN +FP ++ IKH M+F NSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFTLINIFFPVLYDIKHLMKFSNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFF+GSLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFNGSLEKYSGVLYGLGVENGQ  271



>gb|KHN07034.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=274

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 156/208 (75%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT   C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGTESTCIWQFNFREFNISEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHX-GYDXGYLLKIXXXXELPXXQ  419
            G DF+KN E GI+  RFGELL SSGIVLNDSV WV FH  GYD GYLLK+     LP  Q
Sbjct  125  GIDFKKNSEKGIDVNRFGELLMSSGIVLNDSVRWVTFHSGGYDFGYLLKLLTCRSLPETQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTF
Sbjct  185  AGFFDLIKMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK +D FFSGS E+  GVLYG GVE+GQ
Sbjct  245  RKLRDAFFSGSTEKYAGVLYGLGVESGQ  272



>ref|XP_010532089.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010532090.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Tarenaya hassleriana]
Length=274

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDEKGNLPTCGT KYC WQ  FRE D   D+ A DSI+ LRQ 
Sbjct  65   LKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDLNSDIFARDSIDLLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN ++GI+ RR+ ELL SSGIVLN++VHWV FH GYD GYLLK+     LP    
Sbjct  125  GIDFAKNNDNGIDSRRYAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPEKAS  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF 
Sbjct  185  GFFELIKIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFW  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGS+E+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSMEKYSGVLYGLGVENGQ  271



>ref|XP_006356242.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=273

 Score =   288 bits (738),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 162/207 (78%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VD+LKLIQLGLTFSDE GNLP CGT KYC WQ  F + +P EDV A DSIE LRQ 
Sbjct  65   LKDNVDLLKLIQLGLTFSDENGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E+GI+ +RFGE+L SSGIVLND+V+WV FH GYD GYLLKI    +LP  Q+
Sbjct  125  GIDFKKNIENGIDAKRFGEILMSSGIVLNDNVYWVTFHSGYDFGYLLKILTCQDLPETQE  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ +KH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFNLINMYFPVLYDVKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXG-VENG  158
            K K+NFF GSLE+  GVLYG G VENG
Sbjct  245  KLKENFFIGSLEKYAGVLYGLGVVENG  271



>ref|XP_004507083.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer 
arietinum]
Length=277

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 159/209 (76%), Gaps = 2/209 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX--KYCXWQXXFREXDPXEDVXAXDSIEXLR  602
            LKD VDMLKLIQLGLTFSDE GNLP  G    ++C WQ  FRE +  EDV A DSIE LR
Sbjct  66   LKDNVDMLKLIQLGLTFSDEHGNLPKIGDDDDRFCIWQFNFREFNVNEDVFANDSIELLR  125

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            Q G DF+KN E GI+ RRFGELL SSGIVLND+VHWV FH GYD GYLLK+     LP  
Sbjct  126  QSGIDFKKNNEEGIDARRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNLPDT  185

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
            Q GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CT
Sbjct  186  QVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCT  245

Query  241  FRKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            FRK K+NFFSGS+E+  GVLYG GVENGQ
Sbjct  246  FRKLKENFFSGSMEKYAGVLYGLGVENGQ  274



>ref|XP_006857184.1| hypothetical protein AMTR_s00065p00182000 [Amborella trichopoda]
 gb|ERN18651.1| hypothetical protein AMTR_s00065p00182000 [Amborella trichopoda]
Length=274

 Score =   288 bits (738),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDE GNLPTCGT K+  WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKANVDMLKLIQLGLTFSDEDGNLPTCGTDKFYIWQFNFREFNVLEDVYANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAQRFGELLMSSGIVLNDTVHWVTFHSGYDFGYLLKLLTCQNLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LL+VER+G+ HQAGSDSL   CTFR
Sbjct  185  GFFGLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K++FF+GS E+  GVLYG GVENG 
Sbjct  245  KLKESFFNGSTEKYAGVLYGLGVENGN  271



>ref|XP_009390565.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   288 bits (738),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 158/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSD+ GNLPTCGT + C WQ  FRE D  +DV A DSI+ LRQ 
Sbjct  66   LKANVDMLKLIQLGLTFSDQLGNLPTCGTDRGCVWQFNFREFDIQQDVFASDSIDLLRQS  125

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  126  GIDFQKNNEKGIDSQRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQA  185

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG+ HQAGSDSL   C FR
Sbjct  186  GFFNLINIYFPTVYDIKHIMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCAFR  245

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K++FF+GS E+  GVLYG GVENGQ
Sbjct  246  KLKESFFNGSTEKYAGVLYGLGVENGQ  272



>ref|XP_010532085.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Tarenaya 
hassleriana]
Length=274

 Score =   288 bits (738),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDEKGNLPTCGT KYC WQ  FRE D   D+ A DSIE L Q 
Sbjct  65   LKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDLTSDIFARDSIELLHQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN ++GI+ RR+ ELL SSGIVLN++VHWV FH GYD GYLLK+     LP    
Sbjct  125  GIDFAKNKDNGIDSRRYAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPEKAS  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF 
Sbjct  185  GFFELIKIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFW  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGS+E+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGSMEKYSGVLYGLGVENGQ  271



>ref|XP_004241682.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Solanum 
lycopersicum]
Length=274

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 162/207 (78%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VD+LKLIQLGLTFSDE GNLP CGT KYC WQ  F + +P EDV A DSIE LRQ 
Sbjct  65   LKDNVDLLKLIQLGLTFSDEDGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E+GI+ +RFGE+L SSGIVLND+V+WV FH GYD GYLLKI    +LP  Q+
Sbjct  125  GIDFKKNIENGIDAKRFGEILMSSGIVLNDNVYWVTFHSGYDFGYLLKILTCQDLPETQE  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ +KH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFNLINMYFPVLYDVKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXG-VENG  158
            K K+NFF GSLE+  GVLYG G VENG
Sbjct  245  KLKENFFIGSLEKYAGVLYGLGVVENG  271



>ref|XP_010691601.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Beta 
vulgaris subsp. vulgaris]
Length=274

 Score =   288 bits (736),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GNLPTCGT ++C WQ  F E +  EDV A DSI+ LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEQGNLPTCGTEQFCIWQFNFCEFNLNEDVFAHDSIQLLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN + GI   RFGELL SSG+VLND+VHW+ FH GYD GYLLK+     LP  Q+
Sbjct  125  GIDFQKNNDRGINALRFGELLMSSGVVLNDNVHWITFHSGYDFGYLLKLLTCQNLPDTQR  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVER+GV HQAGSDSL   CTFR
Sbjct  185  EFFHLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGVSHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KDNFFSGS+E+  GVLYG G +NGQ
Sbjct  245  KLKDNFFSGSMEKYAGVLYGLGSDNGQ  271



>gb|KHF99352.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
 gb|KHG05538.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=327

 Score =   289 bits (740),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLP+CGT   C WQ  F E +  ED+ A DSIE LRQC
Sbjct  118  LKDNVDMLKLIQLGLTFSDENGNLPSCGTDSSCIWQFNFCEFNISEDIFASDSIELLRQC  177

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  178  GIDFKKNNEKGIDVKRFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDNQA  237

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  238  RFFDLINMYFPMLYDIKHMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  297

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +DNFF+GS E+  GVLYG GVE+GQ
Sbjct  298  KLRDNFFNGSTEKYAGVLYGLGVESGQ  324



>gb|KHG00404.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=274

 Score =   287 bits (734),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSD KGNLPTCGT KYC WQ  FRE DP EDV A DSIE L Q 
Sbjct  65   LKANVDLLKLIQLGLTFSDAKGNLPTCGTDKYCVWQFNFREFDPNEDVYANDSIELLSQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI    F ELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFQKNKEKGISSHDFSELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCKNLPETQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF+LI  YFP ++ IKH M+FCNSLHG  NKLA LLEVER+G+ HQAGSDSL   CTF 
Sbjct  185  GFFSLIKIYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTCCTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSG  E+  GVLYG GVENGQ
Sbjct  245  KLKENFFSGLAEKYAGVLYGLGVENGQ  271



>ref|XP_010048142.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 ref|XP_010048359.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW80304.1| hypothetical protein EUGRSUZ_C01665 [Eucalyptus grandis]
 gb|KCW80609.1| hypothetical protein EUGRSUZ_C01976 [Eucalyptus grandis]
Length=274

 Score =   287 bits (734),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 156/206 (76%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VDMLKLIQLGLTFSDE GNLPTCGT KYC WQ  FRE +  ED+ A DSIE LR+C
Sbjct  65   LKNNVDMLKLIQLGLTFSDENGNLPTCGTDKYCIWQFNFREFNVTEDMFAGDSIELLREC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G++ RRFGELL SSGIVLN  VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNTEKGVDVRRFGELLMSSGIVLNADVHWVTFHSGYDFGYLLKLLTCRSLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVER GV HQAGSDSL   CTF 
Sbjct  185  GFFDLINIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERFGVCHQAGSDSLLTACTFL  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K +D FF+GS E+  GVLYG GVE+G
Sbjct  245  KLRDMFFNGSTEKYAGVLYGLGVEDG  270



>ref|XP_003531734.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X1 [Glycine max]
 ref|XP_006585611.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X2 [Glycine max]
Length=281

 Score =   287 bits (735),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 159/213 (75%), Gaps = 6/213 (3%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKY------CXWQXXFREXDPXEDVXAXDSI  614
            LKD VDMLKLIQLGLTFSDE GNLP CG          C WQ  FRE +  EDV A DSI
Sbjct  66   LKDNVDMLKLIQLGLTFSDEHGNLPMCGGDDEESDTCCCIWQFNFREFNVNEDVFANDSI  125

Query  613  EXLRQCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXE  434
            E LRQ G DF++N E+GI+  RFGELL SSGIVLND++HWV FH GYD GYLLK+    +
Sbjct  126  ELLRQSGIDFKRNNENGIDAHRFGELLMSSGIVLNDNIHWVTFHSGYDFGYLLKLLTCQD  185

Query  433  LPXXQQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLX  254
            LP  Q GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL 
Sbjct  186  LPDTQVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGISHQAGSDSLL  245

Query  253  XXCTFRKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
              CTFRK KDNFFSGSLE+  GVLYG GVENGQ
Sbjct  246  TSCTFRKLKDNFFSGSLEKYAGVLYGLGVENGQ  278



>ref|XP_010929136.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=275

 Score =   287 bits (734),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDE GNLPTCGT   C WQ  FRE D   D+ A DSIE LRQ 
Sbjct  66   LKANVDMLKLIQLGLTFSDESGNLPTCGTGHGCVWQFNFREFDVHHDIFASDSIELLRQS  125

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  126  GIDFKKNNERGIDTNRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQA  185

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG+ HQAGSDSL   CTFR
Sbjct  186  GFFNLIKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFR  245

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K++FF+GS E   GVLYG GVENGQ
Sbjct  246  KLKESFFNGSTERYAGVLYGLGVENGQ  272



>ref|XP_004291948.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   287 bits (734),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 155/206 (75%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT  +  WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGTENFFIWQFNFREFNVTEDIFAADSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RF ELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNSEKGIDVNRFAELLMSSGIVLNDAVHWVTFHSGYDFGYLLKLLTCRSLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LL+VER+GV HQAGSDSL   CTFR
Sbjct  185  GFFDLIKMYFPLVYDIKHMMKFCNSLHGGLNKLAELLDVERIGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K +D+FF+GS E+  GVLYG GVEN 
Sbjct  245  KLRDSFFNGSTEKYAGVLYGLGVENS  270



>ref|XP_003604226.1| Ribonuclease CAF1 [Medicago truncatula]
Length=277

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 159/208 (76%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCG-TXKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LKD VDMLKLIQLGLTFSDE GNLPTCG   ++C WQ  FRE +  EDV A DSIE LRQ
Sbjct  67   LKDNVDMLKLIQLGLTFSDEHGNLPTCGEDDRFCIWQFNFREFNVNEDVFANDSIELLRQ  126

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF+KN E GI+ RRFGELL SSGIVLND+VHW+ FH GYD GYLLK+     LP  Q
Sbjct  127  SGIDFKKNNEDGIDARRFGELLMSSGIVLNDNVHWITFHSGYDFGYLLKLLTCQNLPDTQ  186

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEV+RVG+ HQAGSDSL     F
Sbjct  187  VGFFNLINMYFPMLYDIKHLMKFCNSLHGGLNKLAELLEVKRVGICHQAGSDSLLTSSAF  246

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  247  RKLKENFFSGSLEKYAGVLYGLGVENGQ  274



>ref|XP_010942117.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=275

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDE GNLPTCGT + C WQ  FRE D   D+ A DSIE LRQ 
Sbjct  66   LKANVDMLKLIQLGLTFSDEFGNLPTCGTGRGCVWQFNFREFDAQRDIFASDSIELLRQS  125

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  126  GIDFKKNNERGIDASRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLSCQNLPDTQA  185

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  +FP V+ IKH M+FCNSLHG  NKLA LL+VERVG+ HQAGSDSL   CTFR
Sbjct  186  GFFNLIKIFFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFR  245

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K++FF+GS E   GVLYG GVENGQ
Sbjct  246  KLKESFFNGSTERYAGVLYGLGVENGQ  272



>ref|XP_006483458.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
 gb|KDO67487.1| hypothetical protein CISIN_1g023967mg [Citrus sinensis]
Length=274

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  +D+ A DS+E L QC
Sbjct  66   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNLIDDIFASDSVELLHQC  125

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND V WV FH GYD GYLLK+     LP  Q 
Sbjct  126  GIDFKKNNEKGIDVNRFGELLMSSGIVLNDVVRWVTFHSGYDFGYLLKLLTCRSLPDTQA  185

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  186  GFFELINMYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  245

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K ++NFF+G  E+  GVLYG GVEN +
Sbjct  246  KLRENFFNGCTEKYAGVLYGLGVENDK  272



>ref|XP_006427595.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 ref|XP_006427596.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 gb|ESR40835.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 gb|ESR40836.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
Length=274

 Score =   286 bits (731),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDE GNLPTCGT KYC WQ  FRE D  ED+ A DSIE L+Q 
Sbjct  65   LKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G +F KN E GI+  RFGEL+ SSGIVL+DS+HWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GINFTKNNEIGIDAMRFGELMMSSGIVLSDSMHWVTFHSGYDFGYLLKLLTCQNLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL    TFR
Sbjct  185  EFFNLIRIYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTASTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFS SLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSSSLEKYAGVLYGLGVENGQ  271



>ref|XP_006294779.1| hypothetical protein CARUB_v10023830mg [Capsella rubella]
 gb|EOA27677.1| hypothetical protein CARUB_v10023830mg [Capsella rubella]
Length=275

 Score =   285 bits (730),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V++LK+IQLGLTFSDEKGNLPTCGT  KYC WQ  FRE D   D+ A DSIE LRQ
Sbjct  65   LKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFDLESDIFATDSIELLRQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN + GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+     LP  Q
Sbjct  125  SGIDFAKNNQMGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPETQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF +IN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF
Sbjct  185  TGFFEMINVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK ++NFF GS+E+  GVLYG GVENGQ
Sbjct  245  RKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>ref|XP_009801027.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
 ref|XP_009801028.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
Length=274

 Score =   285 bits (729),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCG+ +YC WQ  FRE D   D+ A DSIE L Q 
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGSERYCIWQFNFREFDTSADIFANDSIELLMQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEMGIDAKRFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRTLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF L+N YFP V+ IKH M+FCNSLHG  NKLA LLE+ER+G+ HQAGSDSL   C F+
Sbjct  185  GFFDLLNVYFPLVYDIKHLMKFCNSLHGGLNKLAELLELERIGICHQAGSDSLLTSCAFK  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KDNFF+G+ E+  GVLYG GVE G 
Sbjct  245  KLKDNFFNGATEKYAGVLYGLGVEYGS  271



>ref|XP_010510101.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   285 bits (729),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V++LK+IQLGLTFSDEKGNLPTCG   KYC WQ  FRE D   D+ A DSIE LRQ
Sbjct  65   LKTNVNILKMIQLGLTFSDEKGNLPTCGPDNKYCIWQFNFREFDLESDIFATDSIELLRQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN E GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+    +LP  Q
Sbjct  125  SGIDFAKNNEMGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPETQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF +IN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF
Sbjct  185  TGFFEMINVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK ++NFF GS+E+  GVLYG GVENGQ
Sbjct  245  RKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>ref|XP_006465196.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
Length=274

 Score =   285 bits (728),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDE GNLPTCGT KYC WQ  FRE D  ED+ A DSIE L+Q 
Sbjct  65   LKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G +F KN E GI+  RFGE + SSGIVL+DS+HWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GINFTKNNEIGIDAMRFGEFMMSSGIVLSDSIHWVTFHSGYDFGYLLKLLTCQNLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL    TFR
Sbjct  185  EFFNLIRIYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTASTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFS SLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSSSLEKYAGVLYGLGVENGQ  271



>ref|XP_010541577.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 isoform 
X2 [Tarenaya hassleriana]
Length=238

 Score =   283 bits (725),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VDMLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +P ED+   +SI+ L QC
Sbjct  27   LKENVDMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNPSEDIYVNESIDLLHQC  86

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSG+VLND++ WV FH GYD GYLLK+     LP  Q 
Sbjct  87   GIDFKKNNEKGIDVKRFGELLMSSGVVLNDAMRWVTFHSGYDFGYLLKLLTCKALPVNQI  146

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+N YFP ++ IKH M+FCN+LHG  +KLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  147  EFFTLLNIYFPVIYDIKHMMKFCNNLHGGLSKLAELLEVERVGVSHQAGSDSLLTWCTFR  206

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K++FF GS+++  GVLYG GVENGQ
Sbjct  207  KLKESFFKGSMKKYAGVLYGLGVENGQ  233



>ref|XP_002862886.1| hypothetical protein ARALYDRAFT_920160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39145.1| hypothetical protein ARALYDRAFT_920160 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   283 bits (725),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V++LK+IQLGLTFSDEKGNLPTCGT  KYC WQ  FRE D   D+ A DSIE LRQ
Sbjct  42   LKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIELLRQ  101

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN + GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+     LP  Q
Sbjct  102  SGIDFAKNNQFGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPETQ  161

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF +I+ YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF
Sbjct  162  TGFFEMISVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  221

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK ++NFF GS+E+  GVLYG GVENGQ
Sbjct  222  RKLQENFFIGSMEKYSGVLYGLGVENGQ  249



>gb|ACU20942.1| unknown [Glycine max]
Length=281

 Score =   285 bits (728),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 158/213 (74%), Gaps = 6/213 (3%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKY------CXWQXXFREXDPXEDVXAXDSI  614
            LKD VDMLK IQLGLTFSDE GNLP CG          C WQ  FRE +  EDV A DSI
Sbjct  66   LKDNVDMLKPIQLGLTFSDEHGNLPMCGGDDEESDTCCCIWQFNFREFNVNEDVFANDSI  125

Query  613  EXLRQCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXE  434
            E LRQ G DF++N E+GI+  RFGELL SSGIVLND++HWV FH GYD GYLLK+    +
Sbjct  126  ELLRQSGIDFKRNNENGIDAHRFGELLMSSGIVLNDNIHWVTFHSGYDFGYLLKLLTCQD  185

Query  433  LPXXQQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLX  254
            LP  Q GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL 
Sbjct  186  LPDTQVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGISHQAGSDSLL  245

Query  253  XXCTFRKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
              CTFRK KDNFFSGSLE+  GVLYG GVENGQ
Sbjct  246  TSCTFRKLKDNFFSGSLEKYAGVLYGLGVENGQ  278



>ref|XP_010469632.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   284 bits (727),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V++LK+IQLGLTFSDEKGNLPTCG   KYC WQ  FRE D   D+ A DSIE LRQ
Sbjct  65   LKTNVNILKMIQLGLTFSDEKGNLPTCGADNKYCIWQFNFREFDLESDIFATDSIELLRQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN + GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+    +LP  Q
Sbjct  125  SGIDFAKNNQMGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPETQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF +IN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF
Sbjct  185  TGFFEMINVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK ++NFF GS+E+  GVLYG GVENGQ
Sbjct  245  RKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>gb|AFK43307.1| unknown [Lotus japonicus]
Length=274

 Score =   284 bits (727),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 157/207 (76%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GNLP+C     C WQ  FRE +  EDV A DSIE LRQ 
Sbjct  66   LKDNVDMLKLIQLGLTFSDEEGNLPSCDGSS-CIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E GI+ RRFGELL SSGIVLND++HWV FH GYD GYLLK+    +LP  Q 
Sbjct  125  GIDFSKNNEMGIDARRFGELLMSSGIVLNDNIHWVTFHSGYDFGYLLKLLTCQDLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF +IN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFNMINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGISHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  G+LYG G ENG 
Sbjct  245  KLKENFFSGSLEKYAGILYGLGCENGH  271



>ref|XP_011073341.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Sesamum 
indicum]
Length=270

 Score =   284 bits (726),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 157/206 (76%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ V++LKLIQLGLTFSDEKGNLPTCGT K+C WQ  FRE +P EDV A DSIE L Q 
Sbjct  65   LKENVNLLKLIQLGLTFSDEKGNLPTCGTDKFCIWQFNFREFNPDEDVFANDSIELLSQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G D  +N E+GI+ RRF ELL SSGIVLND+V+WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDLVRNNENGIDARRFAELLMSSGIVLNDNVNWVTFHSGYDFGYLLKLLTCQNLPDAQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTF 
Sbjct  185  AFFTLINVYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTCCTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K NFFSGS+++  GVLYG GVE+G
Sbjct  245  KLKGNFFSGSMDKYAGVLYGLGVESG  270



>gb|KDO42998.1| hypothetical protein CISIN_1g023991mg [Citrus sinensis]
Length=274

 Score =   284 bits (726),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDE GNLPTCGT KYC WQ  FRE D  ED+ A DSIE L+Q 
Sbjct  65   LKSNVDMLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G +F KN E GI+  RFGE + SSGIVL+DS+HWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GINFTKNNEIGIDAMRFGEFMMSSGIVLSDSMHWVTFHSGYDFGYLLKLLTCQNLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL    TFR
Sbjct  185  EFFNLIRIYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTASTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFS SLE+  GVLYG GVENGQ
Sbjct  245  KLKENFFSSSLEKYAGVLYGLGVENGQ  271



>ref|XP_010541576.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 isoform 
X1 [Tarenaya hassleriana]
Length=275

 Score =   284 bits (726),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VDMLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +P ED+   +SI+ L QC
Sbjct  64   LKENVDMLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNPSEDIYVNESIDLLHQC  123

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSG+VLND++ WV FH GYD GYLLK+     LP  Q 
Sbjct  124  GIDFKKNNEKGIDVKRFGELLMSSGVVLNDAMRWVTFHSGYDFGYLLKLLTCKALPVNQI  183

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+N YFP ++ IKH M+FCN+LHG  +KLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  184  EFFTLLNIYFPVIYDIKHMMKFCNNLHGGLSKLAELLEVERVGVSHQAGSDSLLTWCTFR  243

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K++FF GS+++  GVLYG GVENGQ
Sbjct  244  KLKESFFKGSMKKYAGVLYGLGVENGQ  270



>ref|XP_007135810.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris]
 gb|ESW07804.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris]
Length=283

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 157/215 (73%), Gaps = 8/215 (4%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCG--------TXKYCXWQXXFREXDPXEDVXAXD  620
            LKD VDMLKLIQLGLTFSDE GNLPTC         +   C WQ  FRE +  EDV A D
Sbjct  66   LKDNVDMLKLIQLGLTFSDEYGNLPTCAGAGDVDEESHSCCIWQFNFREFNVNEDVFAND  125

Query  619  SIEXLRQCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXX  440
            SIE LRQ G DF+KN E GI+  RFGELL SSGIVLND+VHWV FH GYD GYLLK+   
Sbjct  126  SIELLRQSGIDFKKNNEDGIDAHRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTC  185

Query  439  XELPXXQQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDS  260
              LP  Q  FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVER+G+ HQAGSDS
Sbjct  186  QNLPDTQVEFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDS  245

Query  259  LXXXCTFRKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            L   CTFRK KDNFFSGSLE+  GVLYG GVENGQ
Sbjct  246  LLTSCTFRKLKDNFFSGSLEKYAGVLYGLGVENGQ  280



>ref|XP_010532091.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X2 [Tarenaya hassleriana]
Length=275

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDEKGNLPTCGT KYC WQ  FRE D   D+ A DSI+ LRQ 
Sbjct  65   LKTNVDMLKLIQLGLTFSDEKGNLPTCGTDKYCIWQFNFREFDLNSDIFARDSIDLLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXG-YDXGYLLKIXXXXELPXXQ  419
            G DF KN ++GI+ RR+ ELL SSGIVLN++VHWV FH G YD GYLLK+     LP   
Sbjct  125  GIDFAKNNDNGIDSRRYAELLMSSGIVLNENVHWVTFHSGGYDFGYLLKLLTCQNLPEKA  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF
Sbjct  185  SGFFELIKIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
             K K+NFFSGS+E+  GVLYG GVENGQ
Sbjct  245  WKLKENFFSGSMEKYSGVLYGLGVENGQ  272



>ref|XP_009417447.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLT SDE G+LPTCGT + C WQ  FRE D   DV A DSIE LRQ 
Sbjct  66   LKANVDMLKLIQLGLTLSDEHGSLPTCGTDRGCVWQFNFREFDIQRDVFASDSIELLRQS  125

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  126  GIDFKKNNEKGIDAQRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPETQA  185

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG+ HQAGSDSL   C FR
Sbjct  186  GFFNLIKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCAFR  245

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K++FF+GS E+  GVLYG GVENGQ
Sbjct  246  KLKESFFNGSTEKYAGVLYGLGVENGQ  272



>emb|CDP10211.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 156/206 (76%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSDEKGNLPTCGT KYC WQ  FRE +P EDV A DSIE LR+ 
Sbjct  65   LKANVDLLKLIQLGLTFSDEKGNLPTCGTGKYCVWQFNFREFNPNEDVYAHDSIELLRRS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN ++G++  RF ELL SSGIVLNDSV WV FH GYD GYLLKI     LP  Q+
Sbjct  125  GFDFKKNVDNGVDAYRFSELLMSSGIVLNDSVSWVAFHSGYDFGYLLKILTCQNLPETQE  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH MRFCN LHG  NKLA LLEVERVG+ HQAGSDSL   CTF 
Sbjct  185  GFFKLIKMYFPTVYDIKHMMRFCNHLHGGLNKLAELLEVERVGICHQAGSDSLLTCCTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K++FF G+ E+  GVLYG GV+NG
Sbjct  245  KLKESFFHGTTEKYAGVLYGLGVDNG  270



>ref|XP_008794330.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=275

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 153/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDE GNLPTCGT   C WQ  FRE D   D+ A DSIE LRQ 
Sbjct  66   LKANVDMLKLIQLGLTFSDESGNLPTCGTGHGCVWQFNFREFDVHHDIFATDSIELLRQS  125

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G D +KN E GI+  RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  126  GIDLKKNNERGIDANRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQP  185

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG+ HQAGSDSL   CTFR
Sbjct  186  GFFNLIKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFR  245

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K++FF+G+ E   GVLYG GVENGQ
Sbjct  246  KLKESFFNGATERYAGVLYGLGVENGQ  272



>ref|XP_010414034.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   283 bits (725),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 157/208 (75%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V++LK+IQLGLTFSDEKGNLPTCG   KYC WQ  FRE D   D+ A DSIE LRQ
Sbjct  65   LKTNVNILKMIQLGLTFSDEKGNLPTCGADSKYCIWQFNFREFDLESDIFATDSIELLRQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN + GI+  RF ELL SSGIVLN++VHWV FH GYD GYLLK+    +LP  Q
Sbjct  125  SGIDFAKNNQMGIDSERFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPETQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF +IN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF
Sbjct  185  TGFFEMINVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK ++NFF GS+E+  GVLYG GVENGQ
Sbjct  245  RKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>ref|XP_002881215.1| hypothetical protein ARALYDRAFT_902256 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57474.1| hypothetical protein ARALYDRAFT_902256 [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V++LK+IQLGLTFSDEKGNLPTCGT  KYC WQ  FRE D   D+ A DSIE LRQ
Sbjct  65   LKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIELLRQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN + GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+     LP  Q
Sbjct  125  SGIDFAKNNQFGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPETQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF +I+ YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF
Sbjct  185  TGFFEMISVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK ++NFF GS+E+  GVLYG GVENGQ
Sbjct  245  RKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>ref|XP_009128391.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Brassica 
rapa]
 emb|CDY53227.1| BnaA02g19410D [Brassica napus]
Length=274

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  V++L +IQLGLTFS+E+GNLPTCGT KYC WQ  FRE D   D+ A DSI+ L+Q 
Sbjct  65   LKLNVNILSIIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIDLLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN + GIE  RF ELL SSGIVLN++VHWV FH GYD GYLLK+    +LP  Q 
Sbjct  125  GIDFAKNTQEGIESNRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPDSQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFQLINVYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFF+G L++  GVLYG GVENGQ
Sbjct  245  KLKENFFAGPLQKYAGVLYGLGVENGQ  271



>ref|XP_008799630.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=275

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDE GNLPTCGT + C WQ  FRE D   D+ A DSIE LRQ 
Sbjct  66   LKANVDMLKLIQLGLTFSDEFGNLPTCGTGRGCVWQFNFREFDVQCDIFASDSIELLRQS  125

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  126  GIDFKKNNERGIDANRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTRQNLPDTQP  185

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  +FP V+ IKH M+FCNSLHG  NKLA LL+VERVG+ HQAGSDSL   CTFR
Sbjct  186  GFFNLIKIFFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFR  245

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K +FF+GS E   GVLYG GVENGQ
Sbjct  246  KLKGSFFNGSTERYAGVLYGLGVENGQ  272



>ref|XP_009620266.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
tomentosiformis]
Length=274

 Score =   283 bits (724),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLP CG+ +YC WQ  FRE D   D+ A DSIE L Q 
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPICGSERYCIWQFNFREFDTSADIFANDSIELLMQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEMGIDAKRFGELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRTLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF L+N YFP V+ IKH M+FCNSLHG  NKLA LLE+ER+G+ HQAGSDSL   C F+
Sbjct  185  GFFDLLNVYFPLVYDIKHLMKFCNSLHGGLNKLAELLELERIGICHQAGSDSLLTSCAFK  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KDNFF+G+ E+  GVLYG GVE G 
Sbjct  245  KLKDNFFNGATEKYAGVLYGLGVEYGS  271



>ref|XP_006450304.1| hypothetical protein CICLE_v10008276mg [Citrus clementina]
 gb|ESR63544.1| hypothetical protein CICLE_v10008276mg [Citrus clementina]
Length=449

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  +D+ A DS+E L QC
Sbjct  241  LKDNVDMLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNLIDDIFASDSVELLHQC  300

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND V WV FH GYD GYLLK+     LP  Q 
Sbjct  301  GIDFKKNNEKGIDVNRFGELLMSSGIVLNDVVRWVTFHSGYDFGYLLKLLTCRSLPDTQA  360

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  361  GFFELINMYFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  420

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K ++NFF+G  E+  GVLYG GVEN +
Sbjct  421  KLRENFFNGCTEKYAGVLYGLGVENDK  447



>ref|XP_006389834.1| hypothetical protein EUTSA_v10018990mg [Eutrema salsugineum]
 gb|ESQ27120.1| hypothetical protein EUTSA_v10018990mg [Eutrema salsugineum]
Length=274

 Score =   282 bits (722),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  V++LK+IQLGLTFS+E+GNLPTCGT KYC WQ  FRE D   D+ A DSI+ L+Q 
Sbjct  65   LKMNVNILKIIQLGLTFSNEQGNLPTCGTEKYCIWQFNFREFDVDSDIYALDSIDLLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN + G++ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFAKNTQQGVDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPNSQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  SFFELINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFF G L++  GVLYG GVENGQ
Sbjct  245  KLKENFFVGPLQKYSGVLYGLGVENGQ  271



>ref|XP_003603309.1| Ribonuclease CAF1 [Medicago truncatula]
 gb|ACJ84747.1| unknown [Medicago truncatula]
 gb|AFK46979.1| unknown [Medicago truncatula]
Length=275

 Score =   282 bits (722),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 153/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT   C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  69   LKDNVDMLKLIQLGLTFSDENGNLPTCGTDSPCIWQFNFREFNVSEDIFAADSIELLRQC  128

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  129  GIDFKKNSEQGIDVNRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCRALPDTQA  188

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVGV HQAGSDSL   CTFR
Sbjct  189  GFFDLIGIYFPIVYDIKHLMKFCNSLHGGLNKLAELLDVERVGVCHQAGSDSLLTACTFR  248

Query  235  KXKDNFFSGSLEEXXGVLYGXGVE  164
            K ++ FF+G  E+  GVLYG GVE
Sbjct  249  KLRETFFNGETEKYSGVLYGLGVE  272



>ref|NP_565735.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9SKZ2.2|CAF1G_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 7 [Arabidopsis 
thaliana]
 gb|AAK93623.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AAD15397.2| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AAN13153.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AEC08630.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=275

 Score =   282 bits (722),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 158/208 (76%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V++LK+IQLGLTFSDEKGNLPTCGT  KYC WQ  FRE D   D+ A DSIE LRQ
Sbjct  65   LKTNVNILKMIQLGLTFSDEKGNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIELLRQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN E GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+     LP  Q
Sbjct  125  SGIDFVKNNEFGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPETQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF +I+ YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG+ HQAGSDSL   CTF
Sbjct  185  TGFFEMISVYFPRVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK ++NFF GS+E+  GVLYG GVENGQ
Sbjct  245  RKLQENFFIGSMEKYSGVLYGLGVENGQ  272



>emb|CDY63973.1| BnaC02g46620D [Brassica napus]
Length=274

 Score =   282 bits (721),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  V++L +IQLGLTFS+E+GNLPTCGT KYC WQ  FRE D   D+ A DSI+ L+Q 
Sbjct  65   LKLNVNILSIIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIDLLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN + GIE  RF ELL SSGIVLN++VHWV FH GYD GYLLK+    +LP  Q 
Sbjct  125  GIDFAKNTQEGIESNRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPDSQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  GFFQLINVYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFF+G L++  GVLYG GVEN Q
Sbjct  245  KLKENFFAGPLQKYAGVLYGLGVENAQ  271



>ref|XP_009399558.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 153/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSDE GNLPTCGT + C WQ  FRE D   DV A DSIE LRQ 
Sbjct  66   LKANVDMLKLIQLGLTFSDELGNLPTCGTDRGCVWQFNFREFDMQLDVFATDSIELLRQS  125

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN + GI+  RFGELL SSGIVLNDS++WV FH GYD GYLLK+     LP  Q 
Sbjct  126  GIDFKKNNDKGIDAHRFGELLMSSGIVLNDSIYWVTFHSGYDFGYLLKVLTCQNLPDTQA  185

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG+ HQAGSDSL   C FR
Sbjct  186  GFFNLIRIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCAFR  245

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K++FFSGS E   GVLYG  VENGQ
Sbjct  246  KLKESFFSGSTERYAGVLYGLSVENGQ  272



>ref|XP_006473977.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
 gb|KDO59415.1| hypothetical protein CISIN_1g024017mg [Citrus sinensis]
 gb|KDO59416.1| hypothetical protein CISIN_1g024017mg [Citrus sinensis]
Length=274

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 153/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTF+DE GNLP CGT KYC WQ  FRE  P EDV A DSI+ L + 
Sbjct  65   LKVNVDLLKLIQLGLTFTDENGNLPKCGTDKYCLWQFNFREFSPDEDVYAYDSIKLLSRS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G++  RF ELL SSGIVLNDSVHWV FH GYD GYLLK+    +LP  Q 
Sbjct  125  GIDFKKNKEKGVDAMRFSELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCKDLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI  YFP ++ IKH M+FCNSLHG  NKLA LLEVER+G+ HQAGSDSL   CTF 
Sbjct  185  CFFDLIKMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTCCTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KDNFF GS E+  GVLYG GVENGQ
Sbjct  245  KMKDNFFKGSPEKYAGVLYGLGVENGQ  271



>ref|XP_004501372.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501373.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501374.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X3 [Cicer arietinum]
 ref|XP_004501375.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X4 [Cicer arietinum]
Length=271

 Score =   280 bits (715),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 150/204 (74%), Gaps = 0/204 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLP CGT   C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPNCGTDSSCIWQFNFREFNVSEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RF ELL SSGIVLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNSEKGIDVNRFAELLMSSGIVLNDDVHWVTFHSGYDFGYLLKLLTCRTLPDTQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF +I  YFP V+ IKH M+FCN+LHG  NKLA LL+VERVGV HQAGSDSL   CTFR
Sbjct  185  GFFDMIKIYFPVVYDIKHLMKFCNNLHGGLNKLAELLDVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVE  164
            K +D FF+G  E+  GVLYG GVE
Sbjct  245  KLRDAFFNGETEKYSGVLYGLGVE  268



>ref|XP_010472873.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=274

 Score =   280 bits (715),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  V++LK+IQLGLTFS+E+G+LPTCGT KYC WQ  FRE D   D+ A DSIE L+Q 
Sbjct  65   LKTNVNILKMIQLGLTFSNEQGDLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G D  KN + GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDLAKNTQDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  DFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFF G L++  GVLYG GVENGQ
Sbjct  245  KLKENFFVGPLQKYSGVLYGLGVENGQ  271



>ref|XP_009144015.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brassica 
rapa]
 emb|CDY64914.1| BnaA05g35260D [Brassica napus]
Length=276

 Score =   280 bits (715),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 158/209 (76%), Gaps = 2/209 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT--XKYCXWQXXFREXDPXEDVXAXDSIEXLR  602
            L+  V++LK+IQLGLTFSDE+GNLPTCG    KYC WQ  FRE D   D+ A DSIE LR
Sbjct  65   LRTNVNLLKMIQLGLTFSDERGNLPTCGPDDSKYCIWQFNFREFDLSSDIFAHDSIELLR  124

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            Q G DF+KN  +G++ RRF ELL SSGIVLN++VHWV FH GYD GYLLK+    +LP  
Sbjct  125  QSGIDFDKNKRNGVDSRRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCRDLPET  184

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
            Q GFF +I  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CT
Sbjct  185  QVGFFEMIRVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCT  244

Query  241  FRKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            FRK ++NFF GS+E+  GVLYG GVENGQ
Sbjct  245  FRKLQENFFIGSMEKYSGVLYGLGVENGQ  273



>ref|XP_008445257.1| PREDICTED: LOW QUALITY PROTEIN: probable CCR4-associated factor 
1 homolog 7 [Cucumis melo]
Length=274

 Score =   279 bits (714),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L++ VD LKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  +D+ A DSIE LR+C
Sbjct  65   LRENVDTLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNICDDIYASDSIELLREC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+K  E GI+  RFGELL SSGIVLND++ WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFQKTHEEGIDVNRFGELLMSSGIVLNDNIXWVTFHSGYDFGYLLKLLTCRNLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI+ YFP V+ IKH MRFCNS HG  NKLA LLEVER+GV HQAGSDSL   CTFR
Sbjct  185  EFFDLIHMYFPMVYDIKHLMRFCNSFHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FF+GS+++  GVLYG GVE GQ
Sbjct  245  KLRDTFFNGSIQKYAGVLYGLGVETGQ  271



>ref|XP_009363839.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=273

 Score =   279 bits (714),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPT GT  +  WQ  FRE +  ED+ A DSI+ LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTLGTENHYIWQFNFREFNVSEDIFASDSIDLLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGE L SSG+VL+D+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDVNRFGEALMSSGLVLSDNVHWVTFHSGYDFGYLLKLLTCRSLPENQM  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI  YFP ++ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  EFFNLIKIYFPVLYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FFSGS E+  GVLYG GVENGQ
Sbjct  245  KLRDTFFSGSAEKYSGVLYGLGVENGQ  271



>ref|NP_178193.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 ref|NP_849915.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 sp|Q9SAI2.1|CAF1F_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 6 [Arabidopsis 
thaliana]
 gb|AAF14666.1|AC011713_14 Similar to gb|U21855 CCR4-associated factor 1 (CAF1) from Mus 
musculus. ESTs gb|AAA394972, gb|AA585812 and gb|H77015 come 
from this gene [Arabidopsis thaliana]
 gb|AAL49916.1| putative CCR4-associated factorCCR4-associated factor [Arabidopsis 
thaliana]
 gb|AAM20381.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AEE36448.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
 gb|AEE36449.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
Length=274

 Score =   279 bits (713),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 153/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  V++LK+IQLGLTFS+E+GNLPTCGT KYC WQ  FRE D   D+ A DSIE L+Q 
Sbjct  65   LKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFALDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G D  KN   GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDLAKNTLDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  DFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFF G L +  GVLYG GVENGQ
Sbjct  245  KLKENFFVGPLHKYSGVLYGLGVENGQ  271



>gb|EPS71126.1| hypothetical protein M569_03633, partial [Genlisea aurea]
Length=268

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 155/204 (76%), Gaps = 0/204 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VD+LKLIQLGLT SDEKGNLP+ GT K C WQ  FRE +P EDV A DSIE LRQ 
Sbjct  65   LKDNVDLLKLIQLGLTLSDEKGNLPSFGTDKRCIWQFNFREFNPNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF  N + GI+  RFGELL SSGIVLND+V+WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFVMNNDKGIDVGRFGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQRLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF+LIN +FP ++ IKH M+F NSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFSLINMFFPVLYDIKHLMKFSNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVE  164
            K K+NFFSGSLE+  GVLYG GVE
Sbjct  245  KLKENFFSGSLEKYSGVLYGLGVE  268



>ref|XP_006302671.1| hypothetical protein CARUB_v10020778mg [Capsella rubella]
 gb|EOA35569.1| hypothetical protein CARUB_v10020778mg [Capsella rubella]
Length=274

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  V++LK+IQLGLTFS+E+GNLPTCGT KYC WQ  F E D   D+ A DSIE L+Q 
Sbjct  65   LKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFGEFDLDSDIFAVDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G D  KN + GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDLAKNTQDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  DFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFF G L++  GVLYG GVENGQ
Sbjct  245  KLKENFFVGPLQKYSGVLYGLGVENGQ  271



>ref|XP_004138706.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cucumis 
sativus]
 gb|KGN62986.1| Ccr4-associated factor [Cucumis sativus]
Length=274

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L++ VD LKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  +D+ A DSIE LR+C
Sbjct  65   LRENVDTLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNICDDIYASDSIELLREC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+K  E GI+  RFGELL SSGIVLND++ WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFQKTHEEGIDVNRFGELLMSSGIVLNDNIFWVTFHSGYDFGYLLKLLTCRNLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI+ YFP V+ IKH MRFCNS HG  NKLA LLEVER+GV HQAGSDSL   CTFR
Sbjct  185  EFFDLIHMYFPMVYDIKHLMRFCNSFHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FF+GS ++  GVLYG GVE GQ
Sbjct  245  KLRDTFFNGSTQKYAGVLYGLGVETGQ  271



>ref|XP_008378874.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
 ref|XP_008343758.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=271

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE G+LPT  T  +  WQ  FRE +  ED+ A DSI+ LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGDLPTLATENHYIWQFNFREFNVSEDIFASDSIDLLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSG+VL+D+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDVNRFGELLMSSGLVLSDNVHWVTFHSGYDFGYLLKLLTCRSLPDNQM  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI  YFP ++ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  EFFNLIKIYFPVLYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FFSGS E+  GVLYG G+ENGQ
Sbjct  245  KLRDTFFSGSAEKYSGVLYGLGIENGQ  271



>gb|ACJ84891.1| unknown [Medicago truncatula]
Length=275

 Score =   278 bits (711),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 151/204 (74%), Gaps = 0/204 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD V MLKLIQLGLTFSDE GNLPTCGT   C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  69   LKDNVYMLKLIQLGLTFSDENGNLPTCGTDSPCIWQFNFREFNVSEDIFAADSIELLRQC  128

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  129  GIDFKKNSEQGIDVNRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCRALPDTQA  188

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVGV HQAGSDSL   CTFR
Sbjct  189  GFFDLIGIYFPIVYDIKHLMKFCNSLHGGLNKLAELLDVERVGVCHQAGSDSLLTACTFR  248

Query  235  KXKDNFFSGSLEEXXGVLYGXGVE  164
            K +  FF+G  E+  GVLYG GVE
Sbjct  249  KLRGTFFNGETEKYSGVLYGLGVE  272



>ref|XP_010048831.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW81224.1| hypothetical protein EUGRSUZ_C02596 [Eucalyptus grandis]
Length=274

 Score =   278 bits (710),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 155/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTF+DEKGNLPTCGT KY  WQ  FRE +  EDV A DSI+ L Q 
Sbjct  65   LKANVDLLKLIQLGLTFADEKGNLPTCGTDKYYVWQFNFREFNLNEDVYAHDSIDLLSQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G +F+KN E G++ RRF ELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GINFKKNNEVGVDARRFSELLMSSGIVLNDSVHWVTFHSGYDFGYLLKVLTCQSLPSTQS  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP ++ IKH M+FCNSLHG  NK+A LLEVERVG+ HQAGSDSL    TF 
Sbjct  185  GFFDLIKMYFPVLYDIKHLMKFCNSLHGGLNKVAELLEVERVGICHQAGSDSLLTCSTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFF+GS E+  GVLYG GVENGQ
Sbjct  245  KLKENFFNGSPEKYAGVLYGLGVENGQ  271



>ref|XP_011073532.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=271

 Score =   277 bits (709),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 152/207 (73%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT   C WQ  FRE +  ED+ A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGTNTCCIWQFNFREFNVSEDIFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RF ELL SSGIVLND + WV FH GYD GYLLK+     LP    
Sbjct  125  GIDFKKNNELGIDAGRFAELLMSSGIVLNDGMCWVTFHSGYDFGYLLKLLTCRSLPETPA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF L+N YFP V+ IKH M+FCNSLHG  NKLA LLEVER+GV HQAGSDSL   C F+
Sbjct  185  GFFLLLNIYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSCAFK  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KDNFF+GS E+  GVLYG G+ENG 
Sbjct  245  KLKDNFFNGSTEKYAGVLYGLGIENGS  271



>gb|KJB06631.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
Length=235

 Score =   276 bits (705),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 151/207 (73%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSD  GNLPTCGT  +C WQ  FRE +  ED+   DSIE L QC
Sbjct  27   LKGNVDMLKLIQLGLTFSDANGNLPTCGTDNFCIWQFNFREFNISEDIFVSDSIELLLQC  86

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  87   GIDFKKNNEKGIDVKRFGELLMSSGIVLNDDVHWVTFHSGYDFGYLLKLLTCRSLPDSQT  146

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCN LHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  147  GFFKLIKLYFPMVYDIKHMMKFCNGLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  206

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +DNFF  S+++  GVLYG  VE GQ
Sbjct  207  KLRDNFFK-SVQKYAGVLYGLEVEGGQ  232



>ref|XP_006356929.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=274

 Score =   277 bits (708),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 152/207 (73%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDML LIQLGLTFSDE GNLPTCG+  Y  WQ  FRE D   D+ A DSIE L Q 
Sbjct  65   LKDNVDMLNLIQLGLTFSDENGNLPTCGSEYYYIWQFNFREFDTSADIFANDSIELLIQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ ++FGELL SSGIVLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEMGIDAKQFGELLMSSGIVLNDMVHWVTFHSGYDFGYLLKLLTCRTLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF L+N YFP V+ IKH M+FCNSLHG  NKLA LLE+ERVG+ HQAGSDSL   C F+
Sbjct  185  GFFDLLNMYFPLVYDIKHLMKFCNSLHGGLNKLAELLELERVGICHQAGSDSLLTSCAFK  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KDNFF+GS E+  GVLYG GVE G 
Sbjct  245  KLKDNFFNGSTEKYAGVLYGLGVEYGS  271



>ref|XP_006453661.1| hypothetical protein CICLE_v10009159mg [Citrus clementina]
 gb|ESR66901.1| hypothetical protein CICLE_v10009159mg [Citrus clementina]
Length=274

 Score =   276 bits (707),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 152/207 (73%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTF+DE GNLP  GT KYC WQ  FRE  P EDV A DSI+ L + 
Sbjct  65   LKVNVDLLKLIQLGLTFTDENGNLPKYGTDKYCLWQFNFREFSPDEDVYAYDSIKLLSRS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G++  RF ELL SSGIVLNDSVHWV FH GYD GYLLK+    +LP  Q 
Sbjct  125  GIDFKKNKEKGVDAMRFSELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCKDLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI  YFP ++ IKH M+FCNSLHG  NKLA LLEVER+G+ HQAGSDSL   CTF 
Sbjct  185  CFFDLIKMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTCCTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KDNFF GS E+  GVLYG GVENGQ
Sbjct  245  KMKDNFFKGSPEKYAGVLYGLGVENGQ  271



>ref|XP_004160761.1| PREDICTED: LOW QUALITY PROTEIN: probable CCR4-associated factor 
1 homolog 7-like [Cucumis sativus]
Length=274

 Score =   276 bits (707),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 153/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L++ VD LKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  +D+ A DSIE LR+C
Sbjct  65   LRENVDTLKLIQLGLTFSDENGNLPTCGTDKFCIWQFNFREFNICDDIYASDSIELLREC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+K  E GI+  RFGELL SSGIVLND++ WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFQKTHEEGIDVNRFGELLMSSGIVLNDNIFWVTFHSGYDFGYLLKLLTCRNLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             F  LI+ YFP V+ IKH MRFCNS HG  NKLA LLEVER+GV HQAGSDSL   CTFR
Sbjct  185  EFLXLIHMYFPMVYDIKHLMRFCNSFHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FF+GS ++  GVLYG GVE GQ
Sbjct  245  KLRDTFFNGSTQKYAGVLYGLGVETGQ  271



>gb|AFK45143.1| unknown [Lotus japonicus]
Length=272

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 152/205 (74%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT   C WQ  FRE +  ED+ A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGTETPCIWQFNFREFNVSEDIFASDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G D +K  E GI+  RFGELL SSG+VLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDLKKINEKGIDVSRFGELLMSSGVVLNDNVHWVTFHSGYDFGYLLKLLTCRVLPESQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP ++ IKH M+FCN+LHG  NKLA LLEV+RVG+ HQAGSDSL   CTFR
Sbjct  185  GFFELIKIYFPMLYDIKHLMKFCNNLHGGLNKLAELLEVDRVGMCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            K +D +FSGS E+  GVLYG GVEN
Sbjct  245  KLRDTYFSGSTEKYAGVLYGLGVEN  269



>gb|KJB06630.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
 gb|KJB06632.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
Length=273

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 151/207 (73%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTFSD  GNLPTCGT  +C WQ  FRE +  ED+   DSIE L QC
Sbjct  65   LKGNVDMLKLIQLGLTFSDANGNLPTCGTDNFCIWQFNFREFNISEDIFVSDSIELLLQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSGIVLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDVKRFGELLMSSGIVLNDDVHWVTFHSGYDFGYLLKLLTCRSLPDSQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCN LHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFKLIKLYFPMVYDIKHMMKFCNGLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +DNFF  S+++  GVLYG  VE GQ
Sbjct  245  KLRDNFFK-SVQKYAGVLYGLEVEGGQ  270



>ref|XP_010556071.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Tarenaya 
hassleriana]
Length=276

 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 156/207 (75%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  +DV A +SI+ L QC
Sbjct  65   LKDNVDMLKLIQLGLTFSDEHGNLPTCGTDKFCIWQFNFREFNLSQDVYASESIDLLHQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E GI+ +RFGELL SSGIVLND+V WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFNKNNEKGIDVKRFGELLMSSGIVLNDAVSWVTFHSGYDFGYLLKLLTCKTLPQLQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF  +N YFP ++ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  EFFNHLNIYFPVIYDIKHMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KD+FF+GS E+  GVLYG GVENG 
Sbjct  245  KLKDSFFNGSTEKYAGVLYGLGVENGH  271



>ref|XP_009106716.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Brassica 
rapa]
 emb|CDX87343.1| BnaA07g35300D [Brassica napus]
Length=275

 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 153/208 (74%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V++L +IQLGLTFS+E+GNLPTCGT  KYC WQ  FRE D   D+ A DSI+ L+Q
Sbjct  65   LKLNVNILNIIQLGLTFSNEQGNLPTCGTDNKYCIWQFNFREFDLDSDIFAVDSIDLLKQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN   GIE RRF ELL SSGIVLN +VHWV FH GYD GYLLK+     LP  Q
Sbjct  125  SGIDFAKNTREGIESRRFAELLMSSGIVLNGNVHWVTFHSGYDFGYLLKLLTCQNLPDSQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF
Sbjct  185  TSFFELINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK K+NFF G L++  GVLYG GVENGQ
Sbjct  245  RKLKENFFVGPLQKYAGVLYGLGVENGQ  272



>ref|XP_010429900.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
 ref|XP_010429901.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=275

 Score =   275 bits (703),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 155/208 (75%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V++LK+IQLGLTFS+E+G+LPTCGT  KYC WQ  FRE D   D+ A DSIE L+Q
Sbjct  65   LKTNVNILKMIQLGLTFSNEQGDLPTCGTDNKYCIWQFNFREFDLDSDIFAVDSIELLKQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G D  KN + GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+     LP  Q
Sbjct  125  SGIDLAKNTQDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF
Sbjct  185  TDFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK K+NFF G L++  GVLYG GVENGQ
Sbjct  245  RKLKENFFVGPLQKYSGVLYGLGVENGQ  272



>ref|XP_010417661.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=275

 Score =   275 bits (703),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 155/208 (75%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V++LK+IQLGLTFS+E+G+LPTCGT  KYC WQ  FRE D   D+ A DSIE L+Q
Sbjct  65   LKTNVNILKMIQLGLTFSNEQGDLPTCGTNNKYCIWQFNFREFDLDSDIFAVDSIELLKQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G D  KN + GI+ +RF ELL SSG+VLN++VHWV FH GYD GYLLK+     LP  Q
Sbjct  125  SGIDLAKNTQDGIDSKRFAELLMSSGVVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF
Sbjct  185  TDFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK K+NFF G L++  GVLYG GVENGQ
Sbjct  245  RKLKENFFVGPLQKYSGVLYGLGVENGQ  272



>emb|CDY12234.1| BnaC04g12640D [Brassica napus]
Length=276

 Score =   275 bits (703),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 156/209 (75%), Gaps = 2/209 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT--XKYCXWQXXFREXDPXEDVXAXDSIEXLR  602
            L+  V++LK+IQLGLTFSDE+GNLPTCG    KYC WQ  FRE D   D+ A DSIE LR
Sbjct  65   LRTNVNLLKMIQLGLTFSDERGNLPTCGPDDKKYCIWQFNFREFDLSSDIFAHDSIELLR  124

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            Q G DF+ N  +G++ RRF ELL SSGIVLN++VHWV FH GYD GYLLK+    +LP  
Sbjct  125  QSGIDFDNNKRNGVDSRRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPET  184

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
            Q GFF +I  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CT
Sbjct  185  QVGFFEMIRVYFPRVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCT  244

Query  241  FRKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            FRK ++NFF GS+E+  GVLYG GVEN Q
Sbjct  245  FRKLQENFFIGSMEKYSGVLYGLGVENVQ  273



>ref|NP_001185452.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 gb|AEE36450.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
Length=286

 Score =   275 bits (703),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 151/205 (74%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  V++LK+IQLGLTFS+E+GNLPTCGT KYC WQ  FRE D   D+ A DSIE L+Q 
Sbjct  65   LKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFALDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G D  KN   GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDLAKNTLDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  185  DFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            K K+NFF G L +  GVLYG GVEN
Sbjct  245  KLKENFFVGPLHKYSGVLYGLGVEN  269



>ref|XP_008377668.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=273

 Score =   275 bits (702),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 152/207 (73%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTF DE GNLPT  T     WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFFDENGNLPTLSTENQYIWQFNFREFNVSEDIYASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL +SG+VL+D+V+WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDVNRFGELLMASGLVLSDNVYWVTFHSGYDFGYLLKLLTCRSLPDAQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI  YFP ++ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  EFFNLIKIYFPVLYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FFSGS E+  GVLYG GVENGQ
Sbjct  245  KLRDTFFSGSAEKYSGVLYGLGVENGQ  271



>ref|XP_008220692.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Prunus 
mume]
Length=274

 Score =   274 bits (701),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 150/207 (72%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSD+ G LP   T     WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDKNGKLPDLDTQNQYIWQFNFREFNVSEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSG+VLN  VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDVKRFGELLVSSGVVLNAEVHWVTFHSGYDFGYLLKLLTGVSLPDSQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  +FP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFELIKAFFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FF G+ E+  GVLYG GVENGQ
Sbjct  245  KLRDTFFGGTAEKYAGVLYGLGVENGQ  271



>emb|CDY39943.1| BnaC06g40210D [Brassica napus]
Length=275

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 152/208 (73%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V++L +IQLGLTFS+E+GNLPTCGT  KYC WQ  FRE D   D+ A DSI+ L+Q
Sbjct  65   LKLNVNILNIIQLGLTFSNEQGNLPTCGTDSKYCIWQFNFREFDLDSDIFAVDSIDLLKQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN   GIE  RF ELL SSGIVLN +VHWV FH GYD GYLLK+     LP  Q
Sbjct  125  SGIDFAKNTRQGIESSRFAELLMSSGIVLNGNVHWVTFHSGYDFGYLLKLLTCKNLPDSQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTF
Sbjct  185  TSFFELINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            RK K+NFF G L++  GVLYG GVENGQ
Sbjct  245  RKLKENFFVGPLQKYAGVLYGLGVENGQ  272



>ref|XP_004250764.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
 ref|XP_004250765.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
Length=274

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 151/207 (73%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDML LIQLGLTFSDE GNLPTC +  Y  WQ  FRE D   ++ A DSIE L Q 
Sbjct  65   LKDNVDMLNLIQLGLTFSDENGNLPTCESEYYYVWQFNFREFDTKANIFANDSIELLIQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ ++FGELL SSGIVLND VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEMGIDAKQFGELLMSSGIVLNDMVHWVTFHSGYDFGYLLKLLTCRTLPETQS  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF L+N YFP V+ IKH M+FCNSLHG  NKLA LLE+ERVG+ HQAGSDSL   C F+
Sbjct  185  GFFDLLNMYFPLVYDIKHLMKFCNSLHGGLNKLAELLEIERVGICHQAGSDSLLTSCAFK  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KDNFF+GS E+  GVLYG GVE G 
Sbjct  245  KLKDNFFNGSTEKYAGVLYGLGVEYGS  271



>emb|CAN68032.1| hypothetical protein VITISV_022019 [Vitis vinifera]
Length=270

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 152/206 (74%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSDE GN PTCGT +YC WQ  FRE +  EDV A DSIE L+Q 
Sbjct  65   LKTNVDLLKLIQLGLTFSDEHGNFPTCGTERYCVWQFNFREFNLNEDVFAHDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G++ RRF ELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGVDARRFSELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTSQNLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP ++ IKH M+FCNSLHG  NKLA LL VER+G  HQAGSDSL   CTF 
Sbjct  185  GFFELIRIYFPILYDIKHLMKFCNSLHGGLNKLAELLGVERIGSCHQAGSDSLLTCCTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K +FF+GS E+  GVLYG GVE+G
Sbjct  245  KLKKDFFNGSPEKCAGVLYGLGVESG  270



>ref|XP_004504674.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer 
arietinum]
Length=282

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 155/209 (74%), Gaps = 2/209 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTC--GTXKYCXWQXXFREXDPXEDVXAXDSIEXLR  602
            LKD VDMLKLIQLG T SDE GNLP       ++C WQ  FRE +  EDV A DSIE LR
Sbjct  72   LKDNVDMLKLIQLGFTLSDEDGNLPNFDDADDRFCVWQFNFREFNVSEDVFANDSIELLR  131

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            Q G DF+KN + GI+ + FG++L SSGIVLND+VHW+ FH GYD GYLLK+     LP  
Sbjct  132  QSGIDFKKNNDKGIDAQCFGDILMSSGIVLNDNVHWLTFHSGYDFGYLLKLLTCQNLPDT  191

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
            Q GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CT
Sbjct  192  QVGFFNLINMYFPNVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTLCT  251

Query  241  FRKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            FRK K+NFFSGS+E+  GVLYG G+ENGQ
Sbjct  252  FRKLKENFFSGSMEKYAGVLYGLGIENGQ  280



>ref|XP_002279241.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=270

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 152/206 (74%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSDE GN PTCGT +YC WQ  FRE +  EDV A DSIE L+Q 
Sbjct  65   LKTNVDLLKLIQLGLTFSDEHGNFPTCGTERYCVWQFNFREFNLNEDVFAHDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G++ RRF ELL SSGIVLN+SVHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGVDARRFSELLMSSGIVLNESVHWVTFHSGYDFGYLLKLLTSQNLPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP ++ IKH M+FCNSLHG  NKLA LL VER+G  HQAGSDSL   CTF 
Sbjct  185  GFFELIRIYFPILYDIKHLMKFCNSLHGGLNKLAELLGVERIGSCHQAGSDSLLTCCTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K +FF+GS E+  GVLYG GVE+G
Sbjct  245  KLKKDFFNGSPEKYAGVLYGLGVESG  270



>gb|KHN29617.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=265

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 150/207 (72%), Gaps = 8/207 (4%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTCGT   C WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCGTESPCIWQFNFREFNVSEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E+GI+  RFGELL SSGIV         FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNSENGIDVNRFGELLMSSGIVF--------FHSGYDFGYLLKLLTCRSLPDTQA  176

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  177  GFFDLIKMYFPMVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFR  236

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FFSGS E+  GVLYG GVE+GQ
Sbjct  237  KLRDTFFSGSTEKYAGVLYGLGVESGQ  263



>gb|ABK24400.1| unknown [Picea sitchensis]
Length=274

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 153/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+L LIQLGLTFSDE GNLP CGT KYC WQ  FRE +  +D+ A DSIE L+Q 
Sbjct  65   LKSNVDILNLIQLGLTFSDEDGNLPRCGTDKYCIWQFNFREFNLDKDMYAIDSIELLQQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ + FGELL SSGIVLND+VHWV FH GYD GY+LK+    +LP    
Sbjct  125  GIDFKKNNEDGIDAQVFGELLMSSGIVLNDTVHWVTFHSGYDFGYMLKLLTCQQLPPTPA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSLHG  NKLA LL+V+R+GV HQAGSDSL   C FR
Sbjct  185  GFFNLINMYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVKRIGVCHQAGSDSLLTSCAFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K ++ FF+GS E+  GVLYG   +NGQ
Sbjct  245  KLREGFFNGSTEKYAGVLYGLAFDNGQ  271



>gb|ABK21469.1| unknown [Picea sitchensis]
Length=236

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+L LIQLGLTFSDE GNLP CGT KYC WQ  FRE +  +D+ A DSIE L+Q 
Sbjct  27   LKSNVDVLNLIQLGLTFSDEDGNLPRCGTDKYCIWQFNFREFNLDKDMYASDSIELLQQS  86

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ + F ELL SSGIVLND+VHWV FH GYD GYLLK+    +LP  + 
Sbjct  87   GIDFKKNNEKGIDAQVFAELLMSSGIVLNDTVHWVTFHSGYDFGYLLKLLTCQQLPPTRA  146

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSL+G  NKLA LL+V+R+GV HQAGSDSL   C FR
Sbjct  147  GFFKLINMYFPTVYDIKHLMKFCNSLYGGLNKLAELLDVKRIGVCHQAGSDSLLTSCAFR  206

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K ++ FF+GS E+  GVLYG  +E+GQ
Sbjct  207  KLREGFFNGSTEKYAGVLYGLALEHGQ  233



>ref|XP_009358471.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=295

 Score =   270 bits (691),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 152/206 (74%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSDEKGNLPTCGT K+C WQ  FR+ +P EDV A DSIE L Q 
Sbjct  86   LKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQS  145

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E G++  +F ELL +SG+VL+D+V WV FH GYD GYLLK+     LP  Q 
Sbjct  146  GMDFVKNNEKGVDASKFAELLMASGVVLSDNVVWVTFHSGYDFGYLLKLLKGQSLPNTQV  205

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF +I  YFP V+ IKH MRFCNSLHG  NKLA LL+VER+G+ HQAGSDSL    TF 
Sbjct  206  GFFKMIKVYFPTVYDIKHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFM  265

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+ FF GS+++  GVLYG GVENG
Sbjct  266  KLKETFFDGSIDKYAGVLYGLGVENG  291



>ref|XP_010063560.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063561.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063562.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063564.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 gb|KCW70795.1| hypothetical protein EUGRSUZ_F03953 [Eucalyptus grandis]
Length=281

 Score =   270 bits (690),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 154/204 (75%), Gaps = 0/204 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VDMLKLIQLGLTFSDE+GNLPTCG+ K C WQ  FRE +  ED  A DSIE L+Q 
Sbjct  65   LKENVDMLKLIQLGLTFSDERGNLPTCGSDKCCIWQFNFREFNANEDFFADDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN + GI   RFGELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNRDRGINAVRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKVLTCQTLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI+ YFP ++ IKH M+FC+SLHG  NK+A LL+VERVGV HQAGSDSL    TF+
Sbjct  185  GFFKLIHMYFPTLYDIKHLMKFCDSLHGGLNKVAELLKVERVGVCHQAGSDSLLTSSTFK  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVE  164
            K K++FFSGSLE+  GVLYG  VE
Sbjct  245  KLKESFFSGSLEKYSGVLYGLCVE  268



>ref|XP_008336906.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=295

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 152/206 (74%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSDEKGNLPTCGT K+C WQ  FR+ +P EDV A DSIE L Q 
Sbjct  86   LKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQS  145

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E G++  +F ELL +SG+VL+D+V WV FH GYD GYLLK+     LP  Q 
Sbjct  146  GMDFVKNNEKGVDASKFTELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLPNTQV  205

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF +I  YFP V+ IKH MRFCNSLHG  NKLA LL+VER+G+ HQAGSDSL    TF 
Sbjct  206  GFFKMIKVYFPTVYDIKHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFM  265

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+ FF GS+++  GVLYG GVENG
Sbjct  266  KLKETFFDGSIDKYAGVLYGLGVENG  291



>gb|EYU21723.1| hypothetical protein MIMGU_mgv1a019889mg [Erythranthe guttata]
Length=272

 Score =   269 bits (688),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 155/208 (75%), Gaps = 3/208 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTC---GTXKYCXWQXXFREXDPXEDVXAXDSIEXL  605
            LKD V++LKLIQLGLTFSDE GNLP C   G  ++C WQ  FRE DP EDV A DSIE L
Sbjct  65   LKDNVNLLKLIQLGLTFSDENGNLPECSGAGKNRHCIWQFNFREFDPNEDVFANDSIELL  124

Query  604  RQCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPX  425
             + G D  +N E+GIE RRF ELL SSGIVLN+SV+WV FH GYD GYL+K+    +LP 
Sbjct  125  SRSGIDLARNTENGIESRRFAELLMSSGIVLNESVYWVTFHSGYDFGYLIKLVTGQKLPE  184

Query  424  XQQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXC  245
             Q+GFF LI+ YFP V+ IKH M+F NSLHG  NKLA LLEVERVGV HQAGSDSL   C
Sbjct  185  EQEGFFGLIDVYFPVVYDIKHLMKFVNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTCC  244

Query  244  TFRKXKDNFFSGSLEEXXGVLYGXGVEN  161
            TF K KDNFFSG+L +  GVLYG G+E+
Sbjct  245  TFFKLKDNFFSGTLHKYSGVLYGLGIES  272



>ref|XP_008344039.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=274

 Score =   269 bits (687),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 151/206 (73%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSDEKGNLPTCGT K+C WQ  FR+ +P EDV A DSIE L Q 
Sbjct  65   LKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E G++  +F ELL +SG+VL+D+V WV FH GYD GYLLK+     LP  Q 
Sbjct  125  GMDFVKNNEKGVDASKFTELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLPNTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF +I  YFP V+ IKH MRFCNSLHG  NKLA LL+VER+G+ HQAGSDSL    TF 
Sbjct  185  GFFKMIKMYFPTVYDIKHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+ +F GS ++  GVLYG GVENG
Sbjct  245  KLKETYFDGSPDKYAGVLYGLGVENG  270



>gb|ACN40154.1| unknown [Picea sitchensis]
Length=274

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 154/207 (74%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+L LIQLGLTFSDE GNLP CGT KYC WQ  FRE +  +D+ A DSIE L+Q 
Sbjct  65   LKSNVDVLNLIQLGLTFSDEDGNLPRCGTDKYCIWQFNFREFNLDKDMYASDSIELLQQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ + F ELL SSGIVLND+VHWV FH GYD GYLLK+    +LP  + 
Sbjct  125  GIDFKKNNEKGIDAQVFAELLMSSGIVLNDTVHWVTFHSGYDFGYLLKLLTCQQLPPTRA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP V+ IKH M+FCNSL+G  NKLA LL+V+R+GV HQAGSDSL   C FR
Sbjct  185  GFFKLINMYFPTVYDIKHLMKFCNSLYGGLNKLAELLDVKRIGVCHQAGSDSLLTSCAFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K ++ FF+GS E+  GVLYG  +E+GQ
Sbjct  245  KLREGFFNGSTEKYAGVLYGLALEHGQ  271



>ref|XP_006410344.1| hypothetical protein EUTSA_v10017059mg [Eutrema salsugineum]
 gb|ESQ51797.1| hypothetical protein EUTSA_v10017059mg [Eutrema salsugineum]
Length=276

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 152/209 (73%), Gaps = 2/209 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCG--TXKYCXWQXXFREXDPXEDVXAXDSIEXLR  602
            LK  V++LK+IQLGLTFSD+KGNLPTCG    K+C WQ  FR+ D   D+ A DSIE LR
Sbjct  65   LKTNVNLLKMIQLGLTFSDDKGNLPTCGGSDKKHCIWQFNFRDFDLNSDIFAHDSIELLR  124

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            Q G DF KN + G++ RRF EL  SSGIVLN+SVHWV FH GYD GYLLK+     LP  
Sbjct  125  QSGIDFVKNNQIGVDSRRFAELFMSSGIVLNESVHWVTFHSGYDFGYLLKLLTCQNLPET  184

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
            Q GFF +I+ YFP V+ +KH M+FCNSLHG  N LA  LEV RVGV HQAGSDSL   CT
Sbjct  185  QTGFFEMISVYFPRVYDVKHLMKFCNSLHGGLNNLAAQLEVARVGVSHQAGSDSLLTSCT  244

Query  241  FRKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            FRK ++NFF GS+E+  GVLYG GVENG 
Sbjct  245  FRKLQENFFVGSMEKYSGVLYGLGVENGH  273



>ref|XP_009366159.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=295

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 151/206 (73%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSDEKGNLPTCGT K+C WQ  FR+ +P EDV A DSIE L Q 
Sbjct  86   LKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQS  145

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E G++  +F ELL +SG+VL+D+V WV FH GYD GYLLK+     LP  Q 
Sbjct  146  GMDFVKNNEKGVDASKFTELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLPNTQA  205

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF +I  YFP V+ IKH MRFCNSLHG  NKLA LL+VER+G+ HQAGSDSL    TF 
Sbjct  206  GFFKMIKMYFPTVYDIKHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFM  265

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+ +F GS ++  GVLYG GVENG
Sbjct  266  KLKETYFDGSPDKYAGVLYGLGVENG  291



>ref|XP_008354337.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=295

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 151/206 (73%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSDEKGNLPTCGT K+C WQ  FR+ +P EDV A DSIE L Q 
Sbjct  86   LKANVDLLKLIQLGLTFSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQS  145

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E G++  +F ELL +SG+VL+D+V WV FH GYD GYLLK+     LP  Q 
Sbjct  146  GMDFVKNNEKGVDASKFTELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLPNTQA  205

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF +I  YFP V+ IKH MRFCNSLHG  NKLA LL+VER+G+ HQAGSDSL    TF 
Sbjct  206  GFFKMIKMYFPTVYDIKHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFM  265

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+ +F GS ++  GVLYG GVENG
Sbjct  266  KLKETYFDGSPDKYAGVLYGLGVENG  291



>ref|XP_007202386.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica]
 gb|EMJ03585.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica]
Length=295

 Score =   267 bits (682),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 152/206 (74%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTF+DE GNLPTC T K+C WQ  FR+ +P EDV A DSIE L Q 
Sbjct  86   LKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIELLSQS  145

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G++  RF +LL +SG+VLN++V WV FH GYD GYLLK+     LP  Q 
Sbjct  146  GMDFKKNNEKGVDAVRFSQLLMTSGVVLNENVVWVTFHSGYDFGYLLKLLKGETLPDTQM  205

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF +I  YFP ++ IKH MRFCNSLHG  NKLA LL+VER+G+ HQAGSDSL   CTF 
Sbjct  206  GFFDMIKVYFPTIYDIKHLMRFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTSCTFM  265

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+ FFSG+ ++  GVLYG GVENG
Sbjct  266  KLKETFFSGNPDKYAGVLYGLGVENG  291



>emb|CDX70376.1| BnaC03g04600D [Brassica napus]
Length=276

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 151/206 (73%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQ+GLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQVGLTFSDEDGNLPTCGTDKFCVWQFNFREFNIGEDIYASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN ESGI+  RFGEL+ SSGIVLNDS+ WV FH GYD GYL+K+    ELP  Q 
Sbjct  125  GIDFKKNVESGIDVARFGELMMSSGIVLNDSISWVTFHGGYDFGYLVKLLTCKELPVKQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP V+ IKH M FCN L G  N+LA L+ VERVGV HQAGSDSL    +FR
Sbjct  185  DFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+ +F GS E   GVLYG GVE+G
Sbjct  245  KLKERYFPGSTERYTGVLYGLGVEDG  270



>ref|XP_007222518.1| hypothetical protein PRUPE_ppa009848mg [Prunus persica]
 gb|EMJ23717.1| hypothetical protein PRUPE_ppa009848mg [Prunus persica]
Length=274

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 150/207 (72%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSD+ G LP   T     WQ  FRE +  ED+ A DSIE LRQC
Sbjct  65   LKDNVDMLKLIQLGLTFSDKNGKLPDLDTQNQYIWQFNFREFNVSEDIFASDSIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ +RFGELL SSG+VLN  VHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDVKRFGELLVSSGVVLNAEVHWVTFHSGYDFGYLLKLLTGLSLPDSQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  +FP V+ IKH M+FCNSLHG  NKLA LLEVERVGV HQAGSDSL   CTFR
Sbjct  185  GFFELIKAFFPVVYDIKHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K +D FF G+ E+  GVLYG GVENGQ
Sbjct  245  KLRDTFFGGTAEKYAGVLYGLGVENGQ  271



>ref|XP_008242960.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X2 [Prunus mume]
Length=295

 Score =   265 bits (677),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 151/206 (73%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTF+DE GNLPTC T K+C WQ  FR+ +P EDV A DSIE L Q 
Sbjct  86   LKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIELLSQS  145

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G++  RF +LL +SG+VLN++V WV FH GYD GYLLK+     LP  Q 
Sbjct  146  GMDFKKNNEKGVDAVRFSQLLMTSGVVLNENVVWVTFHSGYDFGYLLKLLKGETLPDTQM  205

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF +I  YFP ++ IKH MRFCNSLHG  NKLA LL+VER+G+ HQAGSDSL   C F 
Sbjct  206  GFFDMIKVYFPTIYDIKHLMRFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTSCAFM  265

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+ FFSG+ ++  GVLYG GVENG
Sbjct  266  KLKETFFSGNPDKYAGVLYGLGVENG  291



>ref|XP_008242959.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Prunus mume]
Length=307

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 151/206 (73%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTF+DE GNLPTC T K+C WQ  FR+ +P EDV A DSIE L Q 
Sbjct  98   LKANVDLLKLIQLGLTFTDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIELLSQS  157

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G++  RF +LL +SG+VLN++V WV FH GYD GYLLK+     LP  Q 
Sbjct  158  GMDFKKNNEKGVDAVRFSQLLMTSGVVLNENVVWVTFHSGYDFGYLLKLLKGETLPDTQM  217

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF +I  YFP ++ IKH MRFCNSLHG  NKLA LL+VER+G+ HQAGSDSL   C F 
Sbjct  218  GFFDMIKVYFPTIYDIKHLMRFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTSCAFM  277

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+ FFSG+ ++  GVLYG GVENG
Sbjct  278  KLKETFFSGNPDKYAGVLYGLGVENG  303



>gb|EYU32376.1| hypothetical protein MIMGU_mgv1a026872mg [Erythranthe guttata]
Length=272

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 149/206 (72%), Gaps = 1/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE GNLPTC     C WQ  FRE +  ED+ A DSIE LR+ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDENGNLPTCDN-TCCIWQFNFREFNVSEDIFANDSIELLRES  123

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E+GI+   F ELL SSGIVLND+V WV FH GYD GYLLK+     LP    
Sbjct  124  GIDFKKNNEAGIDASHFAELLMSSGIVLNDNVRWVTFHSGYDFGYLLKLLTCRSLPESAV  183

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF ++N YFP V+ IKH M+FCNSLHG  NKLA LLE+ER+G+ HQAGSDSL     F+
Sbjct  184  GFFNMLNLYFPVVYDIKHLMKFCNSLHGGLNKLAELLEIERIGICHQAGSDSLLTSSAFK  243

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K KDNFF+G  E+  GVLYG GVENG
Sbjct  244  KLKDNFFNGFTEKYAGVLYGLGVENG  269



>ref|XP_010537879.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Tarenaya 
hassleriana]
Length=277

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 151/207 (73%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  V+MLKLIQ+GLTFSDE GNLPTCGT K+C WQ   RE DP  D+ + DSIE LRQ 
Sbjct  65   LKLNVNMLKLIQIGLTFSDENGNLPTCGTDKHCIWQFNLREFDPNSDIYSQDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E+GI+  RF ELL SSG+VLN+ + WV FH GYD G LLK+     LP  Q 
Sbjct  125  GIDFTKNNENGIDSGRFAELLISSGLVLNEDIQWVTFHSGYDFG-LLKLLTNRNLPEMQS  183

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH MRFCNSLHG  NKLA LLEVERVGV HQAGSDSL    ++R
Sbjct  184  GFFKLINMYFPILYDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTLRSYR  243

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFF G L++  GVLYG GV+NG 
Sbjct  244  KLKENFFIGCLKKYSGVLYGLGVDNGH  270



>ref|XP_004287117.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 151/207 (73%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLTFSDE GNLPTCGT KYC WQ  F   +  ED+ A +SIE L   
Sbjct  65   LKLNVDLLKLIQLGLTFSDENGNLPTCGTDKYCVWQFNFCNFNLNEDMYAPESIELLTHS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+ RRF ELL +SGIVLN++V WV FH GYD GYLLK+    +LP  Q 
Sbjct  125  GMDFKKNNEKGIDARRFSELLMTSGIVLNENVVWVTFHSGYDFGYLLKLLTCKDLPDSQT  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP+++ +KH MRFCNSLHG  NKLA LL+VERVG+ HQAGSDSL    TF 
Sbjct  185  KFFELINLYFPKIYDVKHLMRFCNSLHGGLNKLAELLDVERVGISHQAGSDSLLTSFTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGS ++  GVLYG G+E G 
Sbjct  245  KLKNNFFSGSPKKYAGVLYGLGIEYGH  271



>gb|KJB06633.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
Length=206

 Score =   260 bits (665),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 142/196 (72%), Gaps = 1/196 (1%)
 Frame = -3

Query  742  QLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQCGXDFEKNXESG  563
            QLGLTFSD  GNLPTCGT  +C WQ  FRE +  ED+   DSIE L QCG DF+KN E G
Sbjct  9    QLGLTFSDANGNLPTCGTDNFCIWQFNFREFNISEDIFVSDSIELLLQCGIDFKKNNEKG  68

Query  562  IEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQGFFALINXYFP  383
            I+ +RFGELL SSGIVLND VHWV FH GYD GYLLK+     LP  Q GFF LI  YFP
Sbjct  69   IDVKRFGELLMSSGIVLNDDVHWVTFHSGYDFGYLLKLLTCRSLPDSQTGFFKLIKLYFP  128

Query  382  EVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFRKXKDNFFSGSL  203
             V+ IKH M+FCN LHG  NKLA LLEVERVGV HQAGSDSL   CTFRK +DNFF  S+
Sbjct  129  MVYDIKHMMKFCNGLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNFFK-SV  187

Query  202  EEXXGVLYGXGVENGQ  155
            ++  GVLYG  VE GQ
Sbjct  188  QKYAGVLYGLEVEGGQ  203



>ref|NP_196657.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9LEU4.1|CAF1J_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 10 [Arabidopsis 
thaliana]
 emb|CAB96851.1| CCR4-ASSOCIATED FACTOR-like protein [Arabidopsis thaliana]
 gb|AAN13040.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AED91615.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=277

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 151/207 (73%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQ+GLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGEL+ SSGIVLND++ WV FH GYD GYL+K+    ELP  Q 
Sbjct  125  GIDFKKNIEKGIDVVRFGELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKELPLKQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP V+ IKH M FCN L G  N+LA L+ VERVG+ HQAGSDSL    +FR
Sbjct  185  DFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+ +F GS E+  GVLYG GVE+G 
Sbjct  245  KLKERYFPGSTEKYTGVLYGLGVEDGT  271



>ref|XP_002871445.1| hypothetical protein ARALYDRAFT_487926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47704.1| hypothetical protein ARALYDRAFT_487926 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   262 bits (669),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 151/207 (73%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQ+GLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGEL+ SSGIVLND++ WV FH GYD GYL+K+    ELP  Q 
Sbjct  125  GIDFKKNIEKGIDVVRFGELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKELPLKQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP V+ IKH M FCN L G  N+LA L+ VERVG+ HQAGSDSL    +FR
Sbjct  185  DFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+ +F GS E+  GVLYG GVE+G 
Sbjct  245  KLKERYFPGSTEKYTGVLYGLGVEDGT  271



>gb|AAK92792.1| putative CCR4-associated factor [Arabidopsis thaliana]
Length=277

 Score =   262 bits (669),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 151/207 (73%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQ+GLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGEL+ SSGIVLND++ WV FH GYD GYL+K+    ELP  Q 
Sbjct  125  GIDFKKNIEKGIDVVRFGELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKELPLKQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP V+ IKH M FCN L G  N+LA L+ VERVG+ HQAGSDSL    +FR
Sbjct  185  DFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+ +F GS E+  GVLYG GVE+G 
Sbjct  245  KPKERYFPGSTEKYTGVLYGLGVEDGT  271



>ref|XP_006399590.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 ref|XP_006399591.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 gb|ESQ41043.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 gb|ESQ41044.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
Length=277

 Score =   261 bits (668),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 151/207 (73%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQ+GLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGEL+ SSGIVLND++ WV FH GYD GYL+K+     LP  Q 
Sbjct  125  GIDFKKNVEKGIDVVRFGELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKALPVKQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP V+ IKH M FCN L G  N+LA L+ VERVG+ HQAGSDSL    +FR
Sbjct  185  DFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+ +F+GS E+  GVLYG GVE+G 
Sbjct  245  KLKERYFTGSTEKYTGVLYGLGVEDGT  271



>gb|ABK22659.1| unknown [Picea sitchensis]
Length=284

 Score =   262 bits (669),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 149/204 (73%), Gaps = 0/204 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+  VD+LKLIQLGLTFSDE GNLP+CGT +YC WQ  FRE +  ED  A DSIE LRQ 
Sbjct  65   LRSNVDVLKLIQLGLTFSDEDGNLPSCGTDRYCVWQFNFREFNIWEDAYASDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G++  RF ELL SSGIVLN++V W+ FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNSELGVDSHRFAELLMSSGIVLNENVRWITFHSGYDFGYLLKLVMNRRLPLTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI  YFP ++ IKH M+FCNSLHG  N+LA LLEVER G  HQAGSDSL   CTFR
Sbjct  185  GFFYLIRMYFPNLYDIKHLMKFCNSLHGGLNRLAELLEVERFGACHQAGSDSLLTSCTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVE  164
            K +++FF+G+ ++  GVLYG G E
Sbjct  245  KLRESFFNGAADKYAGVLYGLGEE  268



>ref|XP_010453129.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
 ref|XP_010453130.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=278

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 150/206 (73%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQ+GLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIV+ND + WV FH GYD GYL+K+    ELP  Q 
Sbjct  125  GIDFKKNVEKGIDVVRFGELLMSSGIVMNDDISWVTFHGGYDFGYLVKLLICKELPLKQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP V+ IKH M FCN L G  N+LA L+ VERVG+ HQAGSDSL    +FR
Sbjct  185  DFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+ +F GS E+  GVLYG GVE+G
Sbjct  245  KLKERYFPGSTEKYTGVLYGLGVEDG  270



>ref|XP_006286536.1| hypothetical protein CARUB_v10001652mg [Capsella rubella]
 gb|EOA19434.1| hypothetical protein CARUB_v10001652mg [Capsella rubella]
Length=282

 Score =   260 bits (664),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 151/206 (73%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQ+GLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGEL+ SSGIVLNDS+ WV FH GYD GYL+K+    ELP  Q 
Sbjct  125  GIDFKKNIEKGIDVVRFGELMMSSGIVLNDSISWVTFHGGYDFGYLVKLLTCKELPLKQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP V+ IK+ M FCN L G  N+LA L+ VERVG+ HQAGSDSL    +FR
Sbjct  185  DFFKLLFVYFPTVYDIKYLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K K+ +F GS E+  GVLYG GVE+G
Sbjct  245  KLKERYFPGSTEKYTGVLYGLGVEDG  270



>ref|XP_010419649.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
 ref|XP_010419650.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=277

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 149/207 (72%), Gaps = 0/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQ+GLTFSDE GNLP CGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQVGLTFSDENGNLPKCGTDKFCIWQFNFREFNIGEDIYASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIV+ND + WV FH GYD GYL+K+    ELP  Q 
Sbjct  125  GIDFKKNVEKGIDVVRFGELLMSSGIVMNDDISWVTFHGGYDFGYLVKLLTCKELPLKQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP V+ IKH M FCN L G  N+LA L+ VERVGV HQAGSDSL    +FR
Sbjct  185  DFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+ +F GS E+  GVLYG GVE+G 
Sbjct  245  KLKERYFPGSTEKYTGVLYGLGVEDGT  271



>ref|XP_002309331.1| hypothetical protein POPTR_0006s20130g [Populus trichocarpa]
 gb|EEE92854.1| hypothetical protein POPTR_0006s20130g [Populus trichocarpa]
Length=269

 Score =   259 bits (661),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 144/205 (70%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLT SDEKGNLPTCGT KYC WQ  F + +P EDV A DSIE L Q 
Sbjct  65   LKANVDLLKLIQLGLTLSDEKGNLPTCGTDKYCVWQFNFCDFNPNEDVYANDSIELLSQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E G +  RF ELL +SGIVLND VHWV FH GYD GYLLK+    +LP  Q 
Sbjct  125  GIDFVKNAEVGADATRFTELLMTSGIVLNDDVHWVTFHSGYDFGYLLKMLTGKKLPDTQV  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI  YFP ++ IKH M+FCN LHG  NKLA  L V+R+G+ HQAGSDSL    TF 
Sbjct  185  DFFKLIKIYFPVLYDIKHLMKFCNGLHGGLNKLAEQLGVKRIGISHQAGSDSLLTSSTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            K K+ FFSGS E   GVLYG GVEN
Sbjct  245  KLKEIFFSGSPERYAGVLYGLGVEN  269



>ref|XP_010491786.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=279

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 149/205 (73%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQ+GLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQVGLTFSDENGNLPTCGTDKFCIWQFNFREFNIGEDIFASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIV+ND + WV FH GYD GYL+K+    ELP  Q 
Sbjct  125  GIDFKKNVEKGIDVVRFGELLMSSGIVMNDDISWVTFHGGYDFGYLVKLLICKELPLKQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP V+ IKH M FCN L G  N+LA L+ VERVGV HQAGSDSL    +FR
Sbjct  185  DFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            K K+ +F GS E+  GVLYG GVE+
Sbjct  245  KLKERYFPGSTEKYTGVLYGLGVED  269



>ref|XP_011033459.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=269

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 145/205 (71%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD+LKLIQLGLT SDEKGNLPTCGT KYC WQ  F + +P EDV A DSIE L Q 
Sbjct  65   LKANVDLLKLIQLGLTLSDEKGNLPTCGTDKYCVWQFNFCDFNPNEDVYANDSIELLSQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E G +  RF ELL +SGIVLND+VHWV FH GYD GYLLK+    +LP  Q 
Sbjct  125  GIDFVKNAEDGADATRFTELLMTSGIVLNDNVHWVTFHSGYDFGYLLKMLTGKKLPDTQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LI  YFP ++ IKH M+FCN LHG  NKLA  L V+R+G+ HQAGSDSL    TF 
Sbjct  185  DFFNLIKIYFPVLYDIKHLMKFCNGLHGGLNKLAEQLGVKRIGISHQAGSDSLLTSSTFM  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            + K+ FFSGS E   GVLYG GV+N
Sbjct  245  RLKEIFFSGSPERYAGVLYGLGVDN  269



>emb|CDX97069.1| BnaC09g45560D [Brassica napus]
Length=280

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 150/205 (73%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCVWQFNFREFNIGEDIYASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGEL+ SSG+VLNDS+ WV FH GYD GYL+K+    ELP  Q 
Sbjct  125  GIDFKKNVERGIDVVRFGELMMSSGVVLNDSISWVTFHGGYDFGYLVKLLTCKELPLKQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF ++  YFP V+ IK+ M FCN L G  N+LA L+ VERVG+ HQAGSDSL    +FR
Sbjct  185  DFFKMLFVYFPTVYDIKYLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            K K+ +F GS E+  GVLYG GVE+
Sbjct  245  KLKERYFPGSTEKYTGVLYGLGVED  269



>emb|CDX69796.1| BnaA10g21450D [Brassica napus]
Length=278

 Score =   258 bits (659),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 150/205 (73%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGEL+ SSGIVLNDS+ W+ FH GYD GYL+K+    ELP  Q 
Sbjct  125  GIDFKKNVEKGIDVVRFGELMMSSGIVLNDSISWITFHGGYDFGYLVKLLTCKELPLRQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF ++  YFP V+ IK+ M FCN L G  N+LA L+ VERVG+ HQAGSDSL    +FR
Sbjct  185  DFFKMLFVYFPTVYDIKYLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            K K+ +F GS E+  GVLYG GVE+
Sbjct  245  KLKERYFPGSTEKYTGVLYGLGVED  269



>ref|XP_009122009.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
 ref|XP_009122010.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
Length=280

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 150/205 (73%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +  ED+ A +SIE LRQC
Sbjct  65   LKENVDLLKLIQLGLTFSDEDGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQC  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGEL+ SSGIVLNDS+ W+ FH GYD GYL+K+    ELP  Q 
Sbjct  125  GIDFKKNVERGIDVVRFGELMMSSGIVLNDSISWITFHGGYDFGYLVKLLTCKELPLRQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF ++  YFP V+ IK+ M FCN L G  N+LA L+ VERVG+ HQAGSDSL    +FR
Sbjct  185  DFFKMLFVYFPTVYDIKYLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            K K+ +F GS E+  GVLYG GVE+
Sbjct  245  KLKERYFPGSTEKYTGVLYGLGVED  269



>ref|NP_001148663.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
 gb|ACG32425.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
Length=237

 Score =   255 bits (651),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 143/207 (69%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS  +G LP  G   + C WQ  FRE D   D+ A DSIE LR+
Sbjct  27   LKANVDMLHLIQLGLTFSGPRGELPALGAGRRRCVWQFNFREFDDARDIFASDSIELLRR  86

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF +N E G++ RRF ELL SSG+VLNDSV+WV FH GYD GYLLKI     LP  Q
Sbjct  87   SGIDFRRNAERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCNSLPDTQ  146

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF L+  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F
Sbjct  147  AGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAF  206

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K KD+FF+GS E+  GVLYG   ENG
Sbjct  207  WKLKDSFFAGSTEKYAGVLYGLNAENG  233



>gb|AEN81307.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81308.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81309.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81310.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81311.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81312.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81313.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81314.1| AT1G80780-like protein, partial [Capsella rubella]
Length=200

 Score =   253 bits (647),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  V++LK+IQLGLTFS+E+GNLPTCGT KYC WQ  F E D   D+ A DSIE L+Q 
Sbjct  14   LKTNVNILKMIQLGLTFSNEQGNLPTCGTDKYCIWQFNFGEFDLDSDIFAVDSIELLKQS  73

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G D  KN + GI+ +RF ELL SSGIVLN++VHWV FH GYD GYLLK+     LP  Q 
Sbjct  74   GIDLAKNTQDGIDSKRFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQT  133

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF LIN YFP V+ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  134  DFFKLINVYFPTVYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFR  193

Query  235  KXKDNFF  215
            K K+NFF
Sbjct  194  KLKENFF  200



>ref|XP_002452981.1| hypothetical protein SORBIDRAFT_04g035960 [Sorghum bicolor]
 gb|EES05957.1| hypothetical protein SORBIDRAFT_04g035960 [Sorghum bicolor]
Length=288

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 143/207 (69%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS  +G LP  G   + C WQ  FRE D   D+ A DSIE LR+
Sbjct  78   LKANVDMLHLIQLGLTFSGPRGELPALGAGRRRCVWQFNFREFDDARDIFASDSIELLRR  137

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF +N E G++ RRF ELL SSG+VLNDSV+WV FH GYD GYLLKI     LP  Q
Sbjct  138  SGIDFRRNAERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQ  197

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF L+  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F
Sbjct  198  AGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAF  257

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K KD+FF+GS E+  GVLYG   ENG
Sbjct  258  WKLKDSFFAGSTEKYAGVLYGLNAENG  284



>ref|XP_009131188.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
 emb|CDX78405.1| BnaA03g03170D [Brassica napus]
Length=278

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 149/207 (72%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK+ VD+LKLIQ+GLTFSDE GNLPTCG   K+C WQ  FRE +  ED+ A +SIE LRQ
Sbjct  65   LKENVDLLKLIQVGLTFSDEDGNLPTCGADDKFCVWQFNFREFNIGEDIYASESIELLRQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
            CG DF+KN E GI+  RFGEL+ SSGIVLNDS+ WV FH GYD GYL+K+    ELP  Q
Sbjct  125  CGIDFKKNLERGIDVARFGELMMSSGIVLNDSISWVTFHGGYDFGYLVKLLTCKELPIKQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF L+  YFP V+ IKH M FCN L G  N+LA L+ VERVGV HQAGSDSL    +F
Sbjct  185  ADFFKLLYVYFPTVYDIKHLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLTLGSF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
            RK K+ +F GS E   GVLYG GVE+G
Sbjct  245  RKLKERYFPGSTERYSGVLYGLGVEDG  271



>gb|ACL53982.1| unknown [Zea mays]
 gb|AFW73867.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
Length=287

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 143/207 (69%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS  +G LP  G   + C WQ  FRE D   D+ A DSIE LR+
Sbjct  77   LKANVDMLHLIQLGLTFSGPRGELPALGAGRRRCVWQFNFREFDDARDIFASDSIELLRR  136

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF +N E G++ RRF ELL SSG+VLNDSV+WV FH GYD GYLLKI     LP  Q
Sbjct  137  SGIDFRRNAERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCNSLPDTQ  196

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF L+  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F
Sbjct  197  AGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAF  256

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K KD+FF+GS E+  GVLYG   ENG
Sbjct  257  WKLKDSFFAGSTEKYAGVLYGLNAENG  283



>ref|XP_004954218.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Setaria 
italica]
Length=287

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 143/207 (69%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS  +G LP  G   + C WQ  FRE D   D+ A DSIE LR+
Sbjct  77   LKANVDMLHLIQLGLTFSGPRGELPALGADRRRCVWQFNFREFDDARDIFASDSIELLRR  136

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF +N E G++ RRF ELL SSG+VLNDSV+WV FH GYD GYLLKI     LP  Q
Sbjct  137  SGIDFRRNAERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCNSLPDTQ  196

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF L+  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F
Sbjct  197  AGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAF  256

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K KD+FF+GS E+  GVLYG   ENG
Sbjct  257  WKLKDSFFAGSTEKYAGVLYGLNAENG  283



>gb|EEC74173.1| hypothetical protein OsI_09281 [Oryza sativa Indica Group]
Length=295

 Score =   254 bits (649),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 142/206 (69%), Gaps = 1/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS  +G LP  G   + C WQ  FRE D   D+ A DSIE LR+
Sbjct  85   LKANVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRR  144

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF +N E G++ RRF ELL SSG+VLNDSV+WV FH GYD GYLLKI     LP  Q
Sbjct  145  SGIDFRRNSERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQ  204

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF L+  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F
Sbjct  205  AGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAF  264

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVEN  161
             K KD+FF+GS E+  GVLYG   EN
Sbjct  265  WKLKDSFFAGSTEKYAGVLYGLNAEN  290



>dbj|BAD19081.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD19282.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
Length=293

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 142/206 (69%), Gaps = 1/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS  +G LP  G   + C WQ  FRE D   D+ A DSIE LR+
Sbjct  83   LKANVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRR  142

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF +N E G++ RRF ELL SSG+VLNDSV+WV FH GYD GYLLKI     LP  Q
Sbjct  143  SGIDFRRNSERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQ  202

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF L+  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F
Sbjct  203  AGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAF  262

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVEN  161
             K KD+FF+GS E+  GVLYG   EN
Sbjct  263  WKLKDSFFAGSTEKYAGVLYGLNAEN  288



>ref|NP_001048387.1| Os02g0796300 [Oryza sativa Japonica Group]
 dbj|BAF10301.1| Os02g0796300 [Oryza sativa Japonica Group]
 dbj|BAG88128.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93253.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99633.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57976.1| hypothetical protein OsJ_08719 [Oryza sativa Japonica Group]
Length=295

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 142/206 (69%), Gaps = 1/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS  +G LP  G   + C WQ  FRE D   D+ A DSIE LR+
Sbjct  85   LKANVDMLHLIQLGLTFSSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRR  144

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF +N E G++ RRF ELL SSG+VLNDSV+WV FH GYD GYLLKI     LP  Q
Sbjct  145  SGIDFRRNSERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQ  204

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF L+  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F
Sbjct  205  AGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAF  264

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVEN  161
             K KD+FF+GS E+  GVLYG   EN
Sbjct  265  WKLKDSFFAGSTEKYAGVLYGLNAEN  290



>dbj|BAJ92910.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 141/207 (68%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS   G LP  G   + C WQ  FRE D   D+ A DSIE LR 
Sbjct  79   LKANVDMLHLIQLGLTFSGPTGELPALGAGRRRCVWQFNFREFDDERDIFATDSIELLRH  138

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF +N E G++ RRF ELL SSG+VLND+V+WV FH GYD GYLLKI     LP  Q
Sbjct  139  SGIDFRRNAERGVDARRFAELLMSSGVVLNDAVYWVTFHAGYDFGYLLKILTCNSLPDTQ  198

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF L+  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F
Sbjct  199  AGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTPCAF  258

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K KD+FF+GS E+  GVLYG   ENG
Sbjct  259  WKLKDSFFAGSTEKYAGVLYGLNAENG  285



>ref|XP_008352217.1| PREDICTED: probable CCR4-associated factor 1 homolog 7, partial 
[Malus domestica]
Length=194

 Score =   248 bits (633),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 138/190 (73%), Gaps = 0/190 (0%)
 Frame = -3

Query  727  FSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQCGXDFEKNXESGIEXRR  548
            FSDEKGNLPTCGT K+C WQ  FR+ +P EDV A DSIE L Q G DF KN E G++  +
Sbjct  1    FSDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQSGMDFVKNNEKGVDASK  60

Query  547  FGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQGFFALINXYFPEVFXI  368
            F ELL +SG+VL+D+V WV FH GYD GYLLK+     LP  Q GFF +I  YFP V+ I
Sbjct  61   FTELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLPNTQVGFFKMIKVYFPTVYDI  120

Query  367  KHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFRKXKDNFFSGSLEEXXG  188
            KH MRFCNSLHG  NKLA LL+VER+G+ HQAGSDSL    TF K K+ FF GS+++  G
Sbjct  121  KHLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFMKLKETFFDGSIDKYAG  180

Query  187  VLYGXGVENG  158
            VLYG GVENG
Sbjct  181  VLYGLGVENG  190



>gb|KHN38030.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=272

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = -3

Query  679  CXWQXXFREXDPXEDVXAXDSIEXLRQCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSV  500
            C WQ  FRE +  EDV A DSIE LRQ G DF++N E+GI+  RFGELL SSGIVLND++
Sbjct  95   CIWQFNFREFNVNEDVFANDSIELLRQSGIDFKRNNENGIDAHRFGELLMSSGIVLNDNI  154

Query  499  HWVXFHXGYDXGYLLKIXXXXELPXXQQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNK  320
            HWV FH GYD GYLLK+    +LP  Q GFF LIN YFP V+ IKH M+FCNSLHG  NK
Sbjct  155  HWVTFHSGYDFGYLLKLLTCQDLPDTQVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNK  214

Query  319  LAXLLEVERVGVXHQAGSDSLXXXCTFRKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            LA LLEVERVG+ HQAGSDSL   CTFRK KDNFFSGSLE+  GVLYG GVENGQ
Sbjct  215  LAELLEVERVGISHQAGSDSLLTSCTFRKLKDNFFSGSLEKYAGVLYGLGVENGQ  269



>ref|XP_003570299.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=295

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 140/207 (68%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS   G LP  G   + C WQ  FRE D   D+ A DSIE LR 
Sbjct  85   LKANVDMLHLIQLGLTFSGPTGELPALGAGRRRCVWQFNFREFDDARDIFATDSIELLRH  144

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G +F  N E G++ RRF ELL SSG+VLND+V+WV FH GYD GYLLKI     LP  Q
Sbjct  145  SGINFRLNAERGVDARRFAELLMSSGVVLNDAVYWVTFHAGYDFGYLLKILTCNSLPDTQ  204

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF L+  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F
Sbjct  205  AGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAF  264

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K KD+FF+GS E+  GVLYG   ENG
Sbjct  265  WKLKDSFFAGSTEKYAGVLYGLNAENG  291



>gb|EMT24915.1| Putative CCR4-associated factor 1-7-like protein [Aegilops tauschii]
Length=205

 Score =   246 bits (628),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 137/201 (68%), Gaps = 1/201 (0%)
 Frame = -3

Query  757  MLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQCGXDFE  581
            ML LIQLGLTFS   G LP  G   + C WQ  FRE D   D+ A DSIE LR  G DF 
Sbjct  1    MLHLIQLGLTFSGPTGELPALGAGRRRCVWQFNFREFDDERDIFATDSIELLRHSGIDFR  60

Query  580  KNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQGFFAL  401
            +N E G++ RRF ELL SSG+VLND+V+WV FH GYD GYLLKI     LP  Q GFF L
Sbjct  61   RNAERGVDARRFAELLMSSGVVLNDAVYWVTFHAGYDFGYLLKILTCNSLPDTQAGFFKL  120

Query  400  INXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFRKXKDN  221
            +  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F K KD+
Sbjct  121  MKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDS  180

Query  220  FFSGSLEEXXGVLYGXGVENG  158
            FF+GS E+  GVLYG   ENG
Sbjct  181  FFAGSTEKYAGVLYGLNAENG  201



>ref|XP_006648046.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=297

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/207 (60%), Positives = 140/207 (68%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS  +G LP  G   + C WQ  FRE D   D+ A DSIE LR+
Sbjct  87   LKANVDMLHLIQLGLTFSGPRGELPVMGDGRRRCVWQFNFREFDDAHDIFASDSIELLRR  146

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF +N E G++ RRF ELL SSG+VLNDSV+WV FH GYD GYLLKI     LP  Q
Sbjct  147  SGIDFRRNAERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQ  206

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF L+  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDS    C F
Sbjct  207  ASFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSFVTSCAF  266

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K KD+FF GS E+  GVLYG   +NG
Sbjct  267  WKLKDSFFGGSTEKYAGVLYGLNADNG  293



>gb|EPS59819.1| hypothetical protein M569_14984, partial [Genlisea aurea]
Length=275

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 146/209 (70%), Gaps = 2/209 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VD+LKLIQLGLTFSDE GNLPTCGT K+C WQ  FRE +P ED  A DS++ LRQ 
Sbjct  65   LKDNVDLLKLIQLGLTFSDEHGNLPTCGTDKHCIWQFNFREFNPSEDAFAADSVQLLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF  N + G+   RFGEL+ +SG+VLN+ V WV FH GYD GYLLK+     +P  Q 
Sbjct  125  GIDFAANSQKGVSAARFGELIMTSGVVLNEDVSWVTFHSGYDFGYLLKVLTRRRMPETQA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVER-VGVXHQAGSDSLXXXCTF  239
            GF+ LI  +FP V+ +KH M+F NSL+G  NKLA  L +ER VG+ HQAGSDSL   CTF
Sbjct  185  GFYGLIRVFFPVVYDVKHLMKFSNSLYGGLNKLAEQLGIERVVGISHQAGSDSLLTCCTF  244

Query  238  RKXKD-NFFSGSLEEXXGVLYGXGVENGQ  155
            R  ++  +F GSLE+  GVLYG   E+ Q
Sbjct  245  RMLREKKYFRGSLEKYAGVLYGLDDEDAQ  273



>ref|XP_001766532.1| predicted protein [Physcomitrella patens]
 gb|EDQ68597.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   246 bits (627),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 147/205 (72%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+  VDMLKLIQLGLTFSDE G LP CG+   C WQ  FRE +  EDV A DSIE L+Q 
Sbjct  65   LRANVDMLKLIQLGLTFSDENGVLPRCGSRDSCVWQFNFREFNLREDVYAHDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF++N E GI+ +RFGELL SSGIVLN++VHW+ FH GYD GYLLK+     LP  + 
Sbjct  125  GIDFQRNEERGIDSQRFGELLMSSGIVLNENVHWITFHSGYDFGYLLKLLTCQNLPTSED  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP ++ IK+ M+FC++LHG  N+LA  L+VER+G  HQAGSDSL    TFR
Sbjct  185  EFFNLMRTYFPTLYDIKYLMKFCDNLHGGLNRLAETLDVERIGPCHQAGSDSLLTSRTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            K KD FF+GS E+  GVL+G G +N
Sbjct  245  KLKDGFFNGSTEKYAGVLFGLGSDN  269



>ref|XP_006368924.1| hypothetical protein POPTR_0001s14860g [Populus trichocarpa]
 gb|ERP65493.1| hypothetical protein POPTR_0001s14860g [Populus trichocarpa]
Length=242

 Score =   244 bits (624),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 139/207 (67%), Gaps = 32/207 (15%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GNLPTCGT KYC WQ  FRE +  ED             
Sbjct  65   LKDNVDMLKLIQLGLTFSDEQGNLPTCGTDKYCIWQFNFREFNVNED-------------  111

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
                               LL SSGIVLND+V+WV FH GYD GYLLK+     LP  Q 
Sbjct  112  -------------------LLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQNLPDTQA  152

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LIN YFP ++ IKH M+FCNSLHG  NKLA LLEVERVG+ HQAGSDSL   CTFR
Sbjct  153  GFFNLINMYFPTLYDIKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFR  212

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K K+NFFSGSLE+  GVLYG GVENGQ
Sbjct  213  KLKENFFSGSLEKYAGVLYGLGVENGQ  239



>ref|XP_001755261.1| predicted protein [Physcomitrella patens]
 gb|EDQ79741.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 147/205 (72%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+  VDMLKLIQLGLTFSDE G LP CG+   C WQ  FRE +  EDV A DSIE L+Q 
Sbjct  65   LRANVDMLKLIQLGLTFSDENGVLPRCGSRDSCVWQFNFREFNLREDVYAHDSIELLKQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF++N E GI+ +RFGELL SSGIVLN++VHW+ FH GYD GYLLK+     LP  + 
Sbjct  125  GIDFQQNEERGIDSQRFGELLMSSGIVLNENVHWITFHSGYDFGYLLKLLTCQNLPTSED  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP ++ IK+ M+FC++LHG  N+LA  L+VER+G  HQAGSDSL    TFR
Sbjct  185  EFFNLLRTYFPTLYDIKYLMKFCDNLHGGLNRLAETLDVERIGPCHQAGSDSLLTSRTFR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            K KD FF+GS E+  GVL+G G +N
Sbjct  245  KLKDGFFNGSTEKYAGVLFGLGSDN  269



>ref|NP_001136747.1| uncharacterized protein LOC100216888 [Zea mays]
 gb|ACF82526.1| unknown [Zea mays]
 gb|AFW64146.1| hypothetical protein ZEAMMB73_273082 [Zea mays]
Length=287

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 139/205 (68%), Gaps = 1/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS  +G LP  G   + C WQ  FRE D   D+ A DSIE LR+
Sbjct  77   LKANVDMLHLIQLGLTFSGPRGELPVLGAGRRRCVWQFNFREFDDARDIFASDSIELLRR  136

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G D   N E G++ RRF ELL SSG+VLNDSV+WV FH GYD GYLLKI     LP  Q
Sbjct  137  SGIDLRLNAERGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCNCLPDTQ  196

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF L+  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F
Sbjct  197  AGFFKLMKIYFPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAF  256

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVE  164
             K KD+FF+GS E+  GVLYG   E
Sbjct  257  WKLKDSFFTGSTEKYAGVLYGLNAE  281



>dbj|BAK01540.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00477.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   245 bits (625),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 141/208 (68%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDMLKLIQLGLTFSDE+G LP  G   + C WQ  FR  DP  DV A DSI+ LR+
Sbjct  67   LKANVDMLKLIQLGLTFSDERGGLPALGPDGRPCVWQFNFRGFDPRTDVAAADSIDLLRR  126

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF ++   G + RRF ELL SSG+VLN  +HWV FH GYD GYLLK+     LP   
Sbjct  127  SGIDFARHAAEGADSRRFAELLMSSGVVLNAEIHWVTFHSGYDFGYLLKLLTGSNLPDTS  186

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LI  YFP ++ IKH MRFCNSLHG  NKLA LL+VERVG+ HQAGSDSL    +F
Sbjct  187  SGFFDLIRIYFPVIYDIKHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTALSF  246

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
             K K+++F G  E+  GVLYG G E G+
Sbjct  247  NKLKESYFGGLTEKYAGVLYGLGTEGGE  274



>ref|XP_002460215.1| hypothetical protein SORBIDRAFT_02g024730 [Sorghum bicolor]
 gb|EER96736.1| hypothetical protein SORBIDRAFT_02g024730 [Sorghum bicolor]
Length=279

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 140/208 (67%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDMLKLIQLGLTFSDE G LP  G   + C WQ  FR  DP  DV A DSI+ LR+
Sbjct  67   LKANVDMLKLIQLGLTFSDEHGGLPALGADGRPCVWQFNFRGFDPRTDVAASDSIDLLRR  126

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF ++   G + RRF ELL SSG+VLN  VHWV FH GYD GYLLK+     LP   
Sbjct  127  SGIDFSRHAADGADARRFAELLMSSGVVLNSDVHWVTFHSGYDFGYLLKLLTGTNLPDTM  186

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LI  YFP ++ IKH MRFCNSLHG  NKLA LL+V RVG+ HQAGSDSL    +F
Sbjct  187  SGFFDLIKIYFPVIYDIKHLMRFCNSLHGGLNKLAELLDVARVGICHQAGSDSLLTALSF  246

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            +K K+ +F+G  E+  GVLYG G E G+
Sbjct  247  KKLKEAYFNGLTEKYAGVLYGLGFEGGE  274



>ref|XP_006665053.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=300

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 139/207 (67%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLTFS  +G LP  G   + C WQ  F E D   D+ A DSIE LR+
Sbjct  90   LKANVDMLHLIQLGLTFSGPRGELPALGDDRRRCVWQFNFCEFDDARDIFASDSIELLRR  149

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF +N E G++ RRF ELL SSG+VLNDSV+WV FH GYD GYLLKI     LP  Q
Sbjct  150  SGLDFRRNAECGVDARRFAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCNSLPDTQ  209

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF L+  YFP  + IKH ++FCNSLHG  NKLA LL+VERVG  HQAGSDS    C F
Sbjct  210  VGFFKLMKIYFPTFYDIKHLIKFCNSLHGGLNKLAELLDVERVGESHQAGSDSFVTSCAF  269

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K KD+FF GS E+  GVLYG   ENG
Sbjct  270  WKLKDSFFGGSTEKYAGVLYGLNAENG  296



>ref|XP_006660627.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=280

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 141/208 (68%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDMLKLIQLGLTFSDE+G LP  G   + C WQ  FR  DP  DV A DSIE LR+
Sbjct  67   LKANVDMLKLIQLGLTFSDERGGLPALGPEGRPCVWQFNFRGFDPRNDVAASDSIELLRR  126

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF ++   G +  RF ELL SSG+VLN  V WV FH GYD GYLLK+     LP   
Sbjct  127  SGIDFARHSADGADACRFAELLMSSGVVLNSEVRWVTFHSGYDFGYLLKLITGTNLPDTI  186

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LI  YFP V+ IKH MRFCNSLHG  NKLA LL+VERVG+ HQAGSDSL    +F
Sbjct  187  SGFFDLIRIYFPVVYDIKHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTALSF  246

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            +K K+++F+G  E+  GVLYG G E G+
Sbjct  247  KKLKESYFNGLTEKYAGVLYGLGTEGGE  274



>gb|EMS46974.1| putative CCR4-associated factor 1-like protein 7 [Triticum urartu]
Length=237

 Score =   239 bits (610),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 134/197 (68%), Gaps = 1/197 (1%)
 Frame = -3

Query  745  IQLGLTFSDEKGNLPTCGT-XKYCXWQXXFREXDPXEDVXAXDSIEXLRQCGXDFEKNXE  569
            ++LGLTFS   G LP  G   + C WQ  FRE D   D+ A DSIE LR  G DF +N E
Sbjct  37   VELGLTFSGPTGELPALGAGRRRCVWQFNFREFDDERDIFATDSIELLRHSGIDFRRNAE  96

Query  568  SGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQGFFALINXY  389
             G++ RRF ELL SSG+VLND+V+WV FH GYD GYLLKI     LP  Q GFF L+  Y
Sbjct  97   RGVDARRFAELLMSSGVVLNDAVYWVTFHAGYDFGYLLKILTCNSLPDTQAGFFKLMKIY  156

Query  388  FPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFRKXKDNFFSG  209
            FP V+ IKH M+FCNSLHG  NKLA LL+VERVG  HQAGSDSL   C F K KD+FF+G
Sbjct  157  FPTVYDIKHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAG  216

Query  208  SLEEXXGVLYGXGVENG  158
            S E+  GVLYG   ENG
Sbjct  217  STEKYAGVLYGLNAENG  233



>ref|NP_001063181.1| Os09g0416800 [Oryza sativa Japonica Group]
 dbj|BAD28924.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD29264.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAF25095.1| Os09g0416800 [Oryza sativa Japonica Group]
 gb|EAZ09108.1| hypothetical protein OsI_31373 [Oryza sativa Indica Group]
 gb|EAZ44741.1| hypothetical protein OsJ_29372 [Oryza sativa Japonica Group]
 dbj|BAG89495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94386.1| unnamed protein product [Oryza sativa Japonica Group]
Length=280

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 141/208 (68%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDMLKLIQLGLTFS+E G LP+ G   + C WQ  FR  DP  DV A DSI+ LR+
Sbjct  67   LKANVDMLKLIQLGLTFSNEHGGLPSLGPEGRPCVWQFNFRGFDPRTDVAAADSIDLLRR  126

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF ++   G + RRF ELL SSG+V+N  V WV FH GYD GYLLK+     LP   
Sbjct  127  SGIDFTRHSADGADARRFAELLMSSGVVMNSEVRWVTFHSGYDFGYLLKLLTGTYLPDTI  186

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LI  YFP V+ IKH MRFCNSLHG  NKLA LL+VERVG+ HQAGSDSL    +F
Sbjct  187  TGFFDLIRIYFPVVYDIKHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTALSF  246

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            +K K+ +F+G  E+  GVLYG G E G+
Sbjct  247  KKLKEAYFNGLTEKYAGVLYGLGTEGGE  274



>gb|ACE98441.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98442.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98443.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98444.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98445.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98446.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98447.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98448.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98449.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98450.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98451.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98452.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98453.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98454.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98455.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98456.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98457.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98458.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98459.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98460.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98461.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98462.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98463.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98464.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98465.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98466.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98467.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98468.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98469.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98470.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98471.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98472.1| ribonuclease CAF1, partial [Populus tremula]
Length=167

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 123/167 (74%), Gaps = 0/167 (0%)
 Frame = -3

Query  718  EKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQCGXDFEKNXESGIEXRRFGE  539
            E GNLPTCGT K+C WQ  FRE +  ED+ A DSIE LRQCG DF+ N E GI+  RFGE
Sbjct  1    ENGNLPTCGTDKFCIWQFNFREFNVTEDIFASDSIELLRQCGIDFKMNNEMGIDVNRFGE  60

Query  538  LLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQGFFALINXYFPEVFXIKHX  359
            LL SSGIVLND VHWV FH GYD GYLLK+     LP    GFF LIN YFP V+ IKH 
Sbjct  61   LLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDTPAGFFDLINMYFPMVYDIKHL  120

Query  358  MRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFRKXKDNF  218
            M+FCNSLHG  NKLA LLEVER+GV HQAGSDSL   CTF+K +DNF
Sbjct  121  MKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSCTFKKLRDNF  167



>ref|XP_002965900.1| hypothetical protein SELMODRAFT_84624 [Selaginella moellendorffii]
 ref|XP_002983145.1| hypothetical protein SELMODRAFT_117491 [Selaginella moellendorffii]
 gb|EFJ15954.1| hypothetical protein SELMODRAFT_117491 [Selaginella moellendorffii]
 gb|EFJ33320.1| hypothetical protein SELMODRAFT_84624 [Selaginella moellendorffii]
Length=274

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 144/206 (70%), Gaps = 1/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCG-TXKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            L+  VD+LKLIQLGLTFSDE GNLPT G T +   WQ  FRE +  EDV A DSIE L+Q
Sbjct  61   LRANVDLLKLIQLGLTFSDEDGNLPTFGSTRESYLWQFNFREFNIKEDVYAHDSIELLKQ  120

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF+KN E GI+  RFGELL SSG++LN+SVHW+ FH GYD GYLLK+     LP  +
Sbjct  121  SGIDFQKNQEHGIDAERFGELLMSSGVILNESVHWITFHSGYDFGYLLKLLTCQNLPPSE  180

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF L+  YFP ++ +K+ M+FC++LHG  N+LA +LEVERVG  HQAGSDSL   C F
Sbjct  181  ADFFVLLRIYFPTIYDVKYLMKFCDNLHGGLNRLAEVLEVERVGPCHQAGSDSLLTSCAF  240

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVEN  161
            +K K     GS E+  GVL+G G +N
Sbjct  241  QKLKKGALKGSTEKYAGVLFGLGADN  266



>gb|KCW80614.1| hypothetical protein EUGRSUZ_C01981 [Eucalyptus grandis]
Length=218

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 142/206 (69%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            +K+ VD LKLIQLGLTF D++GNLPTCGT KYC WQ  FR  D  +D     SIE L + 
Sbjct  9    MKNNVDKLKLIQLGLTFLDDEGNLPTCGTDKYCIWQFNFRGFDVTKDEFDGGSIEWLHER  68

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G++  RFGELL SSGI LND V+WV FH  Y+ G+LLK+     LP    
Sbjct  69   GIDFKKNNEKGVDAERFGELLMSSGIALNDGVNWVTFHGKYNFGFLLKLLTCRSLPDTLA  128

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GF+ LI  YFP V+ +KH M+FC+ LH   NKLA LL+VER+GV HQAGSDSL   C F+
Sbjct  129  GFYDLIKMYFPLVYDVKHMMKFCDGLHCNLNKLAELLDVERLGVCHQAGSDSLLVACAFQ  188

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K KD FF+GS  +  G LYG G+++G
Sbjct  189  KLKDCFFNGSAVKYAGALYGLGIQDG  214



>ref|XP_010048148.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW80311.1| hypothetical protein EUGRSUZ_C01670 [Eucalyptus grandis]
Length=281

 Score =   233 bits (595),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 142/206 (69%), Gaps = 0/206 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            +K+ VD LKLIQLGLTF D++GNLPTCGT KYC WQ  FR  D  +D     SIE L + 
Sbjct  72   MKNNVDKLKLIQLGLTFLDDEGNLPTCGTDKYCIWQFNFRGFDVTKDEFDGGSIEWLHER  131

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G+E  RFGELL SSGI LND V+WV FH  Y+ G+LLK+     LP    
Sbjct  132  GIDFKKNNEKGVEAERFGELLMSSGIALNDGVNWVTFHGKYNFGFLLKLLTCRSLPDTLV  191

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GF+ LI  YFP V+ +KH M+FC+ LH   NKLA LL+VER+GV HQAGSDSL   C F+
Sbjct  192  GFYDLIKMYFPLVYDVKHMMKFCDGLHCNLNKLAELLDVERLGVCHQAGSDSLLVACAFQ  251

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENG  158
            K KD FF+GS  +  G LYG G+++G
Sbjct  252  KLKDCFFNGSAVKYAGALYGLGIQDG  277



>ref|XP_003578122.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=279

 Score =   233 bits (594),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 141/208 (68%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDMLKLIQLGLTFSDE+G LP  G   + C WQ  FR  DP  DV A DSI+ LR+
Sbjct  67   LKANVDMLKLIQLGLTFSDERGGLPALGPGGRPCVWQFNFRGFDPRTDVAAADSIDLLRR  126

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF ++   G + RRF ELL SSG+V+N  +HWV FH GYD GYLLK+     LP   
Sbjct  127  SGIDFARHAADGADSRRFAELLMSSGVVMNAEIHWVTFHSGYDFGYLLKLLTGTNLPDTN  186

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LI  YFP ++ IKH MRFCNSLHG  NKLA LL+VERVG+ HQAGSDSL    +F
Sbjct  187  SGFFDLIRIYFPVIYDIKHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTALSF  246

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
             K K+++F G  E+  GVLYG G E G+
Sbjct  247  NKLKESYFGGLTEKYAGVLYGLGTEGGE  274



>ref|NP_001132298.1| CCR4-NOT transcription complex subunit 7 isoform 1 [Zea mays]
 gb|ACF81091.1| unknown [Zea mays]
 gb|ACG42346.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
 tpg|DAA61464.1| TPA: CCR4-NOT transcription complex subunit 7 isoform 1 [Zea 
mays]
 tpg|DAA61465.1| TPA: CCR4-NOT transcription complex subunit 7 isoform 2 [Zea 
mays]
Length=279

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 136/205 (66%), Gaps = 1/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDMLKLIQLGLT SDE G LP  G   + C WQ  FR  DP  DV A DSI+ LR+
Sbjct  67   LKANVDMLKLIQLGLTLSDEHGGLPALGPDGRPCVWQFNFRGFDPRTDVAAADSIDLLRR  126

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF ++   G++ R F ELL SSG+VLN  VHWV FH GYD GYLLK+     LP   
Sbjct  127  SGIDFSRHAADGVDSRCFAELLMSSGVVLNSDVHWVTFHSGYDFGYLLKLLTGTNLPDTL  186

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LI  YFP ++ IKH MRF NSLHG  NKLA LL+V RVG+ HQAGSDSL    +F
Sbjct  187  PGFFDLIKIYFPVIYDIKHLMRFSNSLHGGLNKLAELLDVARVGICHQAGSDSLLTALSF  246

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVE  164
            +K K+ +F+G  E+  GVLYG G E
Sbjct  247  KKLKEAYFNGLTEKYAGVLYGLGFE  271



>gb|KCW62735.1| hypothetical protein EUGRSUZ_G00324 [Eucalyptus grandis]
Length=213

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 140/204 (69%), Gaps = 19/204 (9%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK+ VD+LKLIQLGLTFSDE+ NLPTCG+ K C  Q  FR+                   
Sbjct  27   LKENVDILKLIQLGLTFSDERRNLPTCGSDKCCINQFNFRD-------------------  67

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G +F+KN + GI   RFGELL  SGIVLND+VHWV FH GYD GYLLK+     LP  Q 
Sbjct  68   GINFKKNRDRGINAVRFGELLMLSGIVLNDNVHWVTFHSGYDLGYLLKVLTCQTLPDTQA  127

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GFF LI+ YFP ++ IKH M+FC+SLHG  NK+A LL+VERVGV HQAGSDSL    TF+
Sbjct  128  GFFKLIHMYFPTLYDIKHLMKFCDSLHGGLNKVAELLKVERVGVCHQAGSDSLLTSSTFK  187

Query  235  KXKDNFFSGSLEEXXGVLYGXGVE  164
            K K++FFSGSLE+  GVLYG  VE
Sbjct  188  KLKESFFSGSLEKYSGVLYGLCVE  211



>ref|XP_006416864.1| hypothetical protein EUTSA_v10008404mg [Eutrema salsugineum]
 gb|ESQ35217.1| hypothetical protein EUTSA_v10008404mg [Eutrema salsugineum]
Length=284

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 136/203 (67%), Gaps = 1/203 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            L+  V+ML LIQLGLT SDE+GNLPTCGT  K C WQ  FRE +   DV A DSIE LRQ
Sbjct  67   LRTNVNMLNLIQLGLTLSDEQGNLPTCGTNNKQCVWQFNFREFNLKTDVFAMDSIELLRQ  126

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN   GIE RRF  LL  SG+VLND V WV FH GYD GYLLK+    +LP  Q
Sbjct  127  SGIDFAKNNHLGIESRRFAALLMCSGVVLNDKVQWVTFHCGYDFGYLLKLLTGKDLPEDQ  186

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF L+  +FP V+ IK+ M FCN L G  +K+A LL V+RVG+ HQAGSDSL     F
Sbjct  187  SDFFLLVKTFFPTVYDIKYLMDFCNGLWGGLSKVAELLLVKRVGISHQAGSDSLLTSRVF  246

Query  238  RKXKDNFFSGSLEEXXGVLYGXG  170
            RK K+  F+GS+ +  GVLYG G
Sbjct  247  RKMKEKHFTGSMAKYSGVLYGLG  269



>ref|XP_004956826.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Setaria 
italica]
Length=279

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 139/208 (67%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDMLKLIQLGLTFSDE G LP  G   + C WQ  FR  DP  DV A DSI+ LR+
Sbjct  67   LKANVDMLKLIQLGLTFSDEHGGLPALGPGGRPCVWQFNFRGFDPRTDVAAADSIDLLRR  126

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF ++   G + RRF ELL SSG+V+N  V WV FH GYD GYLLK+     LP   
Sbjct  127  SGIDFARHGADGADARRFAELLMSSGVVMNSDVRWVTFHSGYDFGYLLKLLTGTNLPDTM  186

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LI  YFP ++ IKH MRFCNSLHG  NKLA LL+V RVG+ HQAGSDSL    +F
Sbjct  187  SGFFDLIKIYFPVIYDIKHLMRFCNSLHGGLNKLAELLDVARVGICHQAGSDSLLTALSF  246

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            +K K+ +F+G  E+  GVLYG G E G+
Sbjct  247  KKLKEAYFNGLTEKYAGVLYGLGFEGGE  274



>gb|KFK43832.1| hypothetical protein AALP_AA1G179300 [Arabis alpina]
Length=272

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 138/201 (69%), Gaps = 1/201 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V+ML LIQLGLT SD++GNLPTCGT  K C WQ  FRE +   D+ A DSIE LRQ
Sbjct  65   LKTNVNMLNLIQLGLTLSDDQGNLPTCGTNNKQCVWQFNFREFNLKTDMFAIDSIELLRQ  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF KN + GIE +RF +LL  SG+VLND + W+ FH GYD GYLLK+     LP  Q
Sbjct  125  SGMDFAKNRQFGIEAKRFAQLLMGSGVVLNDKIQWITFHCGYDLGYLLKLLTGKNLPEKQ  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF+ +  +FP ++ IKH M FC++++G  +K A LLEV+RVG+ HQAGSDSL     F
Sbjct  185  SEFFSRVQTFFPVLYDIKHLMDFCSAVYGGLSKAADLLEVKRVGISHQAGSDSLLTLRVF  244

Query  238  RKXKDNFFSGSLEEXXGVLYG  176
            RK K+  F+G +++  GVLYG
Sbjct  245  RKMKETMFTGPMDKYSGVLYG  265



>gb|ABY89387.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89388.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89389.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89390.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89391.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89392.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89393.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89394.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89395.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89396.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89397.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89398.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89399.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89400.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89401.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89402.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89403.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89404.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89405.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89406.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89407.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89408.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89409.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89410.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89411.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89412.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89413.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89414.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89415.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89416.1| chromatin assembly factor 1, partial [Pinus taeda]
Length=193

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 124/172 (72%), Gaps = 0/172 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+  VD+LKLIQLGLTFSDE GNLP CGT +YC WQ  FRE +  ED  A DSIE LRQ 
Sbjct  22   LRSNVDVLKLIQLGLTFSDEDGNLPNCGTDRYCVWQFNFREFNIWEDAYASDSIELLRQS  81

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G++   F ELL SSGIVLN++V W+ FH GYD GYLLK+     LP  Q 
Sbjct  82   GIDFKKNSERGVDSHLFAELLMSSGIVLNENVRWITFHSGYDFGYLLKLVMNRSLPPTQG  141

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDS  260
            GFF LI  YFP ++ IKH M+FCN+LHG  N+LA +LEVER G  HQAGSDS
Sbjct  142  GFFYLIRMYFPNLYDIKHLMKFCNNLHGGLNRLAEMLEVERFGACHQAGSDS  193



>ref|NP_173044.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 ref|NP_973838.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9S9P2.1|CAF1B_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 2 [Arabidopsis 
thaliana]
 gb|AAF18489.1|AC010924_2 Similar to gi|Q60809 CCR4-associated factor 1 (CAF1) from Mus 
musculus. EST gb|Z26822 comes from this gene [Arabidopsis thaliana]
 gb|AAL86000.1| putative BTG1 binding factor 1 [Arabidopsis thaliana]
 gb|AAM45088.1| putative BTG1 binding factor 1 [Arabidopsis thaliana]
 dbj|BAH19897.1| AT1G15920 [Arabidopsis thaliana]
 gb|AEE29383.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 gb|AEE29384.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=286

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 136/200 (68%), Gaps = 0/200 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  V+MLKLIQLGLT SDEKGNLPTCGT K C WQ  FRE +   D+ A DSIE LR+ 
Sbjct  75   LKANVNMLKLIQLGLTLSDEKGNLPTCGTNKQCIWQFNFREFNVISDMFALDSIELLRKS  134

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
              D EKN E G++ +RF ELL  SG+VLND +HWV FH GYD GYLLK+    ELP    
Sbjct  135  AIDLEKNNECGVDAKRFAELLMGSGVVLNDKIHWVTFHCGYDFGYLLKLLSGKELPEEIS  194

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF  +  +FP V+ IK+ M FC +L+G   K+A LL V+RVG+ HQAGSDSL    TF 
Sbjct  195  DFFDQMEKFFPVVYDIKYLMGFCTNLYGGLEKIAELLGVKRVGISHQAGSDSLLTLRTFI  254

Query  235  KXKDNFFSGSLEEXXGVLYG  176
            K K+ FF+GSL +  G L+G
Sbjct  255  KMKEFFFTGSLLKYSGFLFG  274



>ref|XP_002890137.1| hypothetical protein ARALYDRAFT_312582 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66396.1| hypothetical protein ARALYDRAFT_312582 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 135/200 (68%), Gaps = 0/200 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  V+MLKLIQLGLT SDEKGNLPTCGT K C WQ  FRE +   D+ A DSI+ LR+ 
Sbjct  73   LKTNVNMLKLIQLGLTLSDEKGNLPTCGTNKQCIWQFNFREFNLKSDMFAMDSIQLLRES  132

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
              D EKN E G++ RRF ELL SSG+VLND + WV FH GYD GYLLK+    ELP    
Sbjct  133  YIDLEKNTECGVDSRRFAELLMSSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKELPAEAS  192

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF  +  +FP V+ +K+ M FC  L+G   ++A LL V+RVG+ HQAGSDSL     F 
Sbjct  193  KFFDQVERFFPVVYDMKYLMGFCAPLYGGLGRVAKLLGVKRVGICHQAGSDSLLTLRAFN  252

Query  235  KXKDNFFSGSLEEXXGVLYG  176
            K K+ FF+GSL++  G LYG
Sbjct  253  KMKEIFFTGSLDKYSGFLYG  272



>ref|XP_002981023.1| hypothetical protein SELMODRAFT_444748 [Selaginella moellendorffii]
 gb|EFJ17724.1| hypothetical protein SELMODRAFT_444748 [Selaginella moellendorffii]
Length=285

 Score =   223 bits (568),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 137/205 (67%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L++ V+MLKLIQLGLTF D  GNLP C T +YC WQ  FRE +  EDV A DSI+ L   
Sbjct  65   LRENVNMLKLIQLGLTFCDADGNLPRCNTGEYCVWQFNFREFNIREDVCAQDSIDLLCHS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E G++ R FGELL SSG+VLND + W+ FH GYD GYLLK+     LP  + 
Sbjct  125  GIDFAKNEEQGVDSRLFGELLMSSGVVLNDDIQWITFHSGYDFGYLLKLLTCQPLPACEA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP  F IK+ M+F +SLHG  N+LA L++V R+G  HQAGSDSL     +R
Sbjct  185  DFFNLMRLYFPVFFDIKYMMKFHDSLHGGLNRLAELVDVARIGPCHQAGSDSLLTSEVYR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            + KD +F  S+ +  GVLYG G +N
Sbjct  245  RLKDRYFLESMAKFTGVLYGLGSDN  269



>ref|XP_002982500.1| hypothetical protein SELMODRAFT_179583 [Selaginella moellendorffii]
 gb|EFJ16253.1| hypothetical protein SELMODRAFT_179583 [Selaginella moellendorffii]
Length=287

 Score =   223 bits (568),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 137/205 (67%), Gaps = 0/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L++ V+MLKLIQLGLTF D  GNLP C T +YC WQ  FRE +  EDV A DSI+ L   
Sbjct  65   LRENVNMLKLIQLGLTFCDADGNLPRCNTGEYCVWQFNFREFNIREDVCAQDSIDLLCHS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E G++ R FGELL SSG+VLND + W+ FH GYD GYLLK+     LP  + 
Sbjct  125  GIDFAKNEEQGVDSRLFGELLMSSGVVLNDDIQWITFHSGYDFGYLLKLLTCQPLPACEA  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP  F IK+ M+F +SLHG  N+LA L++V R+G  HQAGSDSL     +R
Sbjct  185  DFFNLMRLYFPVFFDIKYMMKFHDSLHGGLNRLAELVDVARIGPCHQAGSDSLLTSEVYR  244

Query  235  KXKDNFFSGSLEEXXGVLYGXGVEN  161
            + KD +F  S+ +  GVLYG G +N
Sbjct  245  RLKDRYFLESMAKFTGVLYGLGSDN  269



>ref|XP_009396102.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 133/205 (65%), Gaps = 1/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTC-GTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            L+  VD+L LIQLGLTFSD  GN P    + +   WQ  FRE D   D+   DSI+ L++
Sbjct  65   LRANVDLLHLIQLGLTFSDADGNFPASPDSARPIVWQFNFREFDVDGDISNPDSIDLLQK  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF +N E G++   F ELL SSG+VLNDSV WV FH  YD GYLLKI     LP  +
Sbjct  125  SGIDFARNREHGVDANHFAELLMSSGVVLNDSVRWVTFHCAYDFGYLLKILTCRRLPDNR  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
            +GFF L   +FP V+ IKH MRF NSLHG  NK+A  LEV+RVG+ HQAGSDSL    TF
Sbjct  185  EGFFELARTFFPVVYDIKHLMRFSNSLHGGLNKVAEQLEVDRVGICHQAGSDSLLTAQTF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVE  164
            RK  D +F GS+E   GV+YG  +E
Sbjct  245  RKLTDKYFDGSIERYAGVMYGLDIE  269



>ref|XP_006304066.1| hypothetical protein CARUB_v10009915mg [Capsella rubella]
 gb|EOA36964.1| hypothetical protein CARUB_v10009915mg [Capsella rubella]
Length=289

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 133/201 (66%), Gaps = 1/201 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V+MLKLIQLGLT SDE+GNLPTCGT  K C WQ  FRE +   D+ A DSI+ LR 
Sbjct  73   LKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFNLKSDMFAMDSIQLLRD  132

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
               DFEKN E G++  RF ELL  SG+VLND + WV FH GYD GYLLK+    +LP  +
Sbjct  133  SNIDFEKNNECGVDSARFAELLMGSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKDLPEEK  192

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF  +  YFP V+ IK+ M FC SL+G   ++A +L V+RVG+ HQAGSDSL     F
Sbjct  193  TDFFEQVTSYFPVVYDIKYLMGFCASLYGGLERVAEILGVKRVGISHQAGSDSLLTLRAF  252

Query  238  RKXKDNFFSGSLEEXXGVLYG  176
             K KD FF GSL+   G LYG
Sbjct  253  NKMKDIFFPGSLDRYSGFLYG  273



>ref|XP_003574542.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=294

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 129/207 (62%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLT  DE G LP  GT  + C WQ  FR  DP  D    DSI+ LR+
Sbjct  78   LKANVDMLSLIQLGLTLCDESGALPPRGTGGRPCAWQFNFRGFDPRSDPANADSIDLLRK  137

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF++    G++  RF ELL SSG+VLND + WV FH GYD GYLLK      +P   
Sbjct  138  SGIDFDRFLAEGVDTARFAELLMSSGVVLNDDLQWVTFHSGYDFGYLLKALTAQNMPDTM  197

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LI  YFP V+ IKH MRFC SLHG  ++L  LL VERVG  HQAGSDSL     F
Sbjct  198  SGFFDLIRVYFPVVYDIKHLMRFCGSLHGGLSRLGELLAVERVGTCHQAGSDSLLTLQCF  257

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K KD +F GS+E   GVLYG   ++G
Sbjct  258  NKLKDAYFRGSVENYAGVLYGLVSDSG  284



>ref|XP_010459127.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=289

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 133/201 (66%), Gaps = 1/201 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V+MLKLIQLGLT SDE+GNLPTCGT  K C WQ  FRE +   D+ A DSI  LR 
Sbjct  77   LKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFNLKSDMFAMDSINLLRG  136

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
               DFEKN E G++ +RF ELL  SG+VLND + WV FH GYD GYLLK+    +LP  +
Sbjct  137  SNIDFEKNNECGVDSKRFAELLMGSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKDLPEEK  196

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF  +  YFP V+ IK+ M FC  L+G   ++A +L V+RVG+ HQAGSDSL     F
Sbjct  197  SDFFDQVTSYFPVVYDIKYLMGFCAPLYGGLERVADILGVKRVGISHQAGSDSLLTLRAF  256

Query  238  RKXKDNFFSGSLEEXXGVLYG  176
             K K+ FF+GSL+   G LYG
Sbjct  257  NKMKERFFTGSLDRYSGFLYG  277



>ref|XP_009395282.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 133/205 (65%), Gaps = 1/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            L+  VD+L LIQLGLTFSD +GNLP   T  +   WQ  FRE D   D+   DSI+ LR+
Sbjct  65   LRANVDLLHLIQLGLTFSDAEGNLPASATGGRPIVWQFNFREFDVDRDISNPDSIDLLRK  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
               DF++N E G++  RF ELL +SG+VLNDSV WV FH  YD GYLLKI     LP  +
Sbjct  125  SDIDFKRNREHGVDANRFAELLMASGVVLNDSVRWVTFHCAYDFGYLLKILTCRRLPETR  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
            +GF  LI  +FP ++ IKH MRF NSLHG  NKLA  LEV+RVG  HQAGSDSL     F
Sbjct  185  EGFSELIRTFFPVMYDIKHLMRFSNSLHGGLNKLAEQLEVDRVGTCHQAGSDSLLTARAF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVE  164
            RK  +  F GS++   GV+YG  +E
Sbjct  245  RKLMEKHFDGSIDRYAGVMYGLDIE  269



>ref|XP_010476692.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=289

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 133/201 (66%), Gaps = 1/201 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V+MLKLIQLGLT SDE+GNLPTCGT  K C WQ  FRE +   D+ A DSI  LR 
Sbjct  76   LKTNVNMLKLIQLGLTLSDERGNLPTCGTNNKQCIWQFNFREFNLKSDMFAMDSINLLRG  135

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
               DFEKN E G++ +RF ELL  SG+VLND + WV FH GYD GYLLK+    +LP  +
Sbjct  136  SNIDFEKNNECGVDSKRFAELLMGSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKDLPEEK  195

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF  +  YFP V+ IK+ M FC  L+G   ++A +L V+RVG+ HQAGSDSL     F
Sbjct  196  SEFFDQVTSYFPVVYDIKYLMGFCAPLYGGLERVADILGVKRVGISHQAGSDSLLTLRAF  255

Query  238  RKXKDNFFSGSLEEXXGVLYG  176
             K K+ FF+GSL+   G LYG
Sbjct  256  NKMKEMFFTGSLDRYSGFLYG  276



>ref|XP_010497514.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=287

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 133/201 (66%), Gaps = 1/201 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXK-YCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V+MLKLIQLGLT SDE+GNLPTCGT K  C WQ  FRE +   D+ A DSI  LR 
Sbjct  75   LKTNVNMLKLIQLGLTLSDERGNLPTCGTNKRQCIWQFNFREFNLKSDMFAMDSINLLRG  134

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
               DFEKN E G++ +RF ELL  SG+VLND + WV FH GYD GYLLK+    +LP  +
Sbjct  135  SNIDFEKNKECGVDSKRFAELLMGSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKDLPEEK  194

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF  +  YFP V+ IK+ M FC  L+G   ++A +L V+RVG+ HQAGSDSL     F
Sbjct  195  SEFFDQVTSYFPVVYDIKYLMGFCAPLYGGLERVADILGVKRVGISHQAGSDSLLTLRAF  254

Query  238  RKXKDNFFSGSLEEXXGVLYG  176
             K K+ FF+GSL+   G LYG
Sbjct  255  NKMKEMFFTGSLDRYSGFLYG  275



>ref|XP_009418496.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=276

 Score =   216 bits (549),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 134/208 (64%), Gaps = 2/208 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX--KYCXWQXXFREXDPXEDVXAXDSIEXLR  602
            L+  VD+L LIQLGLTFSD  GNLPT          WQ  FRE D   DV   DSI+ L 
Sbjct  65   LRANVDLLHLIQLGLTFSDADGNLPTSSAAGGHPVVWQFNFREFDVDRDVSNPDSIDLLI  124

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            + G D  +N E G++  RF ELL SSG+VLNDSV WV FH  YD GYLLK+     LP  
Sbjct  125  RSGIDLVRNREFGVDAIRFAELLMSSGVVLNDSVSWVTFHCAYDFGYLLKLLTCRRLPDT  184

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
            ++GFF L+  +FP V+ IKH ++F NSLHG  NK+A  LEVERVG+ HQAGSDSL     
Sbjct  185  REGFFELVRTFFPVVYDIKHLLKFSNSLHGGLNKVAEQLEVERVGICHQAGSDSLLTARA  244

Query  241  FRKXKDNFFSGSLEEXXGVLYGXGVENG  158
            FRK   ++F GS+E   GV+YG  +E+G
Sbjct  245  FRKLMGSYFDGSIERYAGVMYGLDIEHG  272



>ref|XP_001697447.1| CCR4-associated factor [Chlamydomonas reinhardtii]
 gb|EDP00109.1| CCR4-associated factor [Chlamydomonas reinhardtii]
Length=300

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 133/206 (65%), Gaps = 2/206 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLT +D KG LP     + C WQ  F+     +DV A DSIE L+Q 
Sbjct  83   LKMNVDMLKLIQLGLTLTDAKGTLPRAANGELCVWQFNFKGFKLSDDVYAQDSIELLKQS  142

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF  +   GI+  RFGELL +SGIVLND V W+ FH  YD GYLLKI     LP  +Q
Sbjct  143  GIDFALHEARGIDVHRFGELLMTSGIVLNDDVRWITFHSNYDFGYLLKILTCQPLPGTEQ  202

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+N YFP +F IK+ MR+C++LHG  NKLA +L+V+R+G  HQAGSDSL    TF 
Sbjct  203  EFFELLNIYFPNIFDIKYLMRYCDNLHGGLNKLAEMLDVQRIGPQHQAGSDSLLTSATFI  262

Query  235  KXKDNFFSG--SLEEXXGVLYGXGVE  164
            K  + +F G     +  GVL+G GV+
Sbjct  263  KLANKYFHGIDGASKHMGVLFGLGVD  288



>ref|XP_009395283.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 132/205 (64%), Gaps = 1/205 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            L+  VD+L LIQLGLTFSD +GNLP   T  +   WQ  FRE D   D+   DSI+ LR+
Sbjct  65   LRANVDLLHLIQLGLTFSDAEGNLPATATGGRPIVWQFNFREFDVDRDISNPDSIDLLRK  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
               DF++N E G++  RF EL  +SG+VLNDSV WV FH  YD GYLLKI     LP  +
Sbjct  125  SDIDFKRNREHGVDANRFAELFMASGVVLNDSVRWVTFHCAYDFGYLLKILTCRRLPETR  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
            +GF  LI  +FP ++ IKH MRF NSLHG  NK+A  LEV+RVG  HQAGSDSL     F
Sbjct  185  EGFSELIRTFFPVMYDIKHLMRFSNSLHGGLNKVAEQLEVDRVGTCHQAGSDSLLTARAF  244

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVE  164
            RK  +  F GS++   GV+YG  +E
Sbjct  245  RKLMEKHFDGSIDRYAGVMYGLDIE  269



>ref|XP_002950174.1| hypothetical protein VOLCADRAFT_80930 [Volvox carteri f. nagariensis]
 gb|EFJ48842.1| hypothetical protein VOLCADRAFT_80930 [Volvox carteri f. nagariensis]
Length=320

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 133/204 (65%), Gaps = 3/204 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VDMLKLIQLGLTF+D KGNLP     + C WQ  F+     +DV A DSIE L+Q 
Sbjct  68   LKMNVDMLKLIQLGLTFTDAKGNLPRA-NGELCVWQFNFKGFRLADDVYAQDSIELLKQS  126

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF  +   GI+  RFGELL +SGIVLND V W+ FH  YD GYLLKI     LP  +Q
Sbjct  127  GIDFATHEAKGIDVHRFGELLMTSGIVLNDDVRWITFHSNYDFGYLLKILTCQPLPQSEQ  186

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+N YFP +F IK+ MR+C++LHG  NKLA +LEV+R+G  HQAGSDSL    TF 
Sbjct  187  EFFELLNIYFPNIFDIKYLMRYCDNLHGGLNKLAEMLEVQRIGPQHQAGSDSLLTSFTFI  246

Query  235  KXKDNFFSG--SLEEXXGVLYGXG  170
            K  + FF G     +  GVL+G G
Sbjct  247  KLANKFFQGIEGASKHMGVLFGLG  270



>ref|XP_010932239.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=270

 Score =   212 bits (540),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 130/202 (64%), Gaps = 2/202 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTC--GTXKYCXWQXXFREXDPXEDVXAXDSIEXLR  602
            L+  VD+L LIQ+G+TFSD  G LP    G    C WQ  FRE DP  DV   DSI+ LR
Sbjct  66   LRANVDLLHLIQVGITFSDASGCLPPSPSGGGLRCVWQFNFREFDPDRDVSNPDSIDLLR  125

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            + G DF KN E GI+  RF ELL SSG+VLNDSV W+ FH  YD  YLLKI     LP  
Sbjct  126  RSGIDFVKNREQGIDALRFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCRRLPES  185

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
             + FF L+  +FP V+ IKH MRFCN+L+G  NK+A  ++ ER+GV HQAGSDSL     
Sbjct  186  LEEFFELVGAFFPIVYDIKHLMRFCNNLYGGLNKVAEQVDAERIGVCHQAGSDSLLTARV  245

Query  241  FRKXKDNFFSGSLEEXXGVLYG  176
            F + K+N+F GS+E   G LYG
Sbjct  246  FWRLKENYFDGSIERYAGCLYG  267



>gb|EAZ07127.1| hypothetical protein OsI_29374 [Oryza sativa Indica Group]
Length=244

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 133/207 (64%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            L+  V+MLKLIQLGLT SDE G+LP  GT  + C WQ  FR  DP  D    DSI+ LR 
Sbjct  27   LEANVNMLKLIQLGLTLSDEGGDLPRRGTGGRRCIWQFNFRGFDPRTDPSNADSIQMLRT  86

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
            CG DF++    G +  RF ELL SSG+VLN  V W+ FH GYD GYLL++     LP   
Sbjct  87   CGIDFDRFAAEGADPIRFAELLMSSGVVLNADVQWITFHSGYDFGYLLRLLTGRNLPDNM  146

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF LI  YFP ++ IKH MRFC++LHG  ++L  LL+V+RVG  HQAGSDSL     +
Sbjct  147  PAFFDLIRIYFPVLYDIKHLMRFCSNLHGGLSRLGELLDVKRVGTCHQAGSDSLLTLGCY  206

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K K+ +F GS E+  GVLYG  +E+G
Sbjct  207  NKIKEVYFKGSTEKHAGVLYGLVIEDG  233



>emb|CDY12236.1| BnaC04g12660D [Brassica napus]
Length=412

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 132/193 (68%), Gaps = 0/193 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+  V+++K+IQLGLTFS+E GNLPTCG+ KYC WQ  F + DP   +   +SI+ LR  
Sbjct  65   LRTNVNLMKMIQLGLTFSNESGNLPTCGSDKYCIWQFNFCDFDPVCSISNPESIKLLRDS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E G+  +RF ELL +SG+VLN++VHWV FH  YD  YLLK+    +LP   +
Sbjct  125  GIDFKKNYEKGVHSKRFAELLLTSGVVLNENVHWVTFHGVYDLAYLLKVLIIQDLPEKPK  184

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
            GF  LI  YFP    IKH M+FCN L G  NKLA LL VER+G+ HQAGSDSL     F 
Sbjct  185  GFDELIRLYFPRFCDIKHLMKFCNGLSGGLNKLAELLGVERLGISHQAGSDSLLTSRIFM  244

Query  235  KXKDNFFSGSLEE  197
              +D+FF+GS+E+
Sbjct  245  ILQDSFFNGSVEK  257



>dbj|BAD09890.1| putative CCR4-NOT transcription complex, subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD09904.1| putative CCR4-NOT transcription complex, subunit 7 [Oryza sativa 
Japonica Group]
 gb|EAZ42877.1| hypothetical protein OsJ_27470 [Oryza sativa Japonica Group]
 dbj|BAG96259.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97485.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98767.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 133/207 (64%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            L+  V+MLKLIQLGLT SDE G+LP  GT  + C WQ  FR  DP  D    DSI+ LR 
Sbjct  71   LEANVNMLKLIQLGLTLSDEGGDLPRRGTGGRRCIWQFNFRGFDPRTDPSNADSIQMLRT  130

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
            CG DF++    G +  RF ELL SSG+VLN  V W+ FH GYD GYLL++     LP   
Sbjct  131  CGIDFDRFAAEGADPIRFAELLMSSGVVLNADVQWITFHSGYDFGYLLRLLTGRNLPDNM  190

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF LI  YFP ++ IKH MRFC++LHG  ++L  LL+V+RVG  HQAGSDSL     +
Sbjct  191  PAFFDLIRIYFPVLYDIKHLMRFCSNLHGGLSRLGELLDVKRVGTCHQAGSDSLLTLGCY  250

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K K+ +F GS E+  GVLYG  +E+G
Sbjct  251  NKIKEVYFKGSTEKHAGVLYGLVIEDG  277



>ref|XP_008796886.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=270

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 129/202 (64%), Gaps = 2/202 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLP--TCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLR  602
            L+  VD+L LIQ+G TFSD  G LP    G  + C WQ  FRE D   DV   DSI+ LR
Sbjct  66   LRANVDLLHLIQIGFTFSDAAGRLPLSPSGGGRRCVWQFNFREFDVDHDVANPDSIDLLR  125

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            + G DF+KN E G++  RF ELL SSG+VLNDSV W+ FH  YD  YLLKI     LP  
Sbjct  126  RSGIDFKKNRECGVDALRFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCRRLPET  185

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
             + F  L++ +FP V+ IKH MRFCN+L+G  NK+A  L+ ER+G  HQAGSDSL     
Sbjct  186  SEAFSDLVSTFFPTVYDIKHLMRFCNNLYGGLNKVAEQLDAERIGFCHQAGSDSLLTVRV  245

Query  241  FRKXKDNFFSGSLEEXXGVLYG  176
            F + K+ +F GS+E   G+LYG
Sbjct  246  FWRLKEKYFDGSIESYAGLLYG  267



>ref|XP_005649974.1| CCR4-associated factor [Coccomyxa subellipsoidea C-169]
 gb|EIE25430.1| CCR4-associated factor [Coccomyxa subellipsoidea C-169]
Length=284

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 131/204 (64%), Gaps = 3/204 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+  VDMLKLIQLGLTFSD KG LP     + C WQ  FRE    ED+ A DSIE L+  
Sbjct  70   LRCNVDMLKLIQLGLTFSDAKGELPRW-KGELCVWQFNFREFKQSEDMFAQDSIELLKDS  128

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF +N   GIE  RFGE+L SSGIVLN+ + WV FH GYD GYLLK+     LP  + 
Sbjct  129  GIDFARNEARGIEVHRFGEVLMSSGIVLNEEIQWVTFHSGYDFGYLLKVLTCQPLPAVEA  188

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  YFP V+ IK+ M+FC +LHG  NKLA  L+VER+G  HQAGSDSL    TF 
Sbjct  189  EFFELLQIYFPNVYDIKYLMKFCGNLHGGLNKLAETLDVERIGPQHQAGSDSLLTSKTFH  248

Query  235  KXKDNFFSG--SLEEXXGVLYGXG  170
            K  D  F+G   + +  GVLYG G
Sbjct  249  KLIDTLFNGIDGVLKHRGVLYGLG  272



>ref|XP_009149028.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Brassica 
rapa]
Length=276

 Score =   208 bits (529),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 133/204 (65%), Gaps = 2/204 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKY-CXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V+ML +IQLGLT SD++GNLPT GT K  C WQ  FRE +   D+ A DSIE LR+
Sbjct  71   LKTNVNMLNMIQLGLTLSDDQGNLPTFGTNKRQCVWQFNFREFNLRTDMYAPDSIELLRR  130

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF++N   GIE +RF +LL  SG+VLN+ + WV FH GYD GYLL++     LP  Q
Sbjct  131  SGIDFDRNSRVGIESKRFADLLMGSGVVLNEEIQWVTFHCGYDFGYLLRLLTGRNLPEKQ  190

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              F  L+  +FP VF IKH + FC  L G  + +A  LEVERVG+ HQAGSDSL     F
Sbjct  191  SEFLYLVKMFFPRVFDIKHMIGFCYDLFGGLSSVAERLEVERVGISHQAGSDSLLTARVF  250

Query  238  RKXKDNFFSG-SLEEXXGVLYGXG  170
            R+ K+  F+G SL+   GVLYG G
Sbjct  251  RRMKETRFAGRSLDMYCGVLYGLG  274



>emb|CDY35049.1| BnaA06g10590D [Brassica napus]
Length=276

 Score =   207 bits (527),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 133/204 (65%), Gaps = 2/204 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKY-CXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  V+ML +IQLGLT SD++GNLPT GT K  C WQ  FRE +   D+ A DSIE LR+
Sbjct  71   LKTNVNMLNMIQLGLTLSDDQGNLPTFGTNKRQCVWQFNFREFNLRTDMYAPDSIELLRR  130

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF++N   GIE +RF +LL  SG+VLN+ + WV FH GYD GYLL++     LP  Q
Sbjct  131  SGIDFDRNSRVGIESKRFADLLMGSGVVLNEEIQWVTFHCGYDFGYLLRLLTGRNLPEKQ  190

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              F  L+  +FP VF IKH + FC  L G  + +A  LEVERVG+ HQAGSDSL     F
Sbjct  191  LEFLYLVKMFFPRVFDIKHMIGFCYDLFGGLSSVAERLEVERVGISHQAGSDSLLTARVF  250

Query  238  RKXKDNFFSG-SLEEXXGVLYGXG  170
            R+ K+  F+G SL+   GVLYG G
Sbjct  251  RRMKETRFAGRSLDMYCGVLYGLG  274



>gb|EYU24605.1| hypothetical protein MIMGU_mgv1a011876mg [Erythranthe guttata]
Length=268

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 135/204 (66%), Gaps = 2/204 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCG-TXKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK+ V+ +KLIQLGLT ++EKG+LPTCG T  +  WQ  FR+ +P ED+   DSI  LR 
Sbjct  65   LKENVNTMKLIQLGLTLTNEKGDLPTCGETGLFIVWQFNFRDFNPSEDIYNSDSIHLLRG  124

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
            CG DFEK+   G++  RF ELL SSG+VLN+SV+WV F  G+D GYLLK+    ELP  +
Sbjct  125  CGIDFEKHVAEGVDATRFAELLMSSGVVLNESVYWVTFQCGHDFGYLLKLLTGRELPETR  184

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
            + FF  I  YFP ++ IKH ++F   L+G  NK+A  L+V+RVG  HQAGSDSL     F
Sbjct  185  EEFFKFIKLYFPVIYDIKHMIQFV-ELYGGLNKVARTLKVDRVGTSHQAGSDSLLTSSVF  243

Query  238  RKXKDNFFSGSLEEXXGVLYGXGV  167
            R  +D     S+E   GV++G G+
Sbjct  244  RTLRDTRLQESIETYAGVMHGLGI  267



>ref|XP_010469633.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=252

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 126/198 (64%), Gaps = 22/198 (11%)
 Frame = -3

Query  760  DMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQCGXDFE  581
            ++++++QLGLT SDE GNLPTC T KYC WQ   R                      +  
Sbjct  73   NIVEMLQLGLTLSDENGNLPTCETDKYCTWQFNIR----------------------NVA  110

Query  580  KNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQGFFAL  401
            +N ++GI+   F  L+ SSG VLN+SVHWV FH GYD GYLLK+     LP  Q GFF +
Sbjct  111  ENNQTGIDPEEFANLMMSSGTVLNESVHWVTFHGGYDVGYLLKLLTNQNLPETQSGFFEM  170

Query  400  INXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFRKXKDN  221
            I+ YFP V+ +KH M+FCN  +G  N LA LL+VERVG+ HQAGSDSL   CTFRK ++ 
Sbjct  171  ISLYFPRVYDVKHLMKFCNDAYGDLNYLAELLDVERVGISHQAGSDSLLTSCTFRKLQEV  230

Query  220  FFSGSLEEXXGVLYGXGV  167
            FF GS+E+  GVL+G GV
Sbjct  231  FFIGSIEKYSGVLFGLGV  248



>ref|XP_003056015.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59391.1| predicted protein [Micromonas pusilla CCMP1545]
Length=279

 Score =   205 bits (522),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 134/203 (66%), Gaps = 2/203 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+  VDMLK+IQLGLT +D +GNLP  G   YC WQ  FRE +  ED+ A DSIE L+  
Sbjct  63   LRCNVDMLKIIQLGLTLTDARGNLPLIGNF-YCLWQFNFREFNLKEDLYAQDSIELLKHS  121

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G +F+ N E GI+  RFGE+L  SG+VL+D V W+ FH G+D GYLLKI     LP  + 
Sbjct  122  GINFQANHERGIDVHRFGEMLMVSGVVLSDKVKWLTFHSGHDFGYLLKILTCQPLPEAES  181

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF +++ YFP +F IK+ M+F ++LHG  +KLA  L+V R+G  HQAGSDSL   C F 
Sbjct  182  DFFYVLSIYFPCIFDIKYLMKFTDNLHGGLSKLAEQLDVARIGPQHQAGSDSLLTACAFF  241

Query  235  KXKDNFFSGS-LEEXXGVLYGXG  170
            K K  +F  S LE+  GVLYG G
Sbjct  242  KLKQTYFIESGLEQYIGVLYGLG  264



>gb|EMS59499.1| putative CCR4-associated factor 1-like protein 7 [Triticum urartu]
Length=294

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 128/208 (62%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            LK  VDML LIQLGLT SDE G LP  GT  + C WQ  FR  DP  D    DSI+ LR 
Sbjct  77   LKANVDMLSLIQLGLTLSDENGALPARGTGGRPCAWQFNFRGFDPRSDPANADSIDLLRN  136

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF++    G +   F ELL SSG++LN  + WV FH GYD GYLLK+     LP   
Sbjct  137  SGIDFDRFTTEGADTGHFAELLMSSGVLLNAELQWVTFHSGYDFGYLLKLLTGRNLPDTM  196

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GFF LI  YFP ++ IKH M++C SLHG  +KL  LL V+RVG+ HQAGSDSL     F
Sbjct  197  PGFFDLIRIYFPVLYDIKHLMKYCGSLHGGLSKLGELLGVQRVGICHQAGSDSLLTLQCF  256

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            +K K+ +F GS E   GVLYG   + G+
Sbjct  257  QKLKEAYFRGSTENYAGVLYGLISDGGE  284



>gb|KCW53891.1| hypothetical protein EUGRSUZ_J03104, partial [Eucalyptus grandis]
Length=240

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 128/207 (62%), Gaps = 34/207 (16%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD V++LKLI+LGLT  DEK NLPTC T                      DSIE L+QC
Sbjct  65   LKDNVNLLKLIRLGLTLFDEKENLPTCRTDN--------------------DSIELLKQC  104

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF KN E G++  +FGELL SSGIVLNDSV+W              +    +LP  Q 
Sbjct  105  GIDFRKNNEKGVDAAQFGELLMSSGIVLNDSVYW--------------LLTCQDLPNTQS  150

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L + YF  ++ IKH M+FCNSLHG  NKLA LLEVERVG  HQAGSDS+   CTFR
Sbjct  151  EFFKLTDMYFLMLYDIKHLMKFCNSLHGGLNKLAELLEVERVGNCHQAGSDSVLTSCTFR  210

Query  235  KXKDNFFSGSLEEXXGVLYGXGVENGQ  155
            K KDNFF GSLE+  GVLY  G ENGQ
Sbjct  211  KLKDNFFRGSLEKYTGVLYDLGFENGQ  237



>emb|CDY33367.1| BnaC05g12160D [Brassica napus]
Length=454

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 133/206 (65%), Gaps = 3/206 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKY--CXWQXXFREXDPXEDVXAXDSIEXLR  602
            LK  V+ML +IQLGLT SD++GNLPT GT K   C WQ  FRE +   D+ A DSIE LR
Sbjct  69   LKTNVNMLNMIQLGLTLSDDQGNLPTLGTNKRRQCVWQFNFREFNLRTDMYAPDSIELLR  128

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            + G DF+ N   G+E +RF +LL  SG+VLN+ + WV FH GYD GYLL++     LP  
Sbjct  129  RSGIDFDWNNRLGVESKRFADLLMGSGVVLNEEIQWVTFHCGYDFGYLLRLLTGRNLPDK  188

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
            Q  F  L+N +FP VF IKH + FC+ L G  + LA  LEVERVGV HQAGSDSL     
Sbjct  189  QSEFLYLVNMFFPRVFDIKHMIGFCHDLFGGLSSLAERLEVERVGVSHQAGSDSLLTARV  248

Query  241  FRKXKDNFFSG-SLEEXXGVLYGXGV  167
            FR  K+  F+G SL+   GVLYG G 
Sbjct  249  FRTMKETRFAGRSLDMYCGVLYGLGT  274



>ref|XP_006659446.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like, 
partial [Oryza brachyantha]
Length=280

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 130/207 (63%), Gaps = 1/207 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            L+  V+MLKLIQLGLT SDE G LP  GT  + C WQ  FR  DP  D    +SI+ L  
Sbjct  64   LRANVNMLKLIQLGLTLSDENGELPRRGTGGRPCIWQFNFRGFDPRSDPSNGESIQLLLN  123

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G +F++    G +  RF ELL SSG+VLN  V W+ FH GYD GYLL++     LP   
Sbjct  124  SGINFDRFAAEGADPIRFAELLMSSGVVLNSDVQWITFHSGYDFGYLLRLLTGQNLPGTM  183

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF LI  +FP V+ IKH M+FC SLHG  +KL  LLE++RVG+ HQAGSDSL     +
Sbjct  184  TAFFDLIRIFFPVVYDIKHLMKFCGSLHGGLSKLGELLEIKRVGICHQAGSDSLLTLGCY  243

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENG  158
             K K+ +F GS E+  GVLYG  +E+G
Sbjct  244  NKIKEVYFKGSTEKHAGVLYGLVIEDG  270



>ref|XP_005843563.1| hypothetical protein CHLNCDRAFT_59811 [Chlorella variabilis]
 gb|EFN51461.1| hypothetical protein CHLNCDRAFT_59811 [Chlorella variabilis]
Length=290

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 135/209 (65%), Gaps = 4/209 (2%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+  VDMLKLIQLGLTF+D +GNLP     + C WQ  F+E    +D+ A DSIE L+Q 
Sbjct  74   LRLNVDMLKLIQLGLTFTDAEGNLPRI-NGELCVWQFNFKEFRLSDDMYAQDSIELLKQS  132

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF +N   GI+ R FGELL  SG+VLN+ V W+ FH GYD GYLLK+     LP  + 
Sbjct  133  GIDFAQNETRGIDVRHFGELLTVSGVVLNEDVRWITFHSGYDFGYLLKLLTCSSLPTNEG  192

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  +FP++F IK+ M+FC++LHG  NKLA  L+V R+G  HQAGSDSL    TF 
Sbjct  193  EFFQLLKLFFPQIFDIKYLMKFCDNLHGGLNKLAETLDVARIGPQHQAGSDSLLTSATFL  252

Query  235  KXKDNFFSG--SLEEXXGVLYGXGVENGQ  155
            K     F G   + +  G+LYG G E+G+
Sbjct  253  KLAQQRFQGMDGVGQHRGILYGLG-EDGR  280



>gb|KDD75431.1| CAF1 family ribonuclease [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 127/206 (62%), Gaps = 3/206 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+  VDMLK+IQLGLTF++ +G LP     + C WQ  FRE    ED+ A DSIE LR  
Sbjct  27   LRLNVDMLKMIQLGLTFTNAEGTLPRI-NGELCVWQFNFREFSMREDLYASDSIELLRCS  85

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G D   N   GI+  RFGELL  SG+VLN+ V W+ FH GYD GYLLK      LP  + 
Sbjct  86   GIDLALNEARGIDVHRFGELLMVSGVVLNEQVQWITFHAGYDFGYLLKTLTCAPLPLAEV  145

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FFAL+  YFP ++ IK+ M+FC  LHG  NKLA  LEVER G  HQAGSDSL    TF+
Sbjct  146  EFFALLQAYFPNLYDIKYLMKFCQPLHGGLNKLAETLEVERFGPQHQAGSDSLLTALTFQ  205

Query  235  KXKDNFFSG--SLEEXXGVLYGXGVE  164
            +    FF+G     +  G+LYG G +
Sbjct  206  RLAATFFNGVAGTVQHCGILYGLGTD  231



>ref|XP_010927524.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=270

 Score =   197 bits (500),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 127/202 (63%), Gaps = 2/202 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTC--GTXKYCXWQXXFREXDPXEDVXAXDSIEXLR  602
            L+  VD+L LIQ+GL+FSD  G LP    G  + C WQ  FRE D   DV   DS+E LR
Sbjct  66   LRANVDVLHLIQVGLSFSDAAGILPPSPSGGGRGCIWQFNFREFDVDRDVCNPDSVELLR  125

Query  601  QCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXX  422
            + G DF+KN E G++  RF ELL SSG+VLNDSV W+ FH  YD  YLLKI     LP  
Sbjct  126  RSGIDFKKNRERGVDALRFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCRRLPET  185

Query  421  QQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCT  242
              GF  L+  +FP V+ IK+ +R+C+ L+G  N +A  L+V R+GV HQAGSDSL     
Sbjct  186  MGGFLELVRIFFPVVYDIKYLLRYCDHLYGGLNNVAEQLDVVRIGVCHQAGSDSLLTARV  245

Query  241  FRKXKDNFFSGSLEEXXGVLYG  176
            F + K+  F GS+E   G+LYG
Sbjct  246  FWRLKEKHFDGSIERYSGLLYG  267



>ref|XP_002507260.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68518.1| predicted protein [Micromonas sp. RCC299]
Length=273

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+  VD+LKLIQLG+T +D  GNLP      YC WQ  FRE D  ED+ A DSIE L+  
Sbjct  64   LRCNVDLLKLIQLGITLTDGDGNLPLIA-GHYCVWQFNFREFDLKEDMYAQDSIELLKHS  122

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSV-HWVXFHXGYDXGYLLKIXXXXELPXXQ  419
            G DF+ N   GI+  RFGELL  SG+VLN  V  W+ FH GYD GYLLK+     LP  +
Sbjct  123  GIDFDANRNRGIDVHRFGELLMVSGVVLNQKVVKWITFHSGYDFGYLLKLLTCTALPQNE  182

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF ++  +FP +F +K+ MRF ++LHG  +KLA  L+VER+G  HQAGSDSL   CTF
Sbjct  183  AEFFGILGLHFPCIFDMKYLMRFTDNLHGGLSKLAEQLDVERIGPQHQAGSDSLLTACTF  242

Query  238  RKXKDNFFS-GSLEEXXGVLYGXG  170
             K +   F    +++  GVLYG G
Sbjct  243  FKLRQTHFGHDCVDKHAGVLYGLG  266



>ref|XP_011395961.1| putative CCR4-associated factor 1-like protein 7 [Auxenochlorella 
protothecoides]
 gb|KFM23091.1| putative CCR4-associated factor 1-like protein 7 [Auxenochlorella 
protothecoides]
Length=293

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 126/206 (61%), Gaps = 3/206 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            L+  V+MLK+IQLGLTFSD  GNLP     + C WQ  FRE    +D+ A DSIE L+Q 
Sbjct  79   LRLNVNMLKMIQLGLTFSDHLGNLPRINN-ELCVWQFNFREFRLNDDIYAQDSIELLKQS  137

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF +N   GI+   FG LL  SG+VLN+ V W+ FH  YD GYLL+      LP  + 
Sbjct  138  GIDFAQNEARGIDIHDFGALLMVSGVVLNEDVRWLTFHSSYDFGYLLRTVTCAPLPNTES  197

Query  415  GFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFR  236
             FF L+  +FP V+ IK+ M+FC++LHG  NKLA  L+V R+G  HQAGSDSL    TF 
Sbjct  198  DFFELLKIFFPSVYDIKYLMKFCDNLHGGLNKLAETLDVARIGPQHQAGSDSLLTSATFM  257

Query  235  KXKDNFFSG--SLEEXXGVLYGXGVE  164
            +  +  F G    ++   VLYG G +
Sbjct  258  RLAEKHFKGLAGTQKHENVLYGLGAD  283



>ref|XP_007023405.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOY26027.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=194

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LKD VDMLKLIQLGLTFSDE+GNLPTCGT KYC WQ  FRE +  EDV A DSIE LRQ 
Sbjct  65   LKDNVDMLKLIQLGLTFSDEEGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQS  124

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DF+KN E GI+  RFGELL SSGIVLNDSVHWV FH GYD GYLLK+     LP  Q 
Sbjct  125  GIDFKKNNEKGIDAMRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQV  184

Query  415  GFFALINXYF  386
            GFF+LIN YF
Sbjct  185  GFFSLINIYF  194



>ref|XP_008779663.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=268

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 119/201 (59%), Gaps = 2/201 (1%)
 Frame = -3

Query  772  KDXVDMLKLIQLGLTFSDEKGNLPTC--GTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            +  VD+L +IQ+G TFSD  G LP    G  + C WQ  FRE D         SI+ LR+
Sbjct  67   RANVDLLHVIQIGFTFSDASGCLPPSPSGVGRPCVWQFNFREFDADRHFCNPASIDLLRR  126

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF++N E G+   RF ELL SSG+VLNDSV W+ FH  YD  YLLKI     LP   
Sbjct  127  SGIDFQRNREWGVHALRFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCRRLPETT  186

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
             GF  L+  +FP V+ IKH M+FCN+L+G    +A  L+ ER+G  HQAGSDSL     F
Sbjct  187  AGFMELVRTFFPTVYDIKHLMKFCNNLYGGLANVAEQLDAERIGASHQAGSDSLLTAHVF  246

Query  238  RKXKDNFFSGSLEEXXGVLYG  176
             + K+ +F  S+E   G LYG
Sbjct  247  WRLKEKYFGWSIERYAGPLYG  267



>gb|ACH59934.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59935.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59936.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59937.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59938.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59939.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59940.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59941.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59942.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59943.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59944.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59945.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59946.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59947.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59948.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59949.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59950.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59951.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59952.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59953.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
macrocarpa]
Length=161

 Score =   185 bits (470),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = -3

Query  604  RQCGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPX  425
            RQ G DF+KN E G++  RF ELL SSGIVLN++V W+ FH GYD GYLLK+     LP 
Sbjct  1    RQSGIDFKKNSEMGVDSHRFAELLMSSGIVLNENVRWITFHSGYDFGYLLKLVMNRSLPP  60

Query  424  XQQGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXC  245
               GFF LI  YFP ++ IKH M+FCNSLHG  N+LA LLEVER G  HQAGSDSL   C
Sbjct  61   TPGGFFYLIRMYFPNLYDIKHLMKFCNSLHGGLNRLAELLEVERFGACHQAGSDSLLTSC  120

Query  244  TFRKXKDNFFSGSLEEXXGVLYGXGVEN  161
            TFRK +++FF G+ ++  GVLYG GVE+
Sbjct  121  TFRKLRESFFKGAADKYAGVLYGLGVES  148



>ref|XP_009385031.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=274

 Score =   189 bits (480),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 134/208 (64%), Gaps = 1/208 (0%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTX-KYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            L   VD+L L+QLGLTFSD  GNLPT  +  +   WQ  FRE D   DV   DSI+ LR+
Sbjct  64   LSANVDLLHLLQLGLTFSDAAGNLPTSPSSGRPVVWQFNFREFDVDSDVFVPDSIDLLRK  123

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF+KN E G++ RRF EL  SSG+VLNDS+HWV FH  YD GYL+KI    +LP  +
Sbjct  124  SGIDFKKNREDGVDARRFAELFMSSGVVLNDSIHWVAFHGAYDFGYLIKILTCRKLPETR  183

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
            + F  L++ +FP V+ IK  +   N+L+G  NK+A  LEVERVG  HQAGSDSL     F
Sbjct  184  KEFLDLLHVFFPVVYDIKRVIHLNNNLYGGLNKVAEKLEVERVGTCHQAGSDSLLTARAF  243

Query  238  RKXKDNFFSGSLEEXXGVLYGXGVENGQ  155
             K + + F GS+E+  G+L+G  +E+  
Sbjct  244  MKMRGHRFVGSMEKYVGLLFGLDIESAH  271



>ref|XP_011006693.1| PREDICTED: probable CCR4-associated factor 1 homolog 11 [Populus 
euphratica]
Length=277

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 128/206 (62%), Gaps = 3/206 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD L LIQ+GLT SD KGNLP  GT     W+  FR+ D   D  A DS+E LR+ 
Sbjct  70   LKSNVDALNLIQVGLTLSDAKGNLPDLGTENRFIWEFNFRDFDVERDSHAPDSVELLRRQ  129

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DFE+N E G++  +F EL+ SSG+V N+SV WV FH  YD GYL+KI    ELP    
Sbjct  130  GIDFERNREEGVDSAKFAELMMSSGLVCNESVSWVTFHSAYDFGYLVKILTRQELPSRLV  189

Query  415  GFFALINXYF-PEVFXIKHXMRFCNSLHGXXNKLAXLLEVER-VGVXHQAGSDSLXXXCT  242
            GF +L+  +F   ++ +KH MRFC SL+G  +++A  LEV R VG  HQAGSDSL     
Sbjct  190  GFLSLLRVFFGNNIYDVKHMMRFCKSLYGGLDRVARTLEVNREVGKCHQAGSDSLLTWHA  249

Query  241  FRKXKDNFF-SGSLEEXXGVLYGXGV  167
            F+K +D FF     E+  GVLYG  V
Sbjct  250  FQKMRDVFFVKDGPEQHAGVLYGLEV  275



>gb|AFK36856.1| unknown [Medicago truncatula]
Length=189

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = -3

Query  586  FEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQGFF  407
              +    GI+  RFGELL SSGIVLND+VHWV FH GYD GYLLK+     LP  Q GFF
Sbjct  46   LRRTASKGIDVNRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCRALPDTQAGFF  105

Query  406  ALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTFRKXK  227
             LI  YFP V+ IKH M+FCNSLHG  NKLA LL+VERVGV HQAGSDSL   CTFRK +
Sbjct  106  DLIGIYFPIVYDIKHLMKFCNSLHGGLNKLAELLDVERVGVCHQAGSDSLLTACTFRKLR  165

Query  226  DNFFSGSLEEXXGVLYGXGVE  164
            + FF+G  E+  GVLYG GVE
Sbjct  166  ETFFNGETEKYSGVLYGLGVE  186



>ref|XP_005707256.1| CCR4-NOT transcription complex subunit 7/8 [Galdieria sulphuraria]
 gb|EME30736.1| CCR4-NOT transcription complex subunit 7/8 [Galdieria sulphuraria]
Length=305

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 132/205 (64%), Gaps = 9/205 (4%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPT-CGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQ  599
            L+  VD+LK+IQLGL+FSD +GN+P  C       WQ  FR     ED+ A DSI+ L +
Sbjct  64   LRCNVDLLKIIQLGLSFSDSEGNIPEGCAC-----WQFNFR-FSLNEDIYAQDSIDLLTR  117

Query  598  CGXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQ  419
             G DF+++   GI+  RFGELL SSGIVLN+ + W+ FH GYD GYLLKI    E+P  +
Sbjct  118  SGIDFDEHERHGIDVERFGELLISSGIVLNEDICWISFHSGYDFGYLLKILTCSEMPAEE  177

Query  418  QGFFALINXYFPEVFXIKHXMRFCNSLHGXXNKLAXLLEVERVGVXHQAGSDSLXXXCTF  239
              FF L+N YFP  + +K+ M   + L+G  NKLA +LEVERVG  HQAGSDSL     F
Sbjct  178  SEFFELLNTYFPRFYDMKYLMMASDRLYGGLNKLAEILEVERVGQMHQAGSDSLLTMKVF  237

Query  238  RKXKDNFFSGSLEEXX--GVLYGXG  170
             K K++ FSG ++E    GVLYG G
Sbjct  238  FKMKESIFSGQIDERRYCGVLYGLG  262



>ref|XP_006384784.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
 gb|ERP62581.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
Length=277

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 128/206 (62%), Gaps = 3/206 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD L LIQ+GLT SD +GNLP  GT     W+  FR+ D   D  A DSIE LR+ 
Sbjct  70   LKSNVDALNLIQVGLTLSDAEGNLPDLGTGNRFIWEFNFRDFDVERDSHAPDSIELLRRQ  129

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DFE+N E G++  RF EL+ SSG+V N+SV WV FH  YD GYL+KI    ELP    
Sbjct  130  GIDFERNREEGVDSARFAELMMSSGLVCNESVSWVTFHSAYDFGYLVKILTRRELPSGLV  189

Query  415  GFFALINXYF-PEVFXIKHXMRFCNSLHGXXNKLAXLLEVER-VGVXHQAGSDSLXXXCT  242
            GF +L+  +F   ++ +KH MRFC SL+G  +++A  LEV R VG  HQAGSDSL     
Sbjct  190  GFLSLLRVFFGNNIYDVKHMMRFCKSLYGGLDRVARTLEVNREVGKCHQAGSDSLLTWHA  249

Query  241  FRKXKDNFF-SGSLEEXXGVLYGXGV  167
            F+K +D FF     E+  GVLYG  V
Sbjct  250  FQKMRDVFFVKDGPEQHAGVLYGLEV  275



>ref|XP_011006712.1| PREDICTED: probable CCR4-associated factor 1 homolog 11 [Populus 
euphratica]
Length=277

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 128/206 (62%), Gaps = 3/206 (1%)
 Frame = -3

Query  775  LKDXVDMLKLIQLGLTFSDEKGNLPTCGTXKYCXWQXXFREXDPXEDVXAXDSIEXLRQC  596
            LK  VD L LIQ+GLT SD KGNLP  GT     W+  FR+ D   D  A DS+E LR+ 
Sbjct  70   LKSNVDALNLIQVGLTLSDAKGNLPDLGTENRFIWEFNFRDFDVERDSHAPDSVELLRRQ  129

Query  595  GXDFEKNXESGIEXRRFGELLXSSGIVLNDSVHWVXFHXGYDXGYLLKIXXXXELPXXQQ  416
            G DFE+N E G++  +F EL+ SSG+V N+SV WV FH  YD GYL+KI    ELP    
Sbjct  130  GIDFERNREEGVDSAKFAELMMSSGLVCNESVSWVTFHSAYDFGYLVKIITRRELPSGLV  189

Query  415  GFFALINXYF-PEVFXIKHXMRFCNSLHGXXNKLAXLLEVER-VGVXHQAGSDSLXXXCT  242
            GF +L+  +F   ++ +KH MRFC SL+G  +++A  LEV R VG  HQAGSDSL     
Sbjct  190  GFLSLLRVFFGNNIYDVKHMMRFCKSLYGGLDRVARTLEVNREVGKCHQAGSDSLLTWHA  249

Query  241  FRKXKDNFF-SGSLEEXXGVLYGXGV  167
            F+K +D FF     E+  GVLYG  V
Sbjct  250  FQKMRDVFFVKDGPEQHAGVLYGLEV  275



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940