BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038K18

Length=899
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP05978.1|  unnamed protein product                                401   3e-134   Coffea canephora [robusta coffee]
gb|EPS64918.1|  sodium/calcium exchanger family protein                 385   4e-127   Genlisea aurea
ref|XP_011082732.1|  PREDICTED: uncharacterized protein LOC105165426    381   3e-125   Sesamum indicum [beniseed]
ref|XP_006451747.1|  hypothetical protein CICLE_v10007809mg             379   4e-124   Citrus clementina [clementine]
ref|XP_004244257.1|  PREDICTED: uncharacterized protein LOC101263533    373   1e-121   Solanum lycopersicum
ref|XP_010098421.1|  hypothetical protein L484_012136                   372   2e-121   Morus notabilis
ref|XP_009340381.1|  PREDICTED: uncharacterized protein LOC103932481    365   1e-118   Pyrus x bretschneideri [bai li]
ref|XP_009593456.1|  PREDICTED: uncharacterized protein LOC104090114    362   5e-118   Nicotiana tomentosiformis
ref|XP_007021648.1|  Sodium/calcium exchanger family protein / ca...    363   7e-118   Theobroma cacao [chocolate]
ref|XP_007213956.1|  hypothetical protein PRUPE_ppa004823mg             359   1e-117   
ref|XP_008386231.1|  PREDICTED: uncharacterized protein LOC103448741    362   1e-117   Malus domestica [apple tree]
ref|XP_002522155.1|  calcium ion binding protein, putative              361   2e-117   
gb|KHG29939.1|  Vacuolar calcium ion transporter                        362   2e-117   Gossypium arboreum [tree cotton]
ref|XP_007149412.1|  hypothetical protein PHAVU_005G068100g             361   2e-117   Phaseolus vulgaris [French bean]
ref|XP_009767335.1|  PREDICTED: uncharacterized protein LOC104218515    360   4e-117   Nicotiana sylvestris
ref|XP_011098256.1|  PREDICTED: uncharacterized protein LOC105176...    360   5e-117   Sesamum indicum [beniseed]
ref|XP_009604315.1|  PREDICTED: uncharacterized protein LOC104099119    360   6e-117   Nicotiana tomentosiformis
ref|XP_007212014.1|  hypothetical protein PRUPE_ppa004833mg             357   6e-117   
gb|KJB45756.1|  hypothetical protein B456_007G325800                    360   7e-117   Gossypium raimondii
ref|XP_010279178.1|  PREDICTED: uncharacterized protein LOC104613162    359   2e-116   Nelumbo nucifera [Indian lotus]
gb|EYU44997.1|  hypothetical protein MIMGU_mgv1a003664mg                357   6e-116   Erythranthe guttata [common monkey flower]
gb|KEH38643.1|  calcium-binding EF-hand protein                         353   7e-116   Medicago truncatula
ref|XP_006348283.1|  PREDICTED: uncharacterized protein LOC102600810    358   7e-116   Solanum tuberosum [potatoes]
ref|XP_008226455.1|  PREDICTED: uncharacterized protein LOC103326029    358   7e-116   Prunus mume [ume]
ref|XP_008226453.1|  PREDICTED: uncharacterized protein LOC103326027    357   1e-115   Prunus mume [ume]
ref|XP_004251882.1|  PREDICTED: uncharacterized protein LOC101257045    356   4e-115   Solanum lycopersicum
ref|XP_006358955.1|  PREDICTED: uncharacterized protein LOC102579474    354   1e-114   Solanum tuberosum [potatoes]
ref|XP_009348414.1|  PREDICTED: uncharacterized protein LOC103940068    352   6e-114   Pyrus x bretschneideri [bai li]
gb|EPS57671.1|  hypothetical protein M569_17145                         346   4e-113   Genlisea aurea
gb|KCW67438.1|  hypothetical protein EUGRSUZ_F01191                     342   6e-113   Eucalyptus grandis [rose gum]
gb|KCW67437.1|  hypothetical protein EUGRSUZ_F01191                     344   2e-112   Eucalyptus grandis [rose gum]
gb|KDP36271.1|  hypothetical protein JCGZ_09836                         347   7e-112   Jatropha curcas
ref|XP_009348415.1|  PREDICTED: uncharacterized protein LOC103940069    347   8e-112   Pyrus x bretschneideri [bai li]
ref|XP_008367781.1|  PREDICTED: uncharacterized protein LOC103431400    345   7e-111   
ref|XP_008367769.1|  PREDICTED: uncharacterized protein LOC103431392    344   1e-110   
ref|XP_010060650.1|  PREDICTED: uncharacterized protein LOC104448506    344   2e-110   Eucalyptus grandis [rose gum]
ref|XP_004294082.1|  PREDICTED: uncharacterized protein LOC101313777    343   2e-110   Fragaria vesca subsp. vesca
ref|XP_010042553.1|  PREDICTED: uncharacterized protein LOC104431654    332   1e-109   Eucalyptus grandis [rose gum]
gb|KJB13246.1|  hypothetical protein B456_002G064800                    340   3e-109   Gossypium raimondii
ref|XP_009766997.1|  PREDICTED: uncharacterized protein LOC104218248    340   6e-109   Nicotiana sylvestris
ref|XP_004489056.1|  PREDICTED: uncharacterized protein LOC101505490    339   9e-109   Cicer arietinum [garbanzo]
gb|KHG25681.1|  Vacuolar calcium ion transporter                        339   1e-108   Gossypium arboreum [tree cotton]
ref|XP_004146032.1|  PREDICTED: uncharacterized protein LOC101209...    338   3e-108   Cucumis sativus [cucumbers]
ref|XP_004146033.1|  PREDICTED: uncharacterized protein LOC101209...    338   3e-108   
ref|XP_010675392.1|  PREDICTED: uncharacterized protein LOC104891403    335   2e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003543222.1|  PREDICTED: uncharacterized protein LOC100809896    335   5e-107   Glycine max [soybeans]
ref|NP_001042378.1|  Os01g0212400                                       333   2e-106   
ref|XP_003634635.1|  PREDICTED: uncharacterized protein LOC100264164    333   2e-106   Vitis vinifera
ref|XP_011000241.1|  PREDICTED: uncharacterized protein LOC105107868    333   3e-106   Populus euphratica
ref|XP_003565462.1|  PREDICTED: uncharacterized protein LOC100838274    332   5e-106   Brachypodium distachyon [annual false brome]
ref|XP_010915578.1|  PREDICTED: uncharacterized protein LOC105040648    331   3e-105   Elaeis guineensis
ref|XP_010519243.1|  PREDICTED: uncharacterized protein LOC104798750    330   5e-105   Tarenaya hassleriana [spider flower]
gb|EMS45634.1|  hypothetical protein TRIUR3_11261                       325   7e-105   Triticum urartu
gb|EMS61578.1|  hypothetical protein TRIUR3_22187                       327   7e-105   Triticum urartu
ref|XP_002298903.2|  sodium/calcium exchanger family protein            329   8e-105   
gb|EMT05376.1|  hypothetical protein F775_06447                         326   2e-104   
ref|XP_006643900.1|  PREDICTED: uncharacterized protein LOC102712578    328   3e-104   Oryza brachyantha
emb|CBI20223.3|  unnamed protein product                                323   2e-103   Vitis vinifera
gb|EMT26919.1|  hypothetical protein F775_25869                         322   2e-103   
gb|ADN33808.1|  sodium/calcium exchanger family protein                 325   4e-103   Cucumis melo subsp. melo
ref|XP_008463718.1|  PREDICTED: uncharacterized protein LOC103501799    325   5e-103   Cucumis melo [Oriental melon]
dbj|BAJ93500.1|  predicted protein                                      324   9e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM82192.1|  unnamed protein product                                323   2e-102   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002282948.1|  PREDICTED: uncharacterized protein LOC100252144    322   3e-102   Vitis vinifera
ref|XP_011098255.1|  PREDICTED: uncharacterized protein LOC105176...    321   9e-102   
ref|XP_004294083.1|  PREDICTED: uncharacterized protein LOC101314065    318   2e-100   Fragaria vesca subsp. vesca
dbj|BAD19956.1|  putative drought-induced protein RDI                   317   2e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002451861.1|  hypothetical protein SORBIDRAFT_04g008850          317   3e-100   
gb|EEE56655.1|  hypothetical protein OsJ_06069                          317   3e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008645573.1|  PREDICTED: uncharacterized protein LOC103626994    317   3e-100   
ref|XP_009405607.1|  PREDICTED: uncharacterized protein LOC103988717    317   5e-100   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAI94501.1|  sodium/calcium exchanger protein                       316   1e-99    Dianthus caryophyllus [carnation]
ref|XP_004951320.1|  PREDICTED: uncharacterized protein LOC101782315    315   3e-99    Setaria italica
ref|XP_010535054.1|  PREDICTED: uncharacterized protein LOC104810447    314   6e-99    Tarenaya hassleriana [spider flower]
ref|XP_007050029.1|  Sodium/calcium exchanger family protein / ca...    314   6e-99    
ref|XP_009380498.1|  PREDICTED: uncharacterized protein LOC103968880    312   4e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAK32813.1|AF361800_1  At1g53210/F12M16_12                           307   4e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010062838.1|  PREDICTED: uncharacterized protein LOC104450104    308   6e-97    Eucalyptus grandis [rose gum]
ref|XP_010276580.1|  PREDICTED: uncharacterized protein LOC104611295    308   2e-96    Nelumbo nucifera [Indian lotus]
ref|NP_564623.2|  Na+/Ca 2+ exchanger-like protein                      308   2e-96    Arabidopsis thaliana [mouse-ear cress]
gb|AAF69532.1|AC008007_7  F12M16.12                                     307   2e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CDY55841.1|  BnaCnng29300D                                          307   3e-96    Brassica napus [oilseed rape]
emb|CDY25725.1|  BnaC03g69500D                                          307   3e-96    Brassica napus [oilseed rape]
ref|XP_009144785.1|  PREDICTED: uncharacterized protein LOC103868446    306   1e-95    Brassica rapa
gb|KCW67441.1|  hypothetical protein EUGRSUZ_F011931                    294   1e-95    Eucalyptus grandis [rose gum]
emb|CDY25869.1|  BnaA05g14600D                                          306   1e-95    Brassica napus [oilseed rape]
ref|XP_008783929.1|  PREDICTED: uncharacterized protein LOC103703017    306   2e-95    
ref|XP_006392816.1|  hypothetical protein EUTSA_v10011341mg             305   2e-95    Eutrema salsugineum [saltwater cress]
ref|XP_007021639.1|  Sodium/calcium exchanger family protein / ca...    308   2e-95    
ref|XP_009106991.1|  PREDICTED: uncharacterized protein LOC103832685    305   2e-95    Brassica rapa
ref|XP_009147618.1|  PREDICTED: uncharacterized protein LOC103871140    303   5e-95    Brassica rapa
ref|XP_008673552.1|  PREDICTED: uncharacterized protein LOC103649588    303   1e-94    
emb|CDY24108.1|  BnaA06g01060D                                          304   2e-94    Brassica napus [oilseed rape]
ref|XP_006307087.1|  hypothetical protein CARUB_v10008672mg             298   5e-94    
gb|ACY66874.1|  P20Sh095F0                                              300   8e-94    Saccharum hybrid cultivar R570
gb|ACY66868.1|  P20Sh148J07                                             300   1e-93    Saccharum hybrid cultivar R570
gb|KDP31770.1|  hypothetical protein JCGZ_12231                         300   1e-93    Jatropha curcas
ref|XP_010479874.1|  PREDICTED: uncharacterized protein LOC104758667    299   4e-93    Camelina sativa [gold-of-pleasure]
gb|ACN36915.1|  unknown                                                 295   5e-93    Zea mays [maize]
ref|XP_006307086.1|  hypothetical protein CARUB_v10008672mg             298   6e-93    Capsella rubella
ref|XP_010462200.1|  PREDICTED: uncharacterized protein LOC104742841    298   7e-93    Camelina sativa [gold-of-pleasure]
gb|ACN35869.1|  unknown                                                 293   8e-93    Zea mays [maize]
gb|ACN27225.1|  unknown                                                 295   1e-92    Zea mays [maize]
gb|KFK35737.1|  hypothetical protein AALP_AA4G030000                    296   2e-92    Arabis alpina [alpine rockcress]
emb|CDY26003.1|  BnaC06g06210D                                          297   2e-92    Brassica napus [oilseed rape]
ref|XP_010500958.1|  PREDICTED: uncharacterized protein LOC104778258    295   2e-91    Camelina sativa [gold-of-pleasure]
gb|KCW44589.1|  hypothetical protein EUGRSUZ_L01893                     290   2e-91    Eucalyptus grandis [rose gum]
ref|NP_001151543.1|  LOC100285177 precursor                             294   2e-91    Zea mays [maize]
ref|XP_008655084.1|  PREDICTED: LOC100285177 isoform X1                 294   4e-91    Zea mays [maize]
ref|XP_002891737.1|  sodium/calcium exchanger family protein            293   1e-90    
ref|XP_009409407.1|  PREDICTED: uncharacterized protein LOC103991626    293   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003571165.2|  PREDICTED: uncharacterized protein LOC100833...    293   2e-90    
ref|XP_002279120.1|  PREDICTED: uncharacterized protein LOC100253888    292   2e-90    Vitis vinifera
ref|XP_010234099.1|  PREDICTED: uncharacterized protein LOC100833...    293   3e-90    
emb|CAN78652.1|  hypothetical protein VITISV_033128                     291   6e-90    Vitis vinifera
ref|XP_010041151.1|  PREDICTED: uncharacterized protein LOC104430086    290   1e-89    Eucalyptus grandis [rose gum]
ref|XP_002525142.1|  calcium ion binding protein, putative              283   2e-87    
ref|XP_004968611.1|  PREDICTED: uncharacterized protein LOC101771765    282   9e-87    Setaria italica
ref|XP_004305436.1|  PREDICTED: uncharacterized protein LOC101295737    277   1e-84    Fragaria vesca subsp. vesca
ref|XP_002522156.1|  calcium ion binding protein, putative              275   7e-84    
ref|XP_009354324.1|  PREDICTED: uncharacterized protein LOC103945475    268   2e-81    Pyrus x bretschneideri [bai li]
ref|XP_008362437.1|  PREDICTED: uncharacterized protein LOC103426126    267   3e-81    
ref|XP_008368645.1|  PREDICTED: uncharacterized protein LOC103432241    267   7e-81    
ref|XP_006852513.1|  hypothetical protein AMTR_s00021p00164610          263   3e-79    Amborella trichopoda
gb|ADE75754.1|  unknown                                                 248   1e-77    Picea sitchensis
ref|XP_010052488.1|  PREDICTED: uncharacterized protein LOC104441...    255   4e-77    
gb|EMS60383.1|  hypothetical protein TRIUR3_19685                       248   1e-76    Triticum urartu
ref|XP_006446746.1|  hypothetical protein CICLE_v10018123mg             256   1e-76    
ref|XP_006469050.1|  PREDICTED: uncharacterized protein LOC102616350    255   2e-76    Citrus sinensis [apfelsine]
gb|KCW89606.1|  hypothetical protein EUGRSUZ_A01890                     254   2e-76    Eucalyptus grandis [rose gum]
ref|XP_010052481.1|  PREDICTED: uncharacterized protein LOC104441...    254   3e-76    Eucalyptus grandis [rose gum]
ref|XP_008229131.1|  PREDICTED: uncharacterized protein LOC103328510    254   7e-76    Prunus mume [ume]
ref|XP_007213018.1|  hypothetical protein PRUPE_ppa023026mg             253   1e-75    Prunus persica
gb|ADM77106.1|  sodium/calcium exchanger family-like protein            240   1e-74    Picea sitchensis
gb|ADM77115.1|  sodium/calcium exchanger family-like protein            239   3e-74    Picea sitchensis
gb|ADM77131.1|  sodium/calcium exchanger family-like protein            237   1e-73    Picea sitchensis
emb|CAN76642.1|  hypothetical protein VITISV_042742                     234   3e-73    Vitis vinifera
dbj|BAD43479.1|  unknown protein                                        228   3e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002992821.1|  hypothetical protein SELMODRAFT_42349              233   2e-68    
ref|XP_002987555.1|  hypothetical protein SELMODRAFT_42348              233   2e-68    
ref|XP_002974272.1|  hypothetical protein SELMODRAFT_52345              222   2e-64    
ref|XP_009340418.1|  PREDICTED: uncharacterized protein LOC103932516    226   3e-64    Pyrus x bretschneideri [bai li]
ref|XP_008386229.1|  PREDICTED: uncharacterized protein LOC103448738    226   4e-64    
ref|XP_002985644.1|  hypothetical protein SELMODRAFT_181929             221   5e-64    
gb|KJB13247.1|  hypothetical protein B456_002G064800                    218   5e-63    Gossypium raimondii
gb|KJB13245.1|  hypothetical protein B456_002G064800                    218   9e-63    Gossypium raimondii
ref|XP_001762095.1|  predicted protein                                  219   1e-62    
ref|XP_010277716.1|  PREDICTED: uncharacterized protein LOC104612096    221   2e-62    Nelumbo nucifera [Indian lotus]
gb|KDP36272.1|  hypothetical protein JCGZ_09837                         215   1e-61    Jatropha curcas
gb|KJB45757.1|  hypothetical protein B456_007G325800                    214   3e-61    Gossypium raimondii
ref|XP_001751608.1|  predicted protein                                  214   1e-60    
ref|XP_011000237.1|  PREDICTED: uncharacterized protein LOC105107...    215   3e-60    Populus euphratica
ref|XP_011000236.1|  PREDICTED: uncharacterized protein LOC105107...    214   3e-60    Populus euphratica
ref|XP_011000235.1|  PREDICTED: uncharacterized protein LOC105107...    214   4e-60    Populus euphratica
ref|XP_006370033.1|  hypothetical protein POPTR_0001s38420g             212   1e-59    
ref|XP_008226451.1|  PREDICTED: uncharacterized protein LOC103326025    213   2e-59    Prunus mume [ume]
ref|XP_010279180.1|  PREDICTED: uncharacterized protein LOC104613163    209   3e-59    Nelumbo nucifera [Indian lotus]
ref|XP_010657148.1|  PREDICTED: uncharacterized protein LOC100245468    202   6e-59    
ref|XP_006370034.1|  hypothetical protein POPTR_0001s38430g             206   1e-58    
ref|XP_011460411.1|  PREDICTED: uncharacterized protein LOC105350345    196   2e-58    Fragaria vesca subsp. vesca
ref|XP_007213499.1|  hypothetical protein PRUPE_ppa022096mg             208   3e-58    
gb|EMT26602.1|  hypothetical protein F775_16567                         196   1e-57    
ref|XP_002298902.2|  hypothetical protein POPTR_0001s38430g             207   2e-57    
emb|CDP05977.1|  unnamed protein product                                206   5e-57    Coffea canephora [robusta coffee]
ref|XP_002275961.1|  PREDICTED: uncharacterized protein LOC100260847    202   2e-56    Vitis vinifera
gb|KDO45773.1|  hypothetical protein CISIN_1g0423001mg                  189   8e-56    Citrus sinensis [apfelsine]
emb|CAN66793.1|  hypothetical protein VITISV_034151                     195   9e-56    Vitis vinifera
emb|CBI21945.3|  unnamed protein product                                202   2e-55    Vitis vinifera
emb|CBI21946.3|  unnamed protein product                                201   6e-55    Vitis vinifera
emb|CAN78275.1|  hypothetical protein VITISV_037788                     197   6e-55    Vitis vinifera
ref|XP_002272134.1|  PREDICTED: uncharacterized protein LOC100243523    196   3e-54    
ref|XP_009605371.1|  PREDICTED: uncharacterized protein LOC104099939    198   3e-54    Nicotiana tomentosiformis
ref|XP_001752917.1|  predicted protein                                  196   5e-54    
ref|XP_007025465.1|  Sodium/calcium exchanger family protein / ca...    196   6e-54    
ref|XP_004233846.1|  PREDICTED: uncharacterized protein LOC101251749    196   3e-53    Solanum lycopersicum
ref|XP_001755925.1|  predicted protein                                  192   8e-53    
ref|XP_009803286.1|  PREDICTED: uncharacterized protein LOC104248681    194   1e-52    Nicotiana sylvestris
emb|CAN78651.1|  hypothetical protein VITISV_033127                     191   2e-52    Vitis vinifera
gb|EYU44996.1|  hypothetical protein MIMGU_mgv1a025835mg                191   1e-51    Erythranthe guttata [common monkey flower]
ref|XP_002979757.1|  hypothetical protein SELMODRAFT_111442             177   2e-51    
ref|XP_002965139.1|  hypothetical protein SELMODRAFT_82683              188   3e-51    
emb|CAN78650.1|  hypothetical protein VITISV_033126                     187   4e-51    Vitis vinifera
ref|XP_002275985.2|  PREDICTED: uncharacterized protein LOC100255777    187   4e-51    Vitis vinifera
ref|XP_002962226.1|  hypothetical protein SELMODRAFT_76965              187   5e-51    
ref|XP_002985423.1|  hypothetical protein SELMODRAFT_122258             176   5e-51    
gb|KCW69971.1|  hypothetical protein EUGRSUZ_F03285                     185   1e-50    Eucalyptus grandis [rose gum]
ref|XP_011082730.1|  PREDICTED: uncharacterized protein LOC105165425    188   1e-50    Sesamum indicum [beniseed]
ref|XP_002276006.2|  PREDICTED: uncharacterized protein LOC100250594    185   2e-50    
ref|XP_011096403.1|  PREDICTED: uncharacterized protein LOC105175606    187   3e-50    
ref|XP_008225191.1|  PREDICTED: uncharacterized protein LOC103324855    185   4e-50    Prunus mume [ume]
gb|KDP21052.1|  hypothetical protein JCGZ_21523                         183   2e-49    Jatropha curcas
gb|EAZ04370.1|  hypothetical protein OsI_26513                          181   3e-49    Oryza sativa Indica Group [Indian rice]
ref|XP_011083284.1|  PREDICTED: uncharacterized protein LOC105165819    184   4e-49    Sesamum indicum [beniseed]
ref|XP_007214217.1|  hypothetical protein PRUPE_ppa023212mg             181   9e-49    
ref|XP_008383659.1|  PREDICTED: uncharacterized protein LOC103446347    181   1e-48    Malus domestica [apple tree]
ref|XP_008358657.1|  PREDICTED: uncharacterized protein LOC103422380    177   3e-48    
ref|XP_006594741.1|  PREDICTED: uncharacterized protein LOC100798...    181   4e-48    Glycine max [soybeans]
ref|XP_006594742.1|  PREDICTED: uncharacterized protein LOC100798...    181   4e-48    Glycine max [soybeans]
ref|XP_006594743.1|  PREDICTED: uncharacterized protein LOC100798...    181   4e-48    
ref|XP_002522528.1|  conserved hypothetical protein                     179   5e-48    
ref|XP_004293919.1|  PREDICTED: uncharacterized protein LOC101312324    178   1e-47    Fragaria vesca subsp. vesca
ref|XP_009352959.1|  PREDICTED: uncharacterized protein LOC103944258    177   3e-47    
gb|KCW67432.1|  hypothetical protein EUGRSUZ_F01188                     176   6e-47    Eucalyptus grandis [rose gum]
gb|KCW67433.1|  hypothetical protein EUGRSUZ_F01189                     174   2e-46    Eucalyptus grandis [rose gum]
ref|XP_010060649.1|  PREDICTED: uncharacterized protein LOC104448505    174   9e-46    Eucalyptus grandis [rose gum]
gb|KDP21053.1|  hypothetical protein JCGZ_21524                         174   9e-46    Jatropha curcas
ref|XP_006340117.1|  PREDICTED: uncharacterized protein LOC102587762    174   1e-45    
gb|EYU28050.1|  hypothetical protein MIMGU_mgv1a023246mg                173   1e-45    Erythranthe guttata [common monkey flower]
ref|XP_009352820.1|  PREDICTED: uncharacterized protein LOC103944133    172   1e-45    
ref|XP_010101519.1|  hypothetical protein L484_008850                   172   2e-45    
ref|XP_008383883.1|  PREDICTED: uncharacterized protein LOC103446524    172   3e-45    
ref|XP_004234097.2|  PREDICTED: uncharacterized protein LOC101254...    172   3e-45    Solanum lycopersicum
ref|XP_007021646.1|  Sodium/calcium exchanger family protein / ca...    171   7e-45    
ref|XP_011460767.1|  PREDICTED: uncharacterized protein LOC105350439    171   9e-45    Fragaria vesca subsp. vesca
ref|XP_009352958.1|  PREDICTED: uncharacterized protein LOC103944256    170   1e-44    
ref|XP_007149413.1|  hypothetical protein PHAVU_005G068200g             169   2e-44    Phaseolus vulgaris [French bean]
ref|XP_006343216.1|  PREDICTED: uncharacterized protein LOC102593213    170   3e-44    Solanum tuberosum [potatoes]
gb|EYU26347.1|  hypothetical protein MIMGU_mgv1a002045mg                169   4e-44    Erythranthe guttata [common monkey flower]
gb|KCW67434.1|  hypothetical protein EUGRSUZ_F01190                     167   6e-44    Eucalyptus grandis [rose gum]
ref|XP_006594744.1|  PREDICTED: uncharacterized protein LOC100799062    167   6e-44    
ref|XP_002522529.1|  calmodulin, putative                               168   8e-44    
ref|XP_011027726.1|  PREDICTED: uncharacterized protein LOC105127...    166   1e-43    Populus euphratica
ref|XP_005839482.1|  hypothetical protein GUITHDRAFT_159252             166   2e-43    Guillardia theta CCMP2712
ref|XP_011027724.1|  PREDICTED: uncharacterized protein LOC105127...    166   2e-43    Populus euphratica
ref|XP_011460597.1|  PREDICTED: uncharacterized protein LOC101307679    164   3e-43    Fragaria vesca subsp. vesca
gb|KHN36865.1|  hypothetical protein glysoja_001596                     166   3e-43    Glycine soja [wild soybean]
gb|KCW74041.1|  hypothetical protein EUGRSUZ_E02665                     163   1e-42    Eucalyptus grandis [rose gum]
ref|XP_011096404.1|  PREDICTED: uncharacterized protein LOC105175608    165   1e-42    Sesamum indicum [beniseed]
ref|XP_010058975.1|  PREDICTED: uncharacterized protein LOC104446873    163   2e-42    
gb|KCW67430.1|  hypothetical protein EUGRSUZ_F01186                     163   5e-42    Eucalyptus grandis [rose gum]
ref|XP_004361492.1|  hypothetical protein DFA_05775                     162   1e-41    Cavenderia fasciculata
ref|XP_007149414.1|  hypothetical protein PHAVU_005G068300g             160   9e-41    Phaseolus vulgaris [French bean]
ref|XP_011096402.1|  PREDICTED: uncharacterized protein LOC105175...    159   1e-40    Sesamum indicum [beniseed]
ref|XP_011096401.1|  PREDICTED: uncharacterized protein LOC105175...    159   1e-40    Sesamum indicum [beniseed]
ref|XP_009629500.1|  PREDICTED: uncharacterized protein LOC104119642    160   1e-40    Nicotiana tomentosiformis
ref|XP_009794964.1|  PREDICTED: uncharacterized protein LOC104241728    158   1e-40    Nicotiana sylvestris
ref|XP_008371442.1|  PREDICTED: uncharacterized protein LOC103434855    159   1e-40    
ref|XP_002305761.1|  hypothetical protein POPTR_0004s05210g             158   2e-40    
ref|XP_010058973.1|  PREDICTED: uncharacterized protein LOC104446871    157   6e-40    
gb|KCW74040.1|  hypothetical protein EUGRSUZ_E02663                     157   7e-40    Eucalyptus grandis [rose gum]
gb|KHN28092.1|  hypothetical protein glysoja_007824                     155   2e-39    Glycine soja [wild soybean]
ref|XP_003540477.1|  PREDICTED: uncharacterized protein LOC100800452    155   5e-39    Glycine max [soybeans]
gb|EYU44995.1|  hypothetical protein MIMGU_mgv1a002795mg                154   5e-39    Erythranthe guttata [common monkey flower]
gb|EYU43358.1|  hypothetical protein MIMGU_mgv1a003865mg                152   2e-38    Erythranthe guttata [common monkey flower]
ref|XP_002500016.1|  Ca2+:Cation antiporter family                      152   4e-38    Micromonas commoda
ref|XP_005650712.1|  hypothetical protein COCSUDRAFT_61158              150   7e-38    Coccomyxa subellipsoidea C-169
emb|CBI20222.3|  unnamed protein product                                151   8e-38    Vitis vinifera
ref|XP_010644148.1|  PREDICTED: uncharacterized protein LOC100241883    151   2e-37    Vitis vinifera
ref|XP_009353170.1|  PREDICTED: uncharacterized protein LOC103944425    150   2e-37    
dbj|GAM24148.1|  hypothetical protein SAMD00019534_073230               147   2e-36    Acytostelium subglobosum LB1
ref|NP_001046432.2|  Os02g0247800                                       136   3e-36    
ref|XP_010478257.1|  PREDICTED: uncharacterized protein LOC104757229    144   1e-35    Camelina sativa [gold-of-pleasure]
ref|XP_004357876.1|  hypothetical protein DFA_00160                     144   4e-35    Cavenderia fasciculata
ref|NP_174197.2|  EF-hand, calcium binding motif-containing protein     141   1e-34    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010058976.1|  PREDICTED: uncharacterized protein LOC104446874    141   1e-34    Eucalyptus grandis [rose gum]
ref|XP_006410547.1|  hypothetical protein EUTSA_v10016396mg             140   7e-34    Eutrema salsugineum [saltwater cress]
ref|XP_004489086.1|  PREDICTED: uncharacterized protein LOC101490438    132   1e-33    
gb|AAF24539.2|AC007508_2  F1K23.2                                       141   1e-33    Arabidopsis thaliana [mouse-ear cress]
emb|CBN73858.1|  Putative sodium calcium exchanger                      137   2e-33    Ectocarpus siliculosus
gb|EYU28049.1|  hypothetical protein MIMGU_mgv1a003825mg                138   3e-33    Erythranthe guttata [common monkey flower]
dbj|GAM24777.1|  hypothetical protein SAMD00019534_079520               135   8e-33    Acytostelium subglobosum LB1
ref|XP_010549555.1|  PREDICTED: uncharacterized protein LOC104820693    136   9e-33    Tarenaya hassleriana [spider flower]
ref|XP_011460766.1|  PREDICTED: uncharacterized protein LOC105350...    129   2e-32    Fragaria vesca subsp. vesca
ref|XP_006415620.1|  hypothetical protein EUTSA_v10007172mg             135   3e-32    Eutrema salsugineum [saltwater cress]
ref|XP_003288984.1|  hypothetical protein DICPUDRAFT_153287             133   9e-32    Dictyostelium purpureum
gb|ABK93869.1|  unknown                                                 124   1e-31    Populus trichocarpa [western balsam poplar]
gb|EFA85983.1|  hypothetical protein PPL_01216                          133   2e-31    Heterostelium album PN500
ref|XP_009132970.1|  PREDICTED: uncharacterized protein LOC103857518    132   3e-31    Brassica rapa
emb|CDX79552.1|  BnaC03g18880D                                          132   4e-31    
ref|NP_001185109.1|  Calcium-binding EF-hand family protein             131   5e-31    Arabidopsis thaliana [mouse-ear cress]
emb|CDY34082.1|  BnaA09g27080D                                          131   8e-31    Brassica napus [oilseed rape]
ref|XP_010509800.1|  PREDICTED: uncharacterized protein LOC104786159    131   9e-31    Camelina sativa [gold-of-pleasure]
ref|XP_009113633.1|  PREDICTED: uncharacterized protein LOC103838933    130   1e-30    Brassica rapa
dbj|BAF00582.1|  hypothetical protein                                   130   1e-30    Arabidopsis thaliana [mouse-ear cress]
emb|CDX84660.1|  BnaA03g15700D                                          130   2e-30    
emb|CDY64851.1|  BnaCnng45370D                                          129   2e-30    Brassica napus [oilseed rape]
ref|XP_006295951.1|  hypothetical protein CARUB_v10025093mg             130   2e-30    Capsella rubella
ref|XP_006304623.1|  hypothetical protein CARUB_v10011719mg             129   2e-30    
ref|XP_007021649.1|  Sodium/calcium exchanger family protein / ca...    129   3e-30    
ref|XP_003386706.1|  PREDICTED: uncharacterized protein LOC100632705    129   4e-30    
ref|XP_004963827.1|  PREDICTED: uncharacterized protein LOC101777425    122   5e-30    
ref|XP_002881319.1|  calcium ion binding protein                        129   5e-30    
ref|NP_180949.2|  calcium-binding EF-hand-containing protein            128   9e-30    
gb|KFK23894.1|  hypothetical protein AALP_AAs69390U000200               128   1e-29    
ref|XP_010460672.1|  PREDICTED: uncharacterized protein LOC104741492    127   2e-29    
ref|XP_002893543.1|  predicted protein                                  129   3e-29    
ref|XP_002296137.1|  EF containing protein                              125   3e-29    
gb|EJK62281.1|  hypothetical protein THAOC_17107                        126   4e-29    
ref|XP_010499420.1|  PREDICTED: uncharacterized protein LOC104776935    125   6e-29    
gb|KIZ00034.1|  hypothetical protein MNEG_7930                          123   7e-29    
ref|XP_001627159.1|  predicted protein                                  127   1e-28    
ref|XP_002185522.1|  predicted protein                                  124   2e-28    
ref|XP_009141357.1|  PREDICTED: uncharacterized protein LOC103865312    124   2e-28    
ref|XP_642144.1|  hypothetical protein DDB_G0278609                     124   2e-28    
emb|CDY37675.1|  BnaA04g19930D                                          124   2e-28    
emb|CCA15196.1|  Ca2 :Cation Antiporter (CaCA) Family putative          124   3e-28    
gb|EPS70685.1|  hypothetical protein M569_04074                         119   5e-28    
ref|XP_002113975.1|  hypothetical protein TRIADDRAFT_57950              121   9e-28    
gb|KFK44728.1|  hypothetical protein AALP_AA1G295100                    121   1e-27    
emb|CCI40171.1|  unnamed protein product                                125   1e-27    
ref|XP_008897040.1|  hypothetical protein PPTG_05278                    120   4e-27    
gb|ETK74657.1|  hypothetical protein L915_18596                         120   4e-27    
ref|XP_002907451.1|  Ca2 :Cation Antiporter (CaCA) Family               121   5e-27    
emb|CBK20420.2|  unnamed protein product                                117   6e-27    
ref|NP_180950.2|  Calcium-binding EF-hand family protein                119   1e-26    
ref|XP_009517896.1|  hypothetical protein PHYSODRAFT_349569             117   8e-26    
ref|XP_009762341.1|  PREDICTED: uncharacterized protein LOC104214380    111   1e-25    
gb|KFK23895.1|  hypothetical protein AALP_AAs69390U000300               113   2e-24    
ref|XP_009032139.1|  hypothetical protein AURANDRAFT_8067               105   3e-24    
ref|XP_009033565.1|  hypothetical protein AURANDRAFT_8128               104   1e-23    
ref|XP_011000239.1|  PREDICTED: uncharacterized protein LOC105107...    108   7e-23    
gb|EWM24964.1|  ca2 :cation antiporter family                           106   4e-22    
gb|ABR26205.1|  sodium/calcium exchanger protein                        103   6e-22    
ref|XP_009032349.1|  hypothetical protein AURANDRAFT_19015            99.8    9e-22    
ref|XP_003057911.1|  predicted protein                                  104   1e-21    
ref|XP_001742689.1|  hypothetical protein                             97.4    3e-21    
ref|XP_005719417.1|  unnamed protein product                            102   1e-20    
gb|EFA82832.1|  hypothetical protein PPL_04527                          102   1e-20    
ref|XP_006306439.1|  hypothetical protein CARUB_v10012381mg             101   2e-20    
ref|XP_010317432.1|  PREDICTED: uncharacterized protein LOC101254...  93.2    1e-17    
ref|XP_002893544.1|  predicted protein                                90.9    6e-17    
ref|XP_002781327.1|  conserved hypothetical protein                   83.2    2e-16    
gb|KFK44727.1|  hypothetical protein AALP_AA1G295000                  86.7    1e-15    
gb|KEH38649.1|  calcium-binding EF-hand protein                       85.1    3e-15    
ref|XP_010319658.1|  PREDICTED: uncharacterized protein LOC101260716  78.2    3e-14    
ref|XP_002769715.1|  conserved hypothetical protein                   72.4    2e-12    
dbj|BAD44247.1|  unknown protein                                      70.1    3e-12    
ref|XP_007050030.1|  Sodium/calcium exchanger family protein / ca...  74.3    1e-11    
ref|XP_011087014.1|  PREDICTED: uncharacterized protein LOC105168577  73.6    2e-11    
gb|ETO26978.1|  hypothetical protein RFI_10156                        68.6    9e-10    
gb|KEH38650.1|  calcium-binding EF-hand protein                       68.6    1e-09    
ref|XP_008380037.1|  PREDICTED: vacuolar cation/proton exchanger ...  59.7    3e-07    
ref|XP_010246067.1|  PREDICTED: vacuolar cation/proton exchanger ...  61.2    3e-07    
gb|EMT26603.1|  hypothetical protein F775_16568                       59.7    6e-07    
ref|XP_010092384.1|  Vacuolar cation/proton exchanger 5               60.1    8e-07    
ref|XP_009390485.1|  PREDICTED: vacuolar cation/proton exchanger ...  60.1    9e-07    
ref|XP_008357973.1|  PREDICTED: vacuolar cation/proton exchanger ...  58.9    2e-06    
ref|XP_002894521.1|  predicted protein                                58.5    3e-06    
ref|XP_002495797.1|  ZYRO0C03256p                                     58.2    5e-06    
ref|XP_010644651.1|  PREDICTED: vacuolar cation/proton exchanger ...  57.4    5e-06    
ref|XP_010644649.1|  PREDICTED: vacuolar cation/proton exchanger ...  57.8    6e-06    
ref|XP_010644650.1|  PREDICTED: vacuolar cation/proton exchanger ...  57.4    6e-06    
gb|AAF79504.1|AC002328_12  F20N2.14                                   57.8    6e-06    
emb|CBI39814.3|  unnamed protein product                              57.4    6e-06    
ref|XP_002153212.1|  membrane bound cation transporter, putative      57.8    6e-06    
ref|XP_010644648.1|  PREDICTED: vacuolar cation/proton exchanger ...  57.4    6e-06    
emb|CDY24195.1|  BnaC01g37750D                                        57.4    7e-06    
ref|XP_010061405.1|  PREDICTED: vacuolar cation/proton exchanger ...  57.4    7e-06    
ref|XP_011000357.1|  PREDICTED: vacuolar cation/proton exchanger ...  57.4    7e-06    
ref|XP_011000354.1|  PREDICTED: vacuolar cation/proton exchanger ...  57.4    7e-06    
gb|AFD32369.1|  CAX2 transporter                                      57.4    7e-06    
ref|XP_010061406.1|  PREDICTED: vacuolar cation/proton exchanger ...  57.0    7e-06    
ref|NP_175968.4|  cation exchanger 6                                  57.0    8e-06    
emb|CDY43356.1|  BnaA01g29870D                                        57.0    8e-06    
ref|XP_006377987.1|  cation exchanger 2 family protein                57.0    8e-06    
sp|Q9LFZ8.3|CAX6_ARATH  RecName: Full=Putative vacuolar cation/pr...  57.0    8e-06    
emb|CDY44007.1|  BnaA05g26020D                                        57.0    8e-06    
ref|XP_009146534.1|  PREDICTED: vacuolar cation/proton exchanger ...  57.0    9e-06    
gb|KFX44344.1|  Vacuolar calcium ion transporter                      57.4    9e-06    
ref|NP_175969.2|  vacuolar cation/proton exchanger 5                  57.0    9e-06    
gb|EGU74084.1|  hypothetical protein FOXB_15405                       54.7    9e-06    
ref|XP_006307535.1|  hypothetical protein CARUB_v10009159mg           56.6    1e-05    
ref|XP_007146685.1|  hypothetical protein PHAVU_006G060800g           56.6    1e-05    
ref|XP_007049462.1|  Vacuolar cation/proton exchanger 5               56.6    1e-05    
ref|XP_008342453.1|  PREDICTED: vacuolar cation/proton exchanger ...  56.2    1e-05    
ref|XP_009399625.1|  PREDICTED: vacuolar cation/proton exchanger ...  56.6    1e-05    
ref|XP_009399624.1|  PREDICTED: vacuolar cation/proton exchanger ...  56.2    1e-05    
ref|XP_006297688.1|  hypothetical protein CARUB_v10013719mg           56.2    1e-05    
ref|XP_006297689.1|  hypothetical protein CARUB_v10013719mg           56.2    1e-05    
ref|XP_002488237.1|  membrane bound cation transporter, putative      56.6    2e-05    
ref|XP_008355044.1|  PREDICTED: vacuolar cation/proton exchanger ...  56.2    2e-05    
ref|XP_010252964.1|  PREDICTED: vacuolar cation/proton exchanger ...  55.8    2e-05    
ref|XP_008355045.1|  PREDICTED: vacuolar cation/proton exchanger ...  56.2    2e-05    
ref|XP_010481195.1|  PREDICTED: putative vacuolar cation/proton e...  55.8    2e-05    
ref|XP_008353345.1|  PREDICTED: vacuolar cation/proton exchanger 5    56.2    2e-05    
ref|XP_010500324.1|  PREDICTED: vacuolar cation/proton exchanger ...  55.8    2e-05    
ref|XP_011082885.1|  PREDICTED: vacuolar cation/proton exchanger ...  55.8    2e-05    
gb|ABI15900.1|  putative calcium exchanger                            55.8    2e-05    
ref|XP_009124740.1|  PREDICTED: vacuolar cation/proton exchanger ...  55.5    2e-05    
ref|XP_009124739.1|  PREDICTED: vacuolar cation/proton exchanger ...  55.8    2e-05    
ref|XP_011082886.1|  PREDICTED: vacuolar cation/proton exchanger ...  55.8    2e-05    
ref|XP_004303848.1|  PREDICTED: vacuolar cation/proton exchanger ...  55.8    2e-05    
emb|CAE30484.1|  low affinity calcium transporter CAX2                55.5    2e-05    
gb|AAB05914.1|  low affinity calcium antiporter CAX2                  55.5    2e-05    
ref|XP_002882816.1|  hypothetical protein ARALYDRAFT_897557           55.5    3e-05    
ref|NP_566452.1|  low affinity calcium antiporter CAX2                55.5    3e-05    
dbj|BAB02801.1|  calcium/proton exchanger                             55.5    3e-05    
gb|EMT19312.1|  Putative vacuolar cation/proton exchanger 4           55.5    3e-05    
ref|XP_010465161.1|  PREDICTED: vacuolar cation/proton exchanger ...  55.5    3e-05    
ref|XP_010552333.1|  PREDICTED: vacuolar cation/proton exchanger ...  55.5    3e-05    
ref|XP_003530824.2|  PREDICTED: vacuolar cation/proton exchanger ...  55.1    3e-05    
ref|XP_010552330.1|  PREDICTED: vacuolar cation/proton exchanger ...  55.1    3e-05    
dbj|BAK01458.1|  predicted protein                                    55.1    3e-05    
ref|XP_008219030.1|  PREDICTED: vacuolar cation/proton exchanger 5    55.1    4e-05    
ref|XP_008229758.1|  PREDICTED: vacuolar cation/proton exchanger ...  55.1    4e-05    
ref|XP_002894520.1|  ATCAX6                                           54.7    4e-05    
ref|XP_006586173.1|  PREDICTED: vacuolar cation/proton exchanger ...  54.7    4e-05    
ref|XP_002266383.2|  PREDICTED: vacuolar cation/proton exchanger ...  54.7    4e-05    
emb|CDY26090.1|  BnaC06g11060D                                        54.7    4e-05    
ref|XP_007020353.1|  Cation exchanger 2 isoform 2                     54.7    4e-05    
ref|XP_007020352.1|  Cation exchanger 2 isoform 1                     54.7    5e-05    
gb|AFD32370.1|  CAX2 transporter                                      54.7    5e-05    
ref|XP_006392609.1|  hypothetical protein EUTSA_v10011487mg           54.7    5e-05    
ref|XP_003570912.2|  PREDICTED: putative vacuolar cation/proton e...  54.7    5e-05    
ref|XP_007205398.1|  hypothetical protein PRUPE_ppa007470mg           54.3    5e-05    
ref|XP_010252961.1|  PREDICTED: vacuolar cation/proton exchanger ...  54.7    5e-05    
ref|XP_004303910.1|  PREDICTED: vacuolar cation/proton exchanger ...  54.7    5e-05    
gb|KDP32640.1|  hypothetical protein JCGZ_13190                       54.7    5e-05    
emb|CDY10539.1|  BnaC03g70750D                                        54.3    5e-05    
gb|EYU34384.1|  hypothetical protein MIMGU_mgv1a006185mg              54.7    5e-05    
ref|XP_004294893.1|  PREDICTED: vacuolar cation/proton exchanger ...  54.3    6e-05    
ref|XP_010462428.1|  PREDICTED: putative vacuolar cation/proton e...  54.3    6e-05    
ref|XP_011461577.1|  PREDICTED: vacuolar cation/proton exchanger ...  54.3    6e-05    
gb|KJB13244.1|  hypothetical protein B456_002G064800                  54.3    6e-05    
ref|XP_010462427.1|  PREDICTED: putative vacuolar cation/proton e...  54.3    6e-05    
emb|CDO97770.1|  unnamed protein product                              54.3    6e-05    
gb|EXK76228.1|  calcium/proton exchanger                              54.3    7e-05    
ref|XP_009106831.1|  PREDICTED: vacuolar cation/proton exchanger ...  54.3    7e-05    
ref|XP_010252965.1|  PREDICTED: vacuolar cation/proton exchanger ...  53.9    8e-05    
ref|XP_009333994.1|  PREDICTED: vacuolar cation/proton exchanger ...  53.9    8e-05    
ref|XP_009106834.1|  PREDICTED: vacuolar cation/proton exchanger ...  53.9    9e-05    
ref|XP_010462426.1|  PREDICTED: putative vacuolar cation/proton e...  53.9    9e-05    
emb|CDY42379.1|  BnaA08g00350D                                        53.9    9e-05    
ref|XP_009106833.1|  PREDICTED: vacuolar cation/proton exchanger ...  53.9    9e-05    
ref|XP_009106832.1|  PREDICTED: vacuolar cation/proton exchanger ...  53.9    9e-05    
ref|XP_003054527.1|  hypothetical protein NECHADRAFT_31235            54.3    9e-05    
gb|EWC44785.1|  vacuolar Ca(2+) transporter                           53.5    1e-04    
ref|XP_010252960.1|  PREDICTED: vacuolar cation/proton exchanger ...  53.5    1e-04    
ref|XP_010252962.1|  PREDICTED: vacuolar cation/proton exchanger ...  53.5    1e-04    
ref|XP_010252959.1|  PREDICTED: vacuolar cation/proton exchanger ...  53.5    1e-04    
gb|EKG20134.1|  Sodium/calcium exchanger membrane region              53.9    1e-04    
gb|EGA59419.1|  Vcx1p                                                 53.1    1e-04    
ref|XP_010252963.1|  PREDICTED: vacuolar cation/proton exchanger ...  53.5    1e-04    
ref|XP_009597430.1|  PREDICTED: vacuolar cation/proton exchanger ...  53.5    1e-04    
ref|XP_002533730.1|  Vacuolar cation/proton exchanger, putative       53.1    1e-04    
emb|CBI28491.3|  unnamed protein product                              53.9    1e-04    
ref|XP_008799118.1|  PREDICTED: vacuolar cation/proton exchanger ...  51.6    1e-04    
gb|KGO43638.1|  Sodium/calcium exchanger membrane region              53.5    1e-04    
ref|XP_010534823.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar cat...  53.1    1e-04    
ref|XP_009795738.1|  PREDICTED: vacuolar cation/proton exchanger ...  53.1    1e-04    
gb|KGO52848.1|  Sodium/calcium exchanger membrane region              53.5    1e-04    
gb|EXK76465.1|  calcium/proton exchanger                              53.1    2e-04    
gb|KCW53938.1|  hypothetical protein EUGRSUZ_J03144                   53.1    2e-04    
dbj|GAM43534.1|  hypothetical protein TCE0_050f18422                  53.1    2e-04    
ref|XP_006579928.1|  PREDICTED: vacuolar cation/proton exchanger ...  51.2    2e-04    
ref|XP_006966478.1|  Ca2+ transporter                                 52.8    2e-04    
gb|AAB67620.1|  unknown protein                                       52.8    2e-04    
dbj|BAK05290.1|  predicted protein                                    52.8    2e-04    
ref|XP_002535143.1|  hypothetical protein RCOM_2032310                51.6    2e-04    
ref|XP_007411357.1|  hypothetical protein MELLADRAFT_56421            52.4    3e-04    
gb|EXK25733.1|  calcium/proton exchanger                              52.4    3e-04    
ref|XP_002451928.1|  hypothetical protein SORBIDRAFT_04g010130        52.4    3e-04    
ref|XP_002299069.2|  cation exchanger 2 family protein                52.4    3e-04    
ref|XP_008806555.1|  PREDICTED: vacuolar cation/proton exchanger ...  52.4    3e-04    
gb|KFY53212.1|  hypothetical protein V496_07817                       52.4    3e-04    
gb|KHN01813.1|  Vacuolar cation/proton exchanger 5                    52.4    3e-04    
ref|XP_006474790.1|  PREDICTED: vacuolar cation/proton exchanger ...  52.0    3e-04    
gb|AAF79505.1|AC002328_13  F20N2.13                                   52.4    3e-04    
gb|EEU08999.1|  Vcx1p                                                 52.0    3e-04    
gb|EDN60231.1|  H+/Ca2+ exchanger                                     52.0    3e-04    
ref|XP_006474787.1|  PREDICTED: vacuolar cation/proton exchanger ...  52.0    3e-04    
ref|NP_010155.1|  Vcx1p                                               52.0    3e-04    
ref|XP_010112892.1|  Vacuolar cation/proton exchanger 5               52.4    3e-04    
gb|EDV08397.1|  hypothetical protein SCRG_00622                       52.0    3e-04    
dbj|GAA22120.1|  K7_Vcx1p                                             52.0    3e-04    
ref|XP_009154535.1|  Ca2+:H+ antiporter                               52.0    4e-04    
ref|XP_003683224.1|  hypothetical protein TDEL_0H01540                51.6    4e-04    
gb|ABI63343.1|  putative calcium exchanger                            49.7    4e-04    
ref|XP_008796922.1|  PREDICTED: vacuolar cation/proton exchanger ...  51.6    4e-04    
pdb|4K1C|A  Chain A, Vcx1 Calcium/proton Exchanger                    51.6    4e-04    
ref|XP_007215349.1|  hypothetical protein PRUPE_ppa005414mg           51.6    5e-04    
gb|EWY88113.1|  Ca2+:H+ antiporter                                    51.6    5e-04    
gb|EWY88114.1|  Ca2+:H+ antiporter                                    51.6    5e-04    
gb|KDO74026.1|  hypothetical protein CISIN_1g012771mg                 51.6    5e-04    
emb|CAA04646.1|  manganese resistance 1 protein                       51.2    5e-04    
gb|KDO74027.1|  hypothetical protein CISIN_1g012771mg                 51.2    6e-04    
ref|XP_003854352.1|  putative H+/Ca2+ transporter                     51.6    6e-04    
gb|KDO74022.1|  hypothetical protein CISIN_1g012771mg                 51.2    6e-04    
emb|CAK41938.1|  unnamed protein product                              51.2    6e-04    
emb|CAA04645.1|  manganese resistance 1 protein                       51.2    6e-04    
ref|XP_006452726.1|  hypothetical protein CICLE_v10008243mg           51.2    6e-04    
ref|XP_007020355.1|  Cation exchanger 5, putative isoform 2           51.2    6e-04    
gb|EHN03401.1|  Vcx1p                                                 51.2    6e-04    
gb|EME45302.1|  hypothetical protein DOTSEDRAFT_71118                 50.8    7e-04    
ref|XP_009391187.1|  PREDICTED: vacuolar cation/proton exchanger ...  51.2    7e-04    
gb|EMF11444.1|  Na_Ca_ex-domain-containing protein                    51.6    7e-04    
ref|XP_003351653.1|  hypothetical protein SMAC_00194                  51.2    7e-04    
gb|KGO65648.1|  Sodium/calcium exchanger membrane region              51.2    8e-04    
ref|XP_002524559.1|  Vacuolar cation/proton exchanger, putative       50.8    9e-04    
ref|XP_008463979.1|  PREDICTED: vacuolar cation/proton exchanger ...  50.8    9e-04    
ref|XP_007020354.1|  Cation exchanger 5, putative isoform 1           50.8    9e-04    
ref|XP_009383596.1|  PREDICTED: vacuolar cation/proton exchanger ...  50.8    0.001    
gb|KGO77411.1|  Sodium/calcium exchanger membrane region              50.8    0.001    



>emb|CDP05978.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   401 bits (1031),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 199/248 (80%), Positives = 221/248 (89%), Gaps = 5/248 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV---PVTLKHLED  724
            +EINLDENDAV+K+MKDFDTS +  I  DEF  G+ +WLDE + SR     P T+K+LED
Sbjct  242  EEINLDENDAVEKVMKDFDTSRDSLISFDEFSYGISRWLDEAKGSRASQAGPGTMKYLED  301

Query  723  FHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNF  544
            FHEQT+REHYLLG  +Q++E  EGV+NP+ T+IKAVL LLLGT IAA FADPLVDAVDNF
Sbjct  302  FHEQTKREHYLLG--EQSDEIVEGVDNPRRTTIKAVLLLLLGTVIAAVFADPLVDAVDNF  359

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  364
            S+ATSIP+FFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS
Sbjct  360  SSATSIPSFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  419

Query  363  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  184
            VFLALVYARGLTWDFSSEVLVILIVCIVMG+FGS+R+TFPLWTS IAF LYP S+ALVYV
Sbjct  420  VFLALVYARGLTWDFSSEVLVILIVCIVMGIFGSLRTTFPLWTSLIAFLLYPFSLALVYV  479

Query  183  LDYVFGWS  160
            LDYVFGWS
Sbjct  480  LDYVFGWS  487



>gb|EPS64918.1| sodium/calcium exchanger family protein, partial [Genlisea aurea]
Length=519

 Score =   385 bits (988),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 216/249 (87%), Gaps = 6/249 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV----TLKHLE  727
            DEINLDE DA++K+MKDFD S +  ID++EFV+GV KWL E +     P     T+K+L+
Sbjct  273  DEINLDEEDALEKVMKDFDVSLDSRIDLNEFVSGVGKWLGEARGGTAAPAARTGTMKYLD  332

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            DFH QTRREH LLG  DQ++E  EGVENP+  SIKAVL LLLGTAIAAAFADPLVDAVDN
Sbjct  333  DFHIQTRREHDLLG--DQSDEVVEGVENPRSNSIKAVLLLLLGTAIAAAFADPLVDAVDN  390

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS ATSIPTFFISF+ALPLATNSSEAVSA+IFA+RKKLRSASLTFSELYGAVTMNNVLCL
Sbjct  391  FSAATSIPTFFISFVALPLATNSSEAVSAVIFATRKKLRSASLTFSELYGAVTMNNVLCL  450

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            SVFLA+VY RGL WDFSSEVLVIL+VC+VMGVF S+R+TFPLWTS +AF+LYP+S+ALVY
Sbjct  451  SVFLAIVYVRGLVWDFSSEVLVILMVCVVMGVFASVRTTFPLWTSLLAFALYPVSLALVY  510

Query  186  VLDYVFGWS  160
            VLDY FGWS
Sbjct  511  VLDYQFGWS  519



>ref|XP_011082732.1| PREDICTED: uncharacterized protein LOC105165426 [Sesamum indicum]
Length=567

 Score =   381 bits (979),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 186/245 (76%), Positives = 211/245 (86%), Gaps = 2/245 (1%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHE  715
            +EINLD  DAV+K+MKDFD S +  +D+ EF+ GV +WL E +   N   ++K+++DFH 
Sbjct  325  NEINLDREDAVEKVMKDFDISLDSRVDLREFIHGVGRWLQEARAVSNYAGSMKYIDDFHM  384

Query  714  QTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTA  535
            QT+R+H LLG  DQ++E  EG ENP+W SIKAVL LLLGTAIAAAFADPLVDAVDNFS A
Sbjct  385  QTKRDHDLLG--DQSDEIVEGFENPRWNSIKAVLLLLLGTAIAAAFADPLVDAVDNFSDA  442

Query  534  TSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFL  355
            T IPTFFISFIALPLATNSSEAVSAIIFA+RKKLRSASLTFSELYGAVTMNN LCLSVFL
Sbjct  443  TKIPTFFISFIALPLATNSSEAVSAIIFATRKKLRSASLTFSELYGAVTMNNALCLSVFL  502

Query  354  ALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDY  175
            ALVY RGL WDFSSEVLVILIVCIVMGVF S+R+TFPLWT+F+AF LYP S+ALVYVLDY
Sbjct  503  ALVYVRGLVWDFSSEVLVILIVCIVMGVFASIRTTFPLWTAFLAFLLYPFSLALVYVLDY  562

Query  174  VFGWS  160
            VFGWS
Sbjct  563  VFGWS  567



>ref|XP_006451747.1| hypothetical protein CICLE_v10007809mg [Citrus clementina]
 ref|XP_006494847.1| PREDICTED: uncharacterized protein LOC102612450 [Citrus sinensis]
 gb|ESR64987.1| hypothetical protein CICLE_v10007809mg [Citrus clementina]
 gb|KDO58493.1| hypothetical protein CISIN_1g048038mg [Citrus sinensis]
Length=591

 Score =   379 bits (974),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 184/250 (74%), Positives = 213/250 (85%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            +EI+LD++DAV K++ DFDTSN+  IDI EF+ G++KWL+E   +R       P T+K L
Sbjct  342  EEIDLDQDDAVSKVLSDFDTSNDSHIDIKEFINGIEKWLNEAMQARTGSADPGPHTMKFL  401

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            +DFH QT+REH LLGA ++++E  EGVENPKW S KAVL LL+GT IAAAFADPLVDAVD
Sbjct  402  DDFHLQTKREHALLGAEEESDEVAEGVENPKWVSFKAVLMLLIGTIIAAAFADPLVDAVD  461

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIP+FFISFIALP ATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LC
Sbjct  462  NFSAATSIPSFFISFIALPFATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILC  521

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVYARGLTWDFSSEVLVILIVC+VMG F S R+ FPLWT  IA++LYP S+ALV
Sbjct  522  LSVFLALVYARGLTWDFSSEVLVILIVCLVMGAFASFRTNFPLWTCSIAYALYPFSLALV  581

Query  189  YVLDYVFGWS  160
            YVLDY FGWS
Sbjct  582  YVLDYFFGWS  591



>ref|XP_004244257.1| PREDICTED: uncharacterized protein LOC101263533 [Solanum lycopersicum]
Length=589

 Score =   373 bits (958),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/251 (73%), Positives = 216/251 (86%), Gaps = 6/251 (2%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKH  733
            L+EINLDENDA+ K+MKDFDTS ++++D+ EF+ GV+KWL E + +        P T+ +
Sbjct  340  LEEINLDENDAIAKVMKDFDTSLDEQVDLHEFITGVEKWLYEAKSTNGSSAQAGPNTINY  399

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            ++DFHE+TRREH LLG  DQ++E  EGVENP+  +IKA   LLLGT IAA FADPLVDAV
Sbjct  400  IDDFHEETRREHSLLGE-DQSDEIVEGVENPRKVAIKAASLLLLGTIIAAVFADPLVDAV  458

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            +NFS+ATSIP+FFISFIALPLATNSSEAVSAIIFA+RKK RSASLTFSELYGAVTMNN+L
Sbjct  459  NNFSSATSIPSFFISFIALPLATNSSEAVSAIIFATRKKQRSASLTFSELYGAVTMNNLL  518

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLA+VYARGLTW+FSSEVLVILIVCIV+GV GS+R+TFPLWTS IAF+ YP S+ L
Sbjct  519  CLSVFLAIVYARGLTWNFSSEVLVILIVCIVIGVLGSIRTTFPLWTSLIAFAFYPFSLVL  578

Query  192  VYVLDYVFGWS  160
            VYVLDYVFGWS
Sbjct  579  VYVLDYVFGWS  589



>ref|XP_010098421.1| hypothetical protein L484_012136 [Morus notabilis]
 gb|EXB75012.1| hypothetical protein L484_012136 [Morus notabilis]
Length=578

 Score =   372 bits (955),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/249 (76%), Positives = 219/249 (88%), Gaps = 4/249 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV----PVTLKHLE  727
            DEI+LD++DAV+KLM+DFDT+++ +ID  EFVAG+ KWL+E + + N       T+K L 
Sbjct  330  DEIDLDKDDAVEKLMRDFDTTSDSQIDGPEFVAGITKWLNEAKRAGNSYNGHGGTMKFLG  389

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            DFH +T++EH LLGAGDQ+EEA EGV N KWTS+KA L LL+G AIAAAFADPLVDAVDN
Sbjct  390  DFHARTKQEHDLLGAGDQSEEATEGVANAKWTSLKAALMLLVGAAIAAAFADPLVDAVDN  449

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS+ATSIPTFFISFIALPLATNSSEAVSAIIFA+RKK R++SLTFSE+YGAVTMNNVLCL
Sbjct  450  FSSATSIPTFFISFIALPLATNSSEAVSAIIFATRKKKRTSSLTFSEIYGAVTMNNVLCL  509

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            SVFLALVYARGLTWDFSSEVLVILIVCIVMG+FGS R+TFPLWTS +AF LYP S+ALVY
Sbjct  510  SVFLALVYARGLTWDFSSEVLVILIVCIVMGLFGSFRTTFPLWTSSVAFLLYPFSLALVY  569

Query  186  VLDYVFGWS  160
            VLDY FGWS
Sbjct  570  VLDYFFGWS  578



>ref|XP_009340381.1| PREDICTED: uncharacterized protein LOC103932481 [Pyrus x bretschneideri]
Length=585

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/250 (73%), Positives = 206/250 (82%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            DEI  D NDAV KLM DFDTS++ +I   EF AG+ KWL+E +   +        T+K L
Sbjct  336  DEIQFDNNDAVAKLMSDFDTSHDSQISFTEFYAGISKWLNEAKRHGDTSTDSGNHTMKFL  395

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFH+QT+ EH LLGA  Q++E  EGVE+ KWTSIKA L LL+GT IAAAFADPLVDAVD
Sbjct  396  TDFHKQTKEEHALLGANGQSDEVVEGVESVKWTSIKAGLMLLVGTLIAAAFADPLVDAVD  455

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            +FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LC
Sbjct  456  DFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKMRTASLTFSELYGAVTMNNLLC  515

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+VFLALVY RGLTWDFS+EVLVILIVCIVMG+ GS R+ FPLWTS IAF LYP S+ALV
Sbjct  516  LAVFLALVYIRGLTWDFSAEVLVILIVCIVMGLLGSFRTVFPLWTSSIAFLLYPFSLALV  575

Query  189  YVLDYVFGWS  160
            YVLDYV GWS
Sbjct  576  YVLDYVVGWS  585



>ref|XP_009593456.1| PREDICTED: uncharacterized protein LOC104090114 [Nicotiana tomentosiformis]
Length=564

 Score =   362 bits (930),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 190/251 (76%), Positives = 216/251 (86%), Gaps = 7/251 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKH  733
            L+EINL+ENDAV+KLMKDFDTS++Q I+  EF+AGV KWL+E + S+       P T+K+
Sbjct  316  LEEINLNENDAVEKLMKDFDTSHDQRIEKSEFIAGVAKWLNEARGSKAPSIEAGPDTMKY  375

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            L D HE+ RREH+ LG  DQN+E+ E VENP+  +IKAVL LLLGT IAA FADPLVDAV
Sbjct  376  LADMHEEARREHHFLG--DQNDESVEAVENPRSIAIKAVLLLLLGTVIAAVFADPLVDAV  433

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            +NFS+AT IP+FFISFI LP ATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN+L
Sbjct  434  NNFSSATGIPSFFISFIVLPFATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNLL  493

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLALVYARGLTWDFSSEVLVILIVC+VMGVF S+RSTFPLWTS +AF LYPLS+ L
Sbjct  494  CLSVFLALVYARGLTWDFSSEVLVILIVCVVMGVFASVRSTFPLWTSLVAFLLYPLSLVL  553

Query  192  VYVLDYVFGWS  160
            VYVLDY FGWS
Sbjct  554  VYVLDYKFGWS  564



>ref|XP_007021648.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
 gb|EOY13173.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
Length=578

 Score =   363 bits (931),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 207/250 (83%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            +EI+LD +DAV K+M DFDTS++  +   EFV G+ KW+ E + +    +     T K +
Sbjct  329  EEIDLDRDDAVRKVMADFDTSHDSLVQEGEFVRGIQKWIIEAKRTGGTYLESNNGTFKFI  388

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH+QT+REH LLG  +Q++E  EGVENP WTS+KAVL LLLGT IAAAFADPLVDAVD
Sbjct  389  DHFHQQTKREHDLLGLEEQSDEVAEGVENPGWTSLKAVLMLLLGTLIAAAFADPLVDAVD  448

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIP+FFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNNVLC
Sbjct  449  NFSDATSIPSFFISFIALPLATNSSEAVSAIIFASRKKKRTASLTFSELYGAVTMNNVLC  508

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGLTWDFSSEVLVILIVCIVMG F S R+TFPLWT  +A+ LYP S+ALV
Sbjct  509  LSVFLALVYVRGLTWDFSSEVLVILIVCIVMGAFASFRTTFPLWTCSVAYLLYPFSLALV  568

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  569  YVLDYVFGWS  578



>ref|XP_007213956.1| hypothetical protein PRUPE_ppa004823mg [Prunus persica]
 gb|EMJ15155.1| hypothetical protein PRUPE_ppa004823mg [Prunus persica]
Length=490

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/250 (71%), Positives = 208/250 (83%), Gaps = 6/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ-----VSRNVPVTLKHL  730
            DEI LD +DAVDK+MK+FDTS +  ID+ EF+ G+ KW+ E +      S N P T+K L
Sbjct  242  DEIQLDRDDAVDKVMKEFDTSCDSRIDLQEFLTGISKWIHEAKRSGDDSSNNDPHTMKFL  301

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFH +T++EH LLGAG Q++E  EGVE+PKWT+ KA L LL+GT IAAAFADPL+D VD
Sbjct  302  FDFHSRTKQEHDLLGAGGQSDEIIEGVESPKWTTFKAGLMLLVGTLIAAAFADPLIDVVD  361

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS+ATSIPTFFISF+ALPLAT S EAVSAI+FASRKK+R+ASLTFS+LYG+ TMNNVLC
Sbjct  362  NFSSATSIPTFFISFVALPLAT-SCEAVSAIMFASRKKIRTASLTFSQLYGSATMNNVLC  420

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGL WDFS+EVLVILIVCIVMGVF S R+ FPLWTS IAF LYP S+AL+
Sbjct  421  LSVFLALVYFRGLEWDFSAEVLVILIVCIVMGVFSSFRTVFPLWTSSIAFLLYPFSVALI  480

Query  189  YVLDYVFGWS  160
            YVLDYV+GWS
Sbjct  481  YVLDYVYGWS  490



>ref|XP_008386231.1| PREDICTED: uncharacterized protein LOC103448741 [Malus domestica]
Length=584

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/250 (73%), Positives = 204/250 (82%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            DEI  D +DAV KLM DFDTS + +I   EF AG+ KWL+E +   +        T+K L
Sbjct  335  DEIQFDNDDAVAKLMTDFDTSCDSQISFTEFCAGISKWLNEAKRHGDTSTDSGNHTMKFL  394

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFHE+T+ EH LLGA  Q++E DEGVEN K TSIKA L LL GT IAAAFADPLVDAVD
Sbjct  395  TDFHERTKEEHALLGANGQSDEVDEGVENVKRTSIKAGLMLLGGTLIAAAFADPLVDAVD  454

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            +FS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LC
Sbjct  455  DFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNLLC  514

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+VFLALVY RGLTWDFS+EVLVILIVCIVMG+ GS R+ FPLWTS IAF LYP S+ALV
Sbjct  515  LAVFLALVYVRGLTWDFSAEVLVILIVCIVMGLLGSFRTVFPLWTSSIAFLLYPFSLALV  574

Query  189  YVLDYVFGWS  160
            YVLDYV GWS
Sbjct  575  YVLDYVLGWS  584



>ref|XP_002522155.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF40234.1| calcium ion binding protein, putative [Ricinus communis]
Length=543

 Score =   361 bits (926),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 185/253 (73%), Positives = 206/253 (81%), Gaps = 8/253 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV----PVTLKHLE  727
            +EI+ D++DA  K+MKDFDTS +  ID++EF  G+ KWL+E + S  V      T K L+
Sbjct  291  EEIDFDKDDAAGKVMKDFDTSRDNSIDLEEFENGISKWLEEAKRSGAVFTDGSRTSKFLD  350

Query  726  DFHEQTRREHYLLGAG----DQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
            DFH  T+REH LLG      DQ++E  EGVENP+W S KAVL LLLGT IAA FADPLVD
Sbjct  351  DFHFLTKREHTLLGPEERIEDQSDEVVEGVENPRWISFKAVLMLLLGTIIAAVFADPLVD  410

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
            AVDNFS ATSIPTFFISFIALPLATNSSEAVSAIIFASRK LR+ASLTFSELYGAVTMNN
Sbjct  411  AVDNFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKTLRTASLTFSELYGAVTMNN  470

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
            +LCLSVFLALVY RGLTWDFSSEVLVI IVCIVMG F S R+TFPLWTS IA+ LYP S+
Sbjct  471  LLCLSVFLALVYCRGLTWDFSSEVLVIFIVCIVMGAFASFRTTFPLWTSSIAYFLYPFSL  530

Query  198  ALVYVLDYVFGWS  160
            ALVYVLDYVFGWS
Sbjct  531  ALVYVLDYVFGWS  543



>gb|KHG29939.1| Vacuolar calcium ion transporter [Gossypium arboreum]
Length=578

 Score =   362 bits (928),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/250 (72%), Positives = 208/250 (83%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            +EI+ D++DAV K+M DFDTS +  I  +EFV G+ KW++E + +    +     T K +
Sbjct  329  EEIDFDKDDAVMKVMADFDTSLDSYIQKEEFVRGITKWINEAKQTGGAYLEPNAGTFKFI  388

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH+QT+REH LLG+ +Q++E  E VENP+W S KAVL LLLGT IAAAFADPLVDAVD
Sbjct  389  DQFHQQTKREHALLGSEEQSDEVVEHVENPRWISFKAVLMLLLGTLIAAAFADPLVDAVD  448

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFSTATSIP+FFISFIALPLATNSSEAVSAIIFA+RKK R+ASLTFSELYGAVTMNNVLC
Sbjct  449  NFSTATSIPSFFISFIALPLATNSSEAVSAIIFATRKKQRTASLTFSELYGAVTMNNVLC  508

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGLTWDFSSEVLVILIVCIVMG F S R+TFPLWT  IA+ LYP S+ALV
Sbjct  509  LSVFLALVYVRGLTWDFSSEVLVILIVCIVMGAFASFRTTFPLWTCSIAYILYPFSLALV  568

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  569  YVLDYVFGWS  578



>ref|XP_007149412.1| hypothetical protein PHAVU_005G068100g [Phaseolus vulgaris]
 gb|ESW21406.1| hypothetical protein PHAVU_005G068100g [Phaseolus vulgaris]
Length=576

 Score =   361 bits (927),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 205/250 (82%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            +EI+LD +DAV ++M DFDTS N  +D +EFV GV +WL   Q +R       P T+K L
Sbjct  327  EEIDLDHDDAVTRIMNDFDTSGNALVDEEEFVNGVCRWLQRAQRARVASGDAGPHTMKFL  386

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFH +T+REH LL  GDQ+ E  EG+EN KW SIKAVLFLLLG+ IAAAFADPLVDAVD
Sbjct  387  SDFHTETKREHDLLDVGDQSNEEVEGIENSKWISIKAVLFLLLGSIIAAAFADPLVDAVD  446

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIP FFISFI LPLATNSSEAVSAIIFASR K ++ASLTFSE+YGAVTMNNVLC
Sbjct  447  NFSEATSIPAFFISFIFLPLATNSSEAVSAIIFASRDKRQTASLTFSEIYGAVTMNNVLC  506

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVYARGLTWDFSSEVLVIL+VCI++GVF S R+ FPLWTS +A  LYP S+ALV
Sbjct  507  LSVFLALVYARGLTWDFSSEVLVILVVCILLGVFASFRTVFPLWTSILAILLYPFSLALV  566

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  567  YVLDYVFGWS  576



>ref|XP_009767335.1| PREDICTED: uncharacterized protein LOC104218515 [Nicotiana sylvestris]
Length=568

 Score =   360 bits (925),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 188/251 (75%), Positives = 216/251 (86%), Gaps = 7/251 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKH  733
            L+EINL+ENDAV+KLMKDFDTS++Q I++ EF+AGV KWL+E + S+       P T+K+
Sbjct  320  LEEINLNENDAVEKLMKDFDTSHDQRIEMSEFIAGVAKWLNEARGSKAPSVEAGPDTMKY  379

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            L D HE+ RREH+ LG  DQN+E+ E VENP+  +IKAVL LLLGT IAA FADPLVDAV
Sbjct  380  LADLHEEARREHHFLG--DQNDESVEAVENPRSIAIKAVLLLLLGTVIAAVFADPLVDAV  437

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            +NFS+ATSIP+FFISFI LP ATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN+L
Sbjct  438  NNFSSATSIPSFFISFIVLPFATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNLL  497

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLALVYARGLTWDFSSEVLVILIVC+VMG+F S+RSTFPLWTS +AF LYP S+ L
Sbjct  498  CLSVFLALVYARGLTWDFSSEVLVILIVCVVMGIFASVRSTFPLWTSLLAFLLYPFSLVL  557

Query  192  VYVLDYVFGWS  160
            VYVLDY  GWS
Sbjct  558  VYVLDYKIGWS  568



>ref|XP_011098256.1| PREDICTED: uncharacterized protein LOC105176958 isoform X2 [Sesamum 
indicum]
Length=569

 Score =   360 bits (925),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 188/246 (76%), Positives = 214/246 (87%), Gaps = 4/246 (2%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR--NVPVTLKHLEDFH  718
            E NLDE+DAV KLMKD D+S +  +D+ EF++ V +WL+E + ++  N   ++K ++DFH
Sbjct  326  ESNLDEDDAVVKLMKDLDSSRDSRVDLHEFISTVARWLEEAKGAKTSNHTGSMKFIDDFH  385

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFST  538
            EQTRREH LLG  DQ +EA EGV+NP+WTS+KAVL LLLGT IAA FADPLVDAVDNFST
Sbjct  386  EQTRREHDLLG--DQGDEAAEGVDNPRWTSVKAVLLLLLGTVIAAVFADPLVDAVDNFST  443

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  358
            ATSIP+FFISFI LPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF
Sbjct  444  ATSIPSFFISFIVLPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  503

Query  357  LALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLD  178
            LALVY RGL WDFSSEVLVILIVC+VMGVF S+R+TFPLWTS +AF LYP S+ALVYVLD
Sbjct  504  LALVYVRGLVWDFSSEVLVILIVCVVMGVFASIRTTFPLWTSLLAFLLYPFSLALVYVLD  563

Query  177  YVFGWS  160
            YVFGWS
Sbjct  564  YVFGWS  569



>ref|XP_009604315.1| PREDICTED: uncharacterized protein LOC104099119 [Nicotiana tomentosiformis]
Length=574

 Score =   360 bits (924),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 183/251 (73%), Positives = 215/251 (86%), Gaps = 7/251 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKH  733
            L+EINLDENDA+ K++KDFDTS+++++D+ EF+AGV+KWL E + S        P T+K+
Sbjct  326  LEEINLDENDAIAKVLKDFDTSSDEKLDLKEFIAGVEKWLYEARSSNGSSREAGPDTMKY  385

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            L+DFHEQTR EH LLG  D ++E  EGVENP+  +IKA L LLLGT IAA FADPLVDAV
Sbjct  386  LDDFHEQTRMEHSLLG--DTSDEIVEGVENPRKVAIKAALLLLLGTIIAAVFADPLVDAV  443

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            +NFS+ATSIPTFFISFIALPLATNSSEAVSAIIFASRK  +SASLTFSELYGAVTMNN+L
Sbjct  444  NNFSSATSIPTFFISFIALPLATNSSEAVSAIIFASRKNKKSASLTFSELYGAVTMNNLL  503

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLA+VY RGLTW+FSSEVLVILIVC++MGV GS+ +TFPLWT  IAF LYP+S+ L
Sbjct  504  CLSVFLAIVYIRGLTWNFSSEVLVILIVCVIMGVLGSIHTTFPLWTCSIAFLLYPMSLVL  563

Query  192  VYVLDYVFGWS  160
            VYVLDYVFGWS
Sbjct  564  VYVLDYVFGWS  574



>ref|XP_007212014.1| hypothetical protein PRUPE_ppa004833mg [Prunus persica]
 gb|EMJ13213.1| hypothetical protein PRUPE_ppa004833mg [Prunus persica]
Length=489

 Score =   357 bits (917),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 185/250 (74%), Positives = 211/250 (84%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            DEI LD+NDAV+K+MKDFDTS++  I +DEF  GV KWL E + + N        T+K L
Sbjct  240  DEIELDKNDAVNKVMKDFDTSHDSRISVDEFWVGVSKWLKEAKRAGNANSDPGHRTMKFL  299

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFH +T+ EH LLGAGDQ++E  EG ENPKWTS+KA L LL+GT IAAAFADPLVDAVD
Sbjct  300  SDFHSRTKEEHALLGAGDQSDEVVEGAENPKWTSLKAGLMLLVGTLIAAAFADPLVDAVD  359

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LC
Sbjct  360  NFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNILC  419

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGL+WDFS+EVLVILIVC+VMG+ GS+R+ +PLWT  IAF LYP S+ALV
Sbjct  420  LSVFLALVYIRGLSWDFSAEVLVILIVCVVMGILGSLRTNYPLWTCSIAFLLYPFSLALV  479

Query  189  YVLDYVFGWS  160
            YVLDYV GWS
Sbjct  480  YVLDYVLGWS  489



>gb|KJB45756.1| hypothetical protein B456_007G325800 [Gossypium raimondii]
Length=578

 Score =   360 bits (924),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 179/250 (72%), Positives = 208/250 (83%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            +EI+ D++DAV K+M DFDTS +  I  +EFV G+ KW++E + +    +     T K +
Sbjct  329  EEIDFDKDDAVMKVMADFDTSLDSYIQEEEFVKGITKWINEAKQTGGAYLEPNAGTFKFI  388

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH+QT+REH LLG+ +Q++E  E VENP+W S KAVL LL+GT IAAAFADPLVDAVD
Sbjct  389  DQFHQQTKREHALLGSEEQSDEVVEHVENPRWISFKAVLMLLVGTLIAAAFADPLVDAVD  448

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFSTATSIP+FFISFIALPLATNSSEAVSAIIFA+RKK R+ASLTFSELYGAVTMNNVLC
Sbjct  449  NFSTATSIPSFFISFIALPLATNSSEAVSAIIFATRKKQRTASLTFSELYGAVTMNNVLC  508

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGLTWDFSSEVLVILIVCIVMG F S R+TFPLWT  IA+ LYP S+ALV
Sbjct  509  LSVFLALVYVRGLTWDFSSEVLVILIVCIVMGAFASFRTTFPLWTCSIAYILYPFSLALV  568

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  569  YVLDYVFGWS  578



>ref|XP_010279178.1| PREDICTED: uncharacterized protein LOC104613162 [Nelumbo nucifera]
Length=577

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 179/251 (71%), Positives = 212/251 (84%), Gaps = 7/251 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRN-VPV----TLKH  733
            L+EI+L+ +DA +KLMKDFD SN+  ++ +EFV G+ KWL E + S + VP     TL++
Sbjct  329  LEEIDLNRDDAAEKLMKDFDQSNDNLLNEEEFVEGIKKWLYEAKRSTDYVPFSGSHTLRY  388

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            ++ FH+Q R+EH LLG  D +++  EGVENPKWTSIKAVL LLLGTAIAAAFADPLVDAV
Sbjct  389  IDGFHKQARQEHILLG--DASDDVIEGVENPKWTSIKAVLMLLLGTAIAAAFADPLVDAV  446

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
             NFS+ATSIP+FFISFIALPLATNSSEAVSA+IFASRKK ++ASLTFSE+YGA TMNN+L
Sbjct  447  QNFSSATSIPSFFISFIALPLATNSSEAVSALIFASRKKKKTASLTFSEIYGAATMNNIL  506

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLALVY R LTWDFS+EVLVILIVCIVMG+F S R+TFPLWT  +AF LYP S+ L
Sbjct  507  CLSVFLALVYVRHLTWDFSAEVLVILIVCIVMGLFASFRTTFPLWTCSVAFVLYPFSLVL  566

Query  192  VYVLDYVFGWS  160
            VYVLDYVFGWS
Sbjct  567  VYVLDYVFGWS  577



>gb|EYU44997.1| hypothetical protein MIMGU_mgv1a003664mg [Erythranthe guttata]
Length=571

 Score =   357 bits (917),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 186/248 (75%), Positives = 219/248 (88%), Gaps = 5/248 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR---NVPVTLKHLED  724
            +EIN+DE+DA+ K++KDFDTS + ++D++EFVAG+ KWL+E + +R   N   ++K+++D
Sbjct  326  NEINMDEDDALAKVIKDFDTSLDSQVDLNEFVAGIGKWLEEAKGARGGSNQAGSMKYIDD  385

Query  723  FHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNF  544
            +H+QT+REH LLG  +Q++E  EGVENP+ TSIKA L LLLGT IAAAFADPLVDAVDNF
Sbjct  386  YHKQTKREHELLG--EQSDEIVEGVENPRSTSIKAGLLLLLGTLIAAAFADPLVDAVDNF  443

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  364
            S ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+RSASLTFSELYGAVTMNN LCLS
Sbjct  444  SAATSIPTFFISFIALPLATNSSEAVSAIIFASRKKIRSASLTFSELYGAVTMNNALCLS  503

Query  363  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  184
            VFL LVY RGLTWDFSSEVLVILIVCIVMGVF S+R+TFPLWT+ +AF LYP S+ALVYV
Sbjct  504  VFLGLVYVRGLTWDFSSEVLVILIVCIVMGVFASVRTTFPLWTAILAFLLYPFSLALVYV  563

Query  183  LDYVFGWS  160
            LDYVFGWS
Sbjct  564  LDYVFGWS  571



>gb|KEH38643.1| calcium-binding EF-hand protein [Medicago truncatula]
Length=443

 Score =   353 bits (906),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 199/250 (80%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            +EI+LD +DAV K+M DFDTS NQ ID  EFV GV +WL   Q SR       P T+K L
Sbjct  194  EEIDLDHDDAVTKIMADFDTSRNQLIDEGEFVNGVCRWLLATQRSRVASGDAGPHTVKFL  253

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFH +T+REH LL  G Q++E  EGVEN +W SIKA LFLLLG+ IAAAFADPLVD VD
Sbjct  254  SDFHTETKREHDLLDVGGQSDEGAEGVENARWISIKAGLFLLLGSLIAAAFADPLVDVVD  313

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIP FFISFI LPLATNSSEAVSAIIFASR K ++ASLTFSE+YGAVTMNNVLC
Sbjct  314  NFSDATSIPAFFISFIFLPLATNSSEAVSAIIFASRDKRQTASLTFSEIYGAVTMNNVLC  373

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGLTWDFSSEVLVILIVCIVMG F S R+ FPLWTS  A  LYP S+ALV
Sbjct  374  LSVFLALVYVRGLTWDFSSEVLVILIVCIVMGAFASFRTVFPLWTSITAILLYPFSLALV  433

Query  189  YVLDYVFGWS  160
            YVLDY FGWS
Sbjct  434  YVLDYQFGWS  443



>ref|XP_006348283.1| PREDICTED: uncharacterized protein LOC102600810 [Solanum tuberosum]
Length=589

 Score =   358 bits (918),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 180/251 (72%), Positives = 215/251 (86%), Gaps = 6/251 (2%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKH  733
            L+EINL+E+DA+ K++KDFDTS + ++D+ EF+ GV+KWL E + S        P T+ +
Sbjct  340  LEEINLEEDDAIAKVLKDFDTSCDDQLDLQEFIDGVEKWLYEARSSNGSSAQAGPNTINY  399

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            ++DFHE+TRREH LLG  DQ++E  EGVENP+  +IKA L LLLGT IAA FADPLVDAV
Sbjct  400  IDDFHEETRREHSLLGE-DQSDELVEGVENPRKVAIKAALLLLLGTIIAAVFADPLVDAV  458

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            +NFS+ATSIP+FFISFIALPLATNSSEAVSAIIFA+RKK RSASLTFSELYGAVTMNN+L
Sbjct  459  NNFSSATSIPSFFISFIALPLATNSSEAVSAIIFATRKKKRSASLTFSELYGAVTMNNLL  518

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLA+VY+RGL W+FSSEVLVILIVCIVMG+ GS+R+TFPLWT  IAF+LYP S+ L
Sbjct  519  CLSVFLAIVYSRGLVWNFSSEVLVILIVCIVMGILGSIRTTFPLWTCLIAFALYPFSLVL  578

Query  192  VYVLDYVFGWS  160
            VYVLDYVFGWS
Sbjct  579  VYVLDYVFGWS  589



>ref|XP_008226455.1| PREDICTED: uncharacterized protein LOC103326029 [Prunus mume]
Length=592

 Score =   358 bits (919),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 177/250 (71%), Positives = 207/250 (83%), Gaps = 6/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ-----VSRNVPVTLKHL  730
            DEI LD +DAVDK+MK+FDTS +  ID+ EF+ G+ KW+ E +      S N P T+K L
Sbjct  344  DEIQLDRDDAVDKVMKEFDTSCDSRIDLQEFLTGISKWIHEAKRSGDDSSNNDPHTMKFL  403

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFH +T++EH LLGAG Q++E  E VE+PKWT+ KAVL LL+GT IAAAFADPL+D VD
Sbjct  404  FDFHSRTKQEHDLLGAGGQSDEIIEAVESPKWTTFKAVLMLLVGTLIAAAFADPLIDVVD  463

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIPTFFISF+ALPLAT S EAVSAI+FASRKK+R+ASLTFS+LYG+ TMNNVLC
Sbjct  464  NFSNATSIPTFFISFVALPLAT-SCEAVSAIMFASRKKIRTASLTFSQLYGSATMNNVLC  522

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGL WDFS+EVLVILIVCIVMGVF S R+ FPLWTS IAF LYP S+AL+
Sbjct  523  LSVFLALVYFRGLEWDFSAEVLVILIVCIVMGVFSSFRTVFPLWTSSIAFLLYPFSVALI  582

Query  189  YVLDYVFGWS  160
            YVLDYV+GWS
Sbjct  583  YVLDYVYGWS  592



>ref|XP_008226453.1| PREDICTED: uncharacterized protein LOC103326027 [Prunus mume]
 ref|XP_008226454.1| PREDICTED: uncharacterized protein LOC103326027 [Prunus mume]
Length=579

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 183/250 (73%), Positives = 212/250 (85%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            DEI LD+NDAVDK+MKDFDTS++ +I +DEFV GV KWL++ + + N         +K L
Sbjct  330  DEIELDKNDAVDKVMKDFDTSHDSKISVDEFVVGVSKWLNQAKRAGNANSDPGHRKMKFL  389

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFH +T+ EH LLGAGDQ++E  EG E PKWTS+KA L LL+GT IAAAFADPLVDAVD
Sbjct  390  SDFHSRTKEEHALLGAGDQSDEVVEGAEKPKWTSLKAGLMLLVGTLIAAAFADPLVDAVD  449

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIPTFFISFIALPLATNSSE+VSAIIFASRKK+R+ASLTFSELYGAVTMNN+LC
Sbjct  450  NFSDATSIPTFFISFIALPLATNSSESVSAIIFASRKKIRTASLTFSELYGAVTMNNILC  509

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGL+WDFS+EVLVILIVC+VMG+ GS+R+ +PLWT  IAF LYP S+ALV
Sbjct  510  LSVFLALVYIRGLSWDFSAEVLVILIVCVVMGILGSLRTNYPLWTCSIAFLLYPFSLALV  569

Query  189  YVLDYVFGWS  160
            YVLDYV GWS
Sbjct  570  YVLDYVLGWS  579



>ref|XP_004251882.1| PREDICTED: uncharacterized protein LOC101257045 [Solanum lycopersicum]
Length=578

 Score =   356 bits (913),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 190/251 (76%), Positives = 218/251 (87%), Gaps = 7/251 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKH  733
            L+EINL ENDAV+KLMKDFDTS++ ++++ EF+AGV KWL E + S        P T+K+
Sbjct  330  LEEINLHENDAVEKLMKDFDTSHDHQVEMSEFIAGVTKWLTEARGSEAPSPEAGPDTMKY  389

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            L+D HEQTRREH+ LG  DQ++E+ E VENP+ T+IKAVL LLLGT IAA FADPLVDAV
Sbjct  390  LDDLHEQTRREHHFLG--DQSDESVETVENPRSTAIKAVLLLLLGTVIAAVFADPLVDAV  447

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            +NFS+ATSIP+FFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN+L
Sbjct  448  NNFSSATSIPSFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNLL  507

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLALVY RGLTWDFSSEVLVILIVC+V+GVF S+RSTFPLWTS +AF LYP S+ L
Sbjct  508  CLSVFLALVYIRGLTWDFSSEVLVILIVCVVVGVFASVRSTFPLWTSLLAFLLYPFSLVL  567

Query  192  VYVLDYVFGWS  160
            VYVLDY FGWS
Sbjct  568  VYVLDYKFGWS  578



>ref|XP_006358955.1| PREDICTED: uncharacterized protein LOC102579474 [Solanum tuberosum]
Length=577

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 190/251 (76%), Positives = 216/251 (86%), Gaps = 7/251 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKH  733
            L+EINL ENDA++KLMKDFDTS++  I++ EF+AGV KWL E + S        P T+K+
Sbjct  329  LEEINLHENDAIEKLMKDFDTSHDHRIEMSEFIAGVTKWLTEARGSEASSPEAGPDTMKY  388

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            L+D HEQTRREH+ LG  DQ++E+ E VENP+ T IKAVL LLLGT IAA FADPLVDAV
Sbjct  389  LDDLHEQTRREHHFLG--DQSDESVETVENPRSTVIKAVLLLLLGTVIAAVFADPLVDAV  446

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            +NFS+ATSIP+FFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN+L
Sbjct  447  NNFSSATSIPSFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNLL  506

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLALVY RGLTWDFSSEVLVILIVC+V+GVF S+RSTFPLWTS +AF LYP S+ L
Sbjct  507  CLSVFLALVYIRGLTWDFSSEVLVILIVCVVVGVFASVRSTFPLWTSLLAFLLYPFSLVL  566

Query  192  VYVLDYVFGWS  160
            VYVLDY FGWS
Sbjct  567  VYVLDYKFGWS  577



>ref|XP_009348414.1| PREDICTED: uncharacterized protein LOC103940068 [Pyrus x bretschneideri]
 ref|XP_009348417.1| PREDICTED: uncharacterized protein LOC103940071 [Pyrus x bretschneideri]
Length=549

 Score =   352 bits (902),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 185/250 (74%), Positives = 211/250 (84%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            DEI LD N+AV+K+M DFDTS +  I  DEF  G+ KWL+E +   ++       T+K L
Sbjct  300  DEIQLDNNEAVEKVMIDFDTSRDSHISSDEFFIGISKWLNEAKRQGDISTDPSNRTMKFL  359

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFH++T+ EH LLGA DQ++E  EGVEN KWTSIKA L LL+GT IAAAFADPLVDAVD
Sbjct  360  TDFHKRTKEEHALLGADDQSDEVVEGVENVKWTSIKAGLMLLVGTLIAAAFADPLVDAVD  419

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LC
Sbjct  420  NFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNLLC  479

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+VFLALVYARGLTWDFSSEVLVILIVC+VMG+ GS+R+ FPLWTS IA+ LYP S+ALV
Sbjct  480  LAVFLALVYARGLTWDFSSEVLVILIVCVVMGLLGSLRTVFPLWTSSIAYLLYPFSLALV  539

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  540  YVLDYVFGWS  549



>gb|EPS57671.1| hypothetical protein M569_17145, partial [Genlisea aurea]
Length=448

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/250 (67%), Positives = 207/250 (83%), Gaps = 4/250 (2%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            L+ +NLD ++AV K+++DFD+S +  +D+DEFVAGV KWL E +       ++ ++++ H
Sbjct  199  LELVNLDYDEAVSKVLQDFDSSRDNRVDLDEFVAGVGKWLHEARGRGIAADSMAYIDEHH  258

Query  717  EQTRREHYLL----GAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            ++TR +H LL    GA  +++EA + +EN +W +IKA +FL+LGTAIAAAFADPLVDAVD
Sbjct  259  KKTRAQHDLLQGGGGAEQEDDEAAQDIENRRWVTIKAAIFLVLGTAIAAAFADPLVDAVD  318

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS+AT IPTFFISF+ALPLATNSSEAVSAIIFASRKK+RSASLTFSELYGA TMNNVLC
Sbjct  319  NFSSATKIPTFFISFVALPLATNSSEAVSAIIFASRKKMRSASLTFSELYGAATMNNVLC  378

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGL W+FSSEVLVILIVCI +GVFGS R+TFPLW+  +AF LYP S+ LV
Sbjct  379  LSVFLALVYVRGLNWNFSSEVLVILIVCIAIGVFGSFRTTFPLWSCSVAFFLYPFSLGLV  438

Query  189  YVLDYVFGWS  160
            Y+LDY FGWS
Sbjct  439  YLLDYHFGWS  448



>gb|KCW67438.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=345

 Score =   342 bits (878),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 203/249 (82%), Gaps = 5/249 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS----RNVPVTLKHLE  727
            +EI+L+E+ AVD++MKDFD+SN+  +++ EF+ G+ KW+   + S    +N   T K L+
Sbjct  98   EEIDLNEDGAVDRIMKDFDSSNDCLLELPEFLDGISKWVSRARSSASGIKNFG-TGKFLD  156

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            D H QT +EH  L +GDQ +E  EGV NPK T++KAVL L+LGT IA AFADPLVDAVDN
Sbjct  157  DAHHQTTQEHAQLKSGDQTDEVTEGVGNPKLTTLKAVLLLVLGTIIAGAFADPLVDAVDN  216

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNN+LCL
Sbjct  217  FSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNLLCL  276

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            SVFLA+VY RGLTWDFSSEVLVILIVC VMG F S R+TFPLWT  +A  LYP S+ALVY
Sbjct  277  SVFLAIVYIRGLTWDFSSEVLVILIVCFVMGTFASFRTTFPLWTFSLALLLYPFSLALVY  336

Query  186  VLDYVFGWS  160
            VLDY+FGWS
Sbjct  337  VLDYIFGWS  345



>gb|KCW67437.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=429

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 203/249 (82%), Gaps = 5/249 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS----RNVPVTLKHLE  727
            +EI+L+E+ AVD++MKDFD+SN+  +++ EF+ G+ KW+   + S    +N   T K L+
Sbjct  182  EEIDLNEDGAVDRIMKDFDSSNDCLLELPEFLDGISKWVSRARSSASGIKNFG-TGKFLD  240

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            D H QT +EH  L +GDQ +E  EGV NPK T++KAVL L+LGT IA AFADPLVDAVDN
Sbjct  241  DAHHQTTQEHAQLKSGDQTDEVTEGVGNPKLTTLKAVLLLVLGTIIAGAFADPLVDAVDN  300

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNN+LCL
Sbjct  301  FSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNLLCL  360

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            SVFLA+VY RGLTWDFSSEVLVILIVC VMG F S R+TFPLWT  +A  LYP S+ALVY
Sbjct  361  SVFLAIVYIRGLTWDFSSEVLVILIVCFVMGTFASFRTTFPLWTFSLALLLYPFSLALVY  420

Query  186  VLDYVFGWS  160
            VLDY+FGWS
Sbjct  421  VLDYIFGWS  429



>gb|KDP36271.1| hypothetical protein JCGZ_09836 [Jatropha curcas]
Length=585

 Score =   347 bits (891),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 177/255 (69%), Positives = 201/255 (79%), Gaps = 10/255 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            +EI+ D+++AVDK+MKDFDTS +  ID+ EF  G+ KW++E + S  V       T K L
Sbjct  331  EEIDFDKDNAVDKVMKDFDTSRDNAIDVGEFCRGISKWIEEAKQSGAVSSDFGSRTSKFL  390

Query  729  EDFHEQTRREHYLLGAGDQNE-----EADEGVENPKWTSIKAVLFLLLGTAIAAAFADPL  565
             +FH QT+REH  LGA +Q E     E  EG+EN +W SIKAVL LLLG  IAAAFADPL
Sbjct  391  HNFHLQTKREHAQLGAEEQGEDQSDDEVVEGIENARWISIKAVLMLLLGAVIAAAFADPL  450

Query  564  VDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTM  385
            VDAVDNFS ATSIPTFFISFIALP ATNSSEAVSAIIFASRK  R+ASLTFSELYGAVTM
Sbjct  451  VDAVDNFSDATSIPTFFISFIALPFATNSSEAVSAIIFASRKSKRTASLTFSELYGAVTM  510

Query  384  NNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPL  205
            NN+LCLSVFLALVY RGLTWDFS+EVLVILIVCIVMG F S  +TF LWT  +AF LYP 
Sbjct  511  NNLLCLSVFLALVYLRGLTWDFSAEVLVILIVCIVMGAFASFSTTFRLWTCSVAFLLYPF  570

Query  204  SIALVYVLDYVFGWS  160
            S+ALVYVLDY+ GWS
Sbjct  571  SLALVYVLDYILGWS  585



>ref|XP_009348415.1| PREDICTED: uncharacterized protein LOC103940069 [Pyrus x bretschneideri]
 ref|XP_009348416.1| PREDICTED: uncharacterized protein LOC103940070 [Pyrus x bretschneideri]
Length=580

 Score =   347 bits (891),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 176/247 (71%), Positives = 205/247 (83%), Gaps = 5/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR--NVPVTLKHLEDF  721
            DEI LD+NDAV+K+M DFDTS++ +ID DEF+ G+ KW+ E + S   N   T+K L DF
Sbjct  337  DEIELDKNDAVEKVMNDFDTSHDSQIDRDEFLFGISKWIHEAKRSGDDNDHHTMKFLFDF  396

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H +T++EH LLG   Q++E  EGVENPKWTS KAVL LL+GT IAAA ADPL+D VDNFS
Sbjct  397  HLKTKQEHDLLGG--QSDEIIEGVENPKWTSFKAVLMLLIGTLIAAAAADPLIDVVDNFS  454

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
            TAT IPTFFISFIALPLAT S EAVSAI+FASRKK+R+ SLTFS+LYG+ TMNNVLCLSV
Sbjct  455  TATGIPTFFISFIALPLAT-SCEAVSAIMFASRKKIRTTSLTFSQLYGSATMNNVLCLSV  513

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLALVY R LTWDFS+EVL+ILIVCIVMGVF S R+ FPLWTS IAF LYP S+AL+YVL
Sbjct  514  FLALVYFRELTWDFSAEVLIILIVCIVMGVFCSFRTVFPLWTSSIAFLLYPFSVALIYVL  573

Query  180  DYVFGWS  160
            DY+FGWS
Sbjct  574  DYIFGWS  580



>ref|XP_008367781.1| PREDICTED: uncharacterized protein LOC103431400 [Malus domestica]
Length=609

 Score =   345 bits (886),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 175/247 (71%), Positives = 205/247 (83%), Gaps = 5/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR--NVPVTLKHLEDF  721
            DEI LD+NDAV+K+M DFDTS++ +ID +EF+ G+ KW+ E + S   N   T+K L DF
Sbjct  366  DEIELDKNDAVEKVMNDFDTSHDSQIDQNEFLFGISKWIHEAKRSGDDNDHRTMKFLFDF  425

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H +T++EH LLG   Q++E  EGVENPKWTS KAVL LL+GT IAAA ADPL+D VDNFS
Sbjct  426  HSKTKQEHDLLGG--QSDEIIEGVENPKWTSFKAVLMLLIGTLIAAAAADPLIDVVDNFS  483

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
            TAT IPTFFISFIALPLAT S EAVSAI+FASRKK+R+ASLTFS+LYG+ TMNNV+CLSV
Sbjct  484  TATGIPTFFISFIALPLAT-SCEAVSAIMFASRKKIRTASLTFSQLYGSATMNNVMCLSV  542

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLALVY R LTWDFS+EVL+ILIVCIVMGVF S R+ FPLWTS IAF LYP SIAL+YVL
Sbjct  543  FLALVYFRELTWDFSAEVLIILIVCIVMGVFCSFRTVFPLWTSSIAFLLYPFSIALIYVL  602

Query  180  DYVFGWS  160
            DY+ GWS
Sbjct  603  DYIXGWS  609



>ref|XP_008367769.1| PREDICTED: uncharacterized protein LOC103431392 [Malus domestica]
Length=586

 Score =   344 bits (883),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 209/250 (84%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            DEI LD N+AV+K+M DFDTS++  I   EF  G+ KWL+E +   ++       T+K L
Sbjct  337  DEIQLDNNEAVEKVMSDFDTSHDSRISKPEFFIGISKWLNEAKRQGDINTDPSNRTMKIL  396

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFH++T+ EH LL A DQ++E  EGVEN KWTSIKA L LL+GT IAAAFADPLVDAVD
Sbjct  397  TDFHKRTKEEHALLRADDQSDEVVEGVENVKWTSIKAGLMLLVGTLIAAAFADPLVDAVD  456

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSELYGAVTMNN+LC
Sbjct  457  NFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELYGAVTMNNLLC  516

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+VFLALVYARGLTWDFSSEVLVILIVC+VMG+ GS+R+ FPLWT  IA+ LYP S+ALV
Sbjct  517  LAVFLALVYARGLTWDFSSEVLVILIVCVVMGLLGSLRTVFPLWTCSIAYLLYPFSLALV  576

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  577  YVLDYVFGWS  586



>ref|XP_010060650.1| PREDICTED: uncharacterized protein LOC104448506 [Eucalyptus grandis]
 gb|KCW67435.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=589

 Score =   344 bits (882),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 203/249 (82%), Gaps = 5/249 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS----RNVPVTLKHLE  727
            +EI+L+E+ AVD++MKDFD+SN+  +++ EF+ G+ KW+   + S    +N   T K L+
Sbjct  342  EEIDLNEDGAVDRIMKDFDSSNDCLLELPEFLDGISKWVSRARSSASGIKNFG-TGKFLD  400

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            D H QT +EH  L +GDQ +E  EGV NPK T++KAVL L+LGT IA AFADPLVDAVDN
Sbjct  401  DAHHQTTQEHAQLKSGDQTDEVTEGVGNPKLTTLKAVLLLVLGTIIAGAFADPLVDAVDN  460

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNN+LCL
Sbjct  461  FSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNLLCL  520

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            SVFLA+VY RGLTWDFSSEVLVILIVC VMG F S R+TFPLWT  +A  LYP S+ALVY
Sbjct  521  SVFLAIVYIRGLTWDFSSEVLVILIVCFVMGTFASFRTTFPLWTFSLALLLYPFSLALVY  580

Query  186  VLDYVFGWS  160
            VLDY+FGWS
Sbjct  581  VLDYIFGWS  589



>ref|XP_004294082.1| PREDICTED: uncharacterized protein LOC101313777 [Fragaria vesca 
subsp. vesca]
Length=580

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 213/251 (85%), Gaps = 6/251 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVT-----LKHL  730
            DEI LD++DAVDK+MKDFDTS +  I  DEF+AGV KWL+E + + +   T     +K L
Sbjct  330  DEIELDKDDAVDKVMKDFDTSRDSHISRDEFIAGVRKWLNEAKHAGDSKTTSGSHTMKFL  389

Query  729  EDFHEQTRREHYLLGAG-DQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
             DFHEQT++EH L+G   DQ++E  EGV+NP+ TSIKA L LL GT IAAAFADPLVDAV
Sbjct  390  SDFHEQTKKEHDLVGVDEDQSDEVVEGVDNPRRTSIKAGLMLLAGTLIAAAFADPLVDAV  449

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            DNFS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNNVL
Sbjct  450  DNFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKRRTASLTFSELYGAVTMNNVL  509

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLALVY RGLTWDFS+EVLVI+IVC+VMGVFGS+R+TFPLWT+ IA+ LYP S+ L
Sbjct  510  CLSVFLALVYVRGLTWDFSAEVLVIVIVCVVMGVFGSLRTTFPLWTTSIAYLLYPFSLVL  569

Query  192  VYVLDYVFGWS  160
            VYVLDY+FGWS
Sbjct  570  VYVLDYIFGWS  580



>ref|XP_010042553.1| PREDICTED: uncharacterized protein LOC104431654, partial [Eucalyptus 
grandis]
Length=290

 Score =   332 bits (850),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/264 (64%), Positives = 204/264 (77%), Gaps = 20/264 (8%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS------RNVPVTLKH  733
            +EI+L+E+ AVD++MKDFD+SN++ +++ EF+ G+ KW+ + + S      +N   T K 
Sbjct  28   EEIDLNEDGAVDRIMKDFDSSNDRLLELPEFLDGISKWVSKARSSGAASGIKNFG-TEKF  86

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            L+D H QT +EH  L +GDQ +E  EGV NPK T++KAVL L+LGT IA  FADPLVDAV
Sbjct  87   LDDVHHQTTQEHARLKSGDQTDEVTEGVGNPKLTTLKAVLLLVLGTIIAGVFADPLVDAV  146

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFS------------  409
            DNFS +T IPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFS            
Sbjct  147  DNFSDSTGIPTFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSGGGVAPFYRFFL  206

Query  408  -ELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTS  232
             +LYGAVTMNN+LCLSVFLA+VY RGLTWDFSSEVLVILIVC VMG F S R+TFPLWT 
Sbjct  207  MQLYGAVTMNNLLCLSVFLAIVYIRGLTWDFSSEVLVILIVCFVMGTFASFRTTFPLWTF  266

Query  231  FIAFSLYPLSIALVYVLDYVFGWS  160
             +A  LYP S+ALVYVLDY+FGWS
Sbjct  267  SLALLLYPFSLALVYVLDYIFGWS  290



>gb|KJB13246.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=578

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 178/250 (71%), Positives = 208/250 (83%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            +EI+LD++DAV K++ DFDTS +  +  DEFV G+ KW++E + +    +     T K +
Sbjct  329  EEIDLDQDDAVSKVIADFDTSRDNLVQEDEFVEGIMKWINEAKQTGGAYLESNAGTFKFI  388

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH+QT+REH LLG+ +Q++E  E VENP+W SIKAVL LLLGT IAAAFADPLVDAVD
Sbjct  389  DHFHQQTKREHALLGSEEQSDEVVENVENPRWISIKAVLMLLLGTLIAAAFADPLVDAVD  448

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIP+FFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNNVLC
Sbjct  449  NFSEATSIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNVLC  508

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGLTWDFSSEVLVILIVC+VMG F S R+TFPLWT  +A+ LYP S+ LV
Sbjct  509  LSVFLALVYVRGLTWDFSSEVLVILIVCVVMGAFASFRTTFPLWTCSVAYILYPFSLGLV  568

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  569  YVLDYVFGWS  578



>ref|XP_009766997.1| PREDICTED: uncharacterized protein LOC104218248 [Nicotiana sylvestris]
Length=574

 Score =   340 bits (871),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 185/251 (74%), Positives = 214/251 (85%), Gaps = 7/251 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKH  733
            L+EINLDENDA+ K++KDFDTS++ ++D+ EF+AGV+KWL E + S        P T+K+
Sbjct  326  LEEINLDENDAIAKVLKDFDTSSDDKLDLTEFIAGVEKWLYEARSSNGSSREAGPDTMKY  385

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            L+DFHEQTR EH LLG  D ++E  EGVENP+  +IKA L LLLGT IAA FADPLVDAV
Sbjct  386  LDDFHEQTRMEHSLLG--DTSDEIVEGVENPRKVAIKAALLLLLGTIIAAVFADPLVDAV  443

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            +NFS+ATSIPTFFISFIALPLATNSSEAVSAIIFASRK  +S SLTFSELYGAVTMNN+L
Sbjct  444  NNFSSATSIPTFFISFIALPLATNSSEAVSAIIFASRKNKKSTSLTFSELYGAVTMNNLL  503

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLA+VY RGLTW+FSSEVLVILIVC+VMGV GS+R+TFPLWT  IAF LYPLS+ L
Sbjct  504  CLSVFLAIVYIRGLTWNFSSEVLVILIVCVVMGVLGSIRTTFPLWTCSIAFLLYPLSLVL  563

Query  192  VYVLDYVFGWS  160
            VYVLDYVFGWS
Sbjct  564  VYVLDYVFGWS  574



>ref|XP_004489056.1| PREDICTED: uncharacterized protein LOC101505490 [Cicer arietinum]
Length=583

 Score =   339 bits (870),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 182/250 (73%), Positives = 204/250 (82%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            +EI+LD +DAV ++M DFDTS NQ +D +EFV GV +WL   + S+       P T+K L
Sbjct  334  EEIDLDHDDAVKRIMVDFDTSRNQLVDEEEFVNGVCRWLQTARRSKAASGDAGPHTMKFL  393

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFH +TRREH LL  G Q++E +EGVEN +W SIKAVL LLLG  IAAAFADPLVDAVD
Sbjct  394  SDFHTETRREHDLLDVGGQSDEVEEGVENARWISIKAVLLLLLGAIIAAAFADPLVDAVD  453

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIP FFISFI LPLATNSSEAVSAIIFASR K ++ASLTFSE+YGAVTMNNVLC
Sbjct  454  NFSEATSIPAFFISFIFLPLATNSSEAVSAIIFASRDKRQTASLTFSEIYGAVTMNNVLC  513

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVF S R+ FPLWTS +A  LYP S+ LV
Sbjct  514  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFASFRTVFPLWTSILAILLYPFSLVLV  573

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  574  YVLDYVFGWS  583



>gb|KHG25681.1| Vacuolar calcium ion transporter [Gossypium arboreum]
Length=578

 Score =   339 bits (869),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 177/250 (71%), Positives = 207/250 (83%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            +EI+LD++DAV K++ DFDTS +  +  DEFV G+ KW++E + +    +     T K +
Sbjct  329  EEIDLDQDDAVSKVIADFDTSRDNLVQEDEFVEGITKWINEAKQTGGAYLESNTGTFKFI  388

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH+QT+REH LLG+ +Q++E  E VENP+W SIKAVL LLLGT IAAAFADPLVDAVD
Sbjct  389  DHFHQQTKREHALLGSEEQSDEVVENVENPRWISIKAVLMLLLGTLIAAAFADPLVDAVD  448

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIP+FFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNNVLC
Sbjct  449  NFSEATSIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNVLC  508

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGLTWDFSSEVLVILIVC+VMG F S R+TFPLWT  +A+ LYP S+ LV
Sbjct  509  LSVFLALVYVRGLTWDFSSEVLVILIVCVVMGAFASFRTTFPLWTCSVAYILYPFSLGLV  568

Query  189  YVLDYVFGWS  160
            YVLDYVF WS
Sbjct  569  YVLDYVFSWS  578



>ref|XP_004146032.1| PREDICTED: uncharacterized protein LOC101209298 isoform 1 [Cucumis 
sativus]
 ref|XP_004162934.1| PREDICTED: uncharacterized protein LOC101229160 isoform 1 [Cucumis 
sativus]
 gb|KGN55087.1| hypothetical protein Csa_4G628350 [Cucumis sativus]
Length=589

 Score =   338 bits (868),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 204/250 (82%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR-----NVPVTLKHL  730
            DE++LD +DAVDK+M DFDTS +  +D +EF  G+ +WL +VQ SR     + P T+K+L
Sbjct  340  DEMDLDHDDAVDKIMNDFDTSRDSHVDSNEFGNGIIRWLSQVQGSRTGRGEDGPHTMKYL  399

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             +FH++T+REH LL  G+Q++E  EGVE  K   IKA+LFLLLGTAIAAAFADPLVD V 
Sbjct  400  HNFHQETKREHDLLDVGEQSDEVVEGVEEGKGVLIKAILFLLLGTAIAAAFADPLVDVVH  459

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS AT IP FFISFIALPLATNSSEAVSAIIFASR K ++ASLTFSELYGAVTMNNVLC
Sbjct  460  NFSNATKIPAFFISFIALPLATNSSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLC  519

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGL W+FSSEVLVILIV ++MGV GS R+ FPLWTS +A  LYPLS+ LV
Sbjct  520  LSVFLALVYMRGLVWNFSSEVLVILIVTMIMGVMGSFRTAFPLWTSLVALLLYPLSLVLV  579

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  580  YVLDYVFGWS  589



>ref|XP_004146033.1| PREDICTED: uncharacterized protein LOC101209298 isoform 2 [Cucumis 
sativus]
 ref|XP_004162935.1| PREDICTED: uncharacterized protein LOC101229160 isoform 2 [Cucumis 
sativus]
Length=584

 Score =   338 bits (867),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 204/250 (82%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR-----NVPVTLKHL  730
            DE++LD +DAVDK+M DFDTS +  +D +EF  G+ +WL +VQ SR     + P T+K+L
Sbjct  335  DEMDLDHDDAVDKIMNDFDTSRDSHVDSNEFGNGIIRWLSQVQGSRTGRGEDGPHTMKYL  394

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             +FH++T+REH LL  G+Q++E  EGVE  K   IKA+LFLLLGTAIAAAFADPLVD V 
Sbjct  395  HNFHQETKREHDLLDVGEQSDEVVEGVEEGKGVLIKAILFLLLGTAIAAAFADPLVDVVH  454

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS AT IP FFISFIALPLATNSSEAVSAIIFASR K ++ASLTFSELYGAVTMNNVLC
Sbjct  455  NFSNATKIPAFFISFIALPLATNSSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLC  514

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGL W+FSSEVLVILIV ++MGV GS R+ FPLWTS +A  LYPLS+ LV
Sbjct  515  LSVFLALVYMRGLVWNFSSEVLVILIVTMIMGVMGSFRTAFPLWTSLVALLLYPLSLVLV  574

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  575  YVLDYVFGWS  584



>ref|XP_010675392.1| PREDICTED: uncharacterized protein LOC104891403 [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 203/250 (81%), Gaps = 6/250 (2%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSN-NQEIDIDEFVAGVDKWLDEV---QVSRNVPVTLKHL  730
            +D +++ E+D V KLMK+FDT   +  +D  EF  G+ K L  V   +VS +   TLKH+
Sbjct  325  IDGMSVAEDDVVQKLMKEFDTETLDGRLDRAEFSQGISKLLSLVRGDKVSHHNADTLKHI  384

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + + E+ + EH LLG  D  +EA E +ENPK T+IKAVLFL+LGT IAA FADPLVDAV+
Sbjct  385  DSYDEEAKVEHRLLG--DSGDEAGEVIENPKATTIKAVLFLVLGTIIAAVFADPLVDAVN  442

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIP+FFISFIALPLATNSSEAVSAIIFA+RKK +SASLTFSELYGAVTMNNVLC
Sbjct  443  NFSDATSIPSFFISFIALPLATNSSEAVSAIIFATRKKTKSASLTFSELYGAVTMNNVLC  502

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVYARGL+WDFSSEVLVI +VC++MG  GS R+TFPLWT+ +AF LYPLS+ LV
Sbjct  503  LSVFLALVYARGLSWDFSSEVLVIFLVCVIMGALGSFRTTFPLWTTIVAFLLYPLSLVLV  562

Query  189  YVLDYVFGWS  160
            YVLDY+FGWS
Sbjct  563  YVLDYIFGWS  572



>ref|XP_003543222.1| PREDICTED: uncharacterized protein LOC100809896 [Glycine max]
 gb|KHN36868.1| hypothetical protein glysoja_001599 [Glycine soja]
Length=579

 Score =   335 bits (859),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 203/250 (81%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            +EI+LD +DAV ++M DFDTS N+ +D +EFV GV +WL   Q +R       P T+K L
Sbjct  330  EEIDLDHDDAVKRIMDDFDTSGNERVDREEFVNGVSRWLQRAQRARVASGDAGPHTMKFL  389

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DFH +T+REH LL  G Q  E  EG+EN KW SIKAVL LLLGT IAAAFADPLVDAVD
Sbjct  390  SDFHTETKREHDLLDVGGQVNEEAEGIENAKWISIKAVLLLLLGTIIAAAFADPLVDAVD  449

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIP FFISFI LPLATNSSEAVSAIIFASR K ++ASLTFSELYGAVTMNNVLC
Sbjct  450  NFSEATSIPAFFISFIFLPLATNSSEAVSAIIFASRDKRQTASLTFSELYGAVTMNNVLC  509

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVYARGLTWDFSSEVLVIL+VCIV+GVF S R+ FPLWT+ +A  LYP S+ALV
Sbjct  510  LSVFLALVYARGLTWDFSSEVLVILVVCIVVGVFASFRTVFPLWTAILAILLYPFSLALV  569

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  570  YVLDYVFGWS  579



>ref|NP_001042378.1| Os01g0212400 [Oryza sativa Japonica Group]
 dbj|BAD73036.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04292.1| Os01g0212400 [Oryza sativa Japonica Group]
 dbj|BAG89983.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70160.1| hypothetical protein OsI_00872 [Oryza sativa Indica Group]
 gb|EEE54102.1| hypothetical protein OsJ_00857 [Oryza sativa Japonica Group]
Length=584

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 202/249 (81%), Gaps = 8/249 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTL----KHLE  727
            +E++ D+NDAVDK+M DFDTS N  ++  EFV+G+ +WL+E +  R+VP +     K + 
Sbjct  340  EEVDFDKNDAVDKIMDDFDTSGNDIVEEAEFVSGMKRWLNEAK--RSVPTSGAYSNKFIT  397

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            D+H +TR+EH LL   D+++E  E VENP W   KAV  LLLG+AIAAAFADPLVDAV N
Sbjct  398  DYHARTRQEHDLLV--DRSDETVESVENPGWCITKAVGLLLLGSAIAAAFADPLVDAVHN  455

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS A+ IP+FFISFIALPLATNSSEAVSAIIFASRKKLR++SLTFSE+YG VTMNN LCL
Sbjct  456  FSNASHIPSFFISFIALPLATNSSEAVSAIIFASRKKLRTSSLTFSEVYGGVTMNNTLCL  515

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             VFLAL+Y R LTWDFSSEVL+IL+VC++MG+F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  516  GVFLALIYIRNLTWDFSSEVLIILLVCVIMGLFTSFRTTFPLWTCLVAYMLYPLSLVVVY  575

Query  186  VLDYVFGWS  160
            +LD+VFGWS
Sbjct  576  ILDFVFGWS  584



>ref|XP_003634635.1| PREDICTED: uncharacterized protein LOC100264164 [Vitis vinifera]
 emb|CBI20221.3| unnamed protein product [Vitis vinifera]
Length=580

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 181/250 (72%), Positives = 205/250 (82%), Gaps = 6/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            +EI+LD+N+AVDK+M DFDTSN+Q +D  EFV G+ +WL E +          P +   L
Sbjct  332  EEIDLDKNEAVDKVMSDFDTSNDQFVDEGEFVKGISRWLMEAKRYGGSGPDAGPNSSSVL  391

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH  T+REH+ LG GDQ++E  E VENPKW + KAV+ LLLGT IAA FADPLVDAVD
Sbjct  392  DAFHRGTKREHHRLG-GDQSDEVVEAVENPKWITFKAVMMLLLGTLIAAVFADPLVDAVD  450

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSELYGAVTMNNVLC
Sbjct  451  NFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKNRTTSLTFSELYGAVTMNNVLC  510

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGLTWDFSSEVLVI+IVC+VMGVF S R+TFPLWTSF+A  LYP S+ALV
Sbjct  511  LSVFLALVYVRGLTWDFSSEVLVIVIVCVVMGVFASFRTTFPLWTSFVALLLYPFSLALV  570

Query  189  YVLDYVFGWS  160
            YVLDYV GWS
Sbjct  571  YVLDYVLGWS  580



>ref|XP_011000241.1| PREDICTED: uncharacterized protein LOC105107868 [Populus euphratica]
Length=589

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 176/251 (70%), Positives = 203/251 (81%), Gaps = 6/251 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            +EI+ D++DAV KLMKDFDTS +  ID+ EF  G+ KWLDE   +        P T K+L
Sbjct  339  EEIDFDKDDAVSKLMKDFDTSFDNRIDLGEFTNGIKKWLDEAIRAGGGSPDPGPRTHKYL  398

Query  729  EDFHEQTRREHYLLGAGDQNE-EADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            + FH++T++ H LL + +  E ++DEGV+NP+WTS KA L LL G  IAAAFADPLVDAV
Sbjct  399  DAFHDKTKKAHALLRSPEPEEGQSDEGVKNPRWTSFKASLMLLAGAVIAAAFADPLVDAV  458

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            DNFS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+ +ASLTFSELYGAVTMNNVL
Sbjct  459  DNFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKVTTASLTFSELYGAVTMNNVL  518

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLALVY R LTWDFS+EVLVI IVCIVMG F S R+TFPLWTSF+A+ LYP S+ L
Sbjct  519  CLSVFLALVYFRELTWDFSAEVLVICIVCIVMGAFASFRTTFPLWTSFLAYFLYPFSLVL  578

Query  192  VYVLDYVFGWS  160
            VYVLDYV GWS
Sbjct  579  VYVLDYVLGWS  589



>ref|XP_003565462.1| PREDICTED: uncharacterized protein LOC100838274 [Brachypodium 
distachyon]
Length=582

 Score =   332 bits (852),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 197/249 (79%), Gaps = 8/249 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTL----KHLE  727
            +EI+ D++DAVDK+M DFDTS N  ++  EF+AG+ KWL+E +  RNVP +     K + 
Sbjct  338  EEIDFDKDDAVDKIMDDFDTSGNDTVEEAEFIAGMKKWLNEAK--RNVPASGAFSNKFVN  395

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            D+H +TR EH  L   D+++EA E VENP W   KAV FLLLG  I AAFADPLVDAV N
Sbjct  396  DYHARTREEHDQLV--DRSDEAVESVENPGWCIAKAVGFLLLGGVICAAFADPLVDAVHN  453

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  454  FSNATHIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  513

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             VFLAL+Y R LTWDFSSEVL+IL+VC++MG+F S R+ FPLWT  +A+ LYPLS+A+VY
Sbjct  514  GVFLALIYFRNLTWDFSSEVLIILLVCVIMGLFTSFRTNFPLWTCLVAYLLYPLSLAVVY  573

Query  186  VLDYVFGWS  160
            VLDYVFGWS
Sbjct  574  VLDYVFGWS  582



>ref|XP_010915578.1| PREDICTED: uncharacterized protein LOC105040648 [Elaeis guineensis]
Length=590

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/247 (66%), Positives = 199/247 (81%), Gaps = 4/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            +EI+LD +DAV+K+M +FDTS N  I+ DEFV G+ +WL+E +  V  +   + K L DF
Sbjct  346  EEIDLDRDDAVNKVMLEFDTSRNACIEEDEFVGGIKQWLNEAKRTVVTSGAYSKKFLHDF  405

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H +T+ EH +L   D+++E  E + NP W   KAVL LLLGT IAA FADPLVDAVDNFS
Sbjct  406  HMKTKEEHNMLI--DKSDEVVENINNPTWICFKAVLLLLLGTVIAAVFADPLVDAVDNFS  463

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             AT+IP+FFISFIA+PLATNSSEAVSAIIFASRKK R++SLTFSE+YG VTMNN LCL+V
Sbjct  464  LATNIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTSSLTFSEIYGGVTMNNTLCLAV  523

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLALVY R LTWDFS+EVL+IL+VCIVMG+F S R+TFPLWT  IA+ LYPLS+ LVYVL
Sbjct  524  FLALVYLRHLTWDFSAEVLIILVVCIVMGLFTSFRTTFPLWTCSIAYLLYPLSLVLVYVL  583

Query  180  DYVFGWS  160
            D+VFGWS
Sbjct  584  DFVFGWS  590



>ref|XP_010519243.1| PREDICTED: uncharacterized protein LOC104798750 [Tarenaya hassleriana]
Length=587

 Score =   330 bits (846),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 172/253 (68%), Positives = 205/253 (81%), Gaps = 8/253 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            DEI+LD++DAV K+++DFD S ++ +D DEFV G+ +WL E   +        P T+K +
Sbjct  335  DEIDLDKDDAVGKVLQDFDKSLDEHVDEDEFVRGIKRWLIEAMGAGPAAPDAGPRTMKFI  394

Query  729  EDFHEQTRREHYLLGAGDQNEEADE---GVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
            + +H+Q +REH LLGA ++NEE DE    V +PK  +IKAVL LLLGTAIAAAFADPLVD
Sbjct  395  DHYHQQAKREHALLGAQEENEENDEAAVHVADPKAITIKAVLMLLLGTAIAAAFADPLVD  454

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
             V NFS ATSIP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN
Sbjct  455  TVHNFSAATSIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNN  514

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
            +LCLSVFLALVYARGLTW+FSSEVLVILIVC+VM  F S R+T+PLWT FIA+ LYP S+
Sbjct  515  ILCLSVFLALVYARGLTWNFSSEVLVILIVCLVMSGFASFRTTYPLWTCFIAYLLYPFSL  574

Query  198  ALVYVLDYVFGWS  160
             LVY+LDY FGWS
Sbjct  575  GLVYILDYWFGWS  587



>gb|EMS45634.1| hypothetical protein TRIUR3_11261 [Triticum urartu]
Length=427

 Score =   325 bits (832),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 194/247 (79%), Gaps = 4/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            ++I LD N A D++M DFD S N  I+  EFV GV +WL+E +  V+ +   + K ++DF
Sbjct  183  EDIELDTNLATDQVMADFDRSRNSSIEKGEFVDGVLRWLEEAKRVVAGSGAYSKKFMDDF  242

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H  T  EH  L   D++E+  E +ENP WT  KA+  LLLGTA+AAAFADPLVDAV NFS
Sbjct  243  HITTGEEHNALL--DKHEDDGESIENPTWTCFKAISLLLLGTAMAAAFADPLVDAVHNFS  300

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
            +ATSIP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL+V
Sbjct  301  SATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCLAV  360

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLALVY RGLTWDFSSEVLVI +VCI+MG+F S R+ FPLWT F+AF LYPLS+ LVY+L
Sbjct  361  FLALVYVRGLTWDFSSEVLVIFLVCIIMGLFTSFRTKFPLWTCFVAFLLYPLSLVLVYIL  420

Query  180  DYVFGWS  160
            DY FGWS
Sbjct  421  DYKFGWS  427



>gb|EMS61578.1| hypothetical protein TRIUR3_22187 [Triticum urartu]
Length=497

 Score =   327 bits (837),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/247 (65%), Positives = 196/247 (79%), Gaps = 4/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            DEI+ D+NDAVDK+M DFDTS N  ++ DEFVAG+  WL+E +  V+ +   + K + D+
Sbjct  253  DEIDFDKNDAVDKIMDDFDTSGNDTVEEDEFVAGMKTWLNEAKQKVAASGAYSNKFVNDY  312

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H +TR EH  L   D+++EA E VENP W   KAV +L+LG  I AAFADPLVDAV NFS
Sbjct  313  HARTREEHDQLV--DRSDEAVESVENPGWCIAKAVGYLILGATICAAFADPLVDAVHNFS  370

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             AT IP+FF+SFI LPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL V
Sbjct  371  NATHIPSFFVSFIGLPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCLGV  430

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLAL+Y R LTWDFSSEVLVIL+VC++MG+F S R++FPLWT  +A+ LYPL++A+VYVL
Sbjct  431  FLALIYFRELTWDFSSEVLVILLVCVIMGLFTSFRTSFPLWTCLVAYLLYPLTLAVVYVL  490

Query  180  DYVFGWS  160
            D+VFGWS
Sbjct  491  DFVFGWS  497



>ref|XP_002298903.2| sodium/calcium exchanger family protein [Populus trichocarpa]
 gb|EEE83708.2| sodium/calcium exchanger family protein [Populus trichocarpa]
Length=582

 Score =   329 bits (844),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 173/251 (69%), Positives = 204/251 (81%), Gaps = 6/251 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDE-VQVSRNVP----VTLKHL  730
            +EI+ D++DAV KL+KDFD +N+  I+  EF+ G+ KWLDE ++V    P     T K+L
Sbjct  332  EEIDFDKDDAVSKLIKDFDKTNDNLINFREFINGIQKWLDEAMRVGGGSPDPGPRTHKYL  391

Query  729  EDFHEQTRREHYLLGAGDQNE-EADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            ++FH++T++ H LLG+ +  E E+D GV+NP+WTS KA L LL G  IAAAFADPLVDAV
Sbjct  392  DNFHDKTKKAHALLGSKEPEEGESDGGVKNPRWTSFKASLMLLAGAVIAAAFADPLVDAV  451

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            DNFS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK+ +ASLTFSELYGAVTMNNVL
Sbjct  452  DNFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKKVTTASLTFSELYGAVTMNNVL  511

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CLSVFLALVY R LTWDFS+EVLVI IVCI MG F S R+TFPLWT F+A+ LYP S+ L
Sbjct  512  CLSVFLALVYFRELTWDFSAEVLVICIVCIAMGAFASFRTTFPLWTCFLAYFLYPFSLVL  571

Query  192  VYVLDYVFGWS  160
            VYVLDYV GWS
Sbjct  572  VYVLDYVLGWS  582



>gb|EMT05376.1| hypothetical protein F775_06447 [Aegilops tauschii]
Length=503

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 194/247 (79%), Gaps = 4/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            ++I LD N A D++M DFD S N  I+  EFV GV +WL+E +  V+ +   + K +EDF
Sbjct  259  EDIELDSNLATDQVMADFDRSRNSSIEKGEFVDGVLRWLEEAKRVVAGSGAYSKKFMEDF  318

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H  T  EH  L   D++E+  E +ENP WT  KA+  LLLGTA+AAAFADPLVDAV NFS
Sbjct  319  HITTGEEHNALL--DKHEDDGESIENPTWTCFKAISLLLLGTAMAAAFADPLVDAVHNFS  376

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
            +ATSIP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL+V
Sbjct  377  SATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCLAV  436

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLALVY RGLTWDFSSEVLVI +VCI+MG+F S R+ FPLWT F+AF LYPLS+ LVY+L
Sbjct  437  FLALVYIRGLTWDFSSEVLVIFLVCIIMGLFTSFRTKFPLWTCFVAFLLYPLSLVLVYIL  496

Query  180  DYVFGWS  160
            DY FGWS
Sbjct  497  DYKFGWS  503



>ref|XP_006643900.1| PREDICTED: uncharacterized protein LOC102712578 [Oryza brachyantha]
Length=577

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 198/249 (80%), Gaps = 8/249 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVP----VTLKHLE  727
            +EI+ D+ DAVDK+M DFDTS N  ++  EFV G+ +WL E +  R+VP     + K + 
Sbjct  333  EEIDFDKEDAVDKIMNDFDTSRNTVVEEAEFVEGMKRWLHEAK--RSVPGSGAYSTKFMS  390

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            D+H +TR+EH LL   + ++E  E VENP W   KAV  LLLG+AIAAAFADPLVDAV N
Sbjct  391  DYHARTRQEHDLLV--EASDETVESVENPGWCITKAVGLLLLGSAIAAAFADPLVDAVHN  448

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS A+ IP+FFISFIALPLATNSSEAVSAIIFASRKKLR++SLTFSE+YG VTMNN LCL
Sbjct  449  FSNASHIPSFFISFIALPLATNSSEAVSAIIFASRKKLRTSSLTFSEVYGGVTMNNTLCL  508

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             VFLAL+Y R LTWDFSSEVL+IL+VC++MG+F S ++TFPLWT  +A+ LYPLS+ +VY
Sbjct  509  GVFLALIYIRNLTWDFSSEVLIILLVCVIMGLFTSFKTTFPLWTCLVAYMLYPLSLVVVY  568

Query  186  VLDYVFGWS  160
            +LD+VFGWS
Sbjct  569  ILDFVFGWS  577



>emb|CBI20223.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   323 bits (827),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 177/250 (71%), Positives = 199/250 (80%), Gaps = 7/250 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            +EI+LD N+AVDK+M DFDTSN+Q +D  EFV G+ +W+ E +          P +   L
Sbjct  242  EEIDLDRNEAVDKVMSDFDTSNDQFVDEGEFVKGISRWITEAKRYEGSGPDAGPNSSSIL  301

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH  T+REH  L  G Q++E  E VENPKW + KAV+ LLLGT IAA FADPLVDAVD
Sbjct  302  DAFHRGTKREHNRL-EGYQSDEVVEAVENPKWITFKAVMMLLLGTLIAAVFADPLVDAVD  360

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIPTFFISFIALPLAT SSEAVSAIIFASRKK R+ SLTFS LYGAVTMNNVLC
Sbjct  361  NFSDATSIPTFFISFIALPLAT-SSEAVSAIIFASRKKRRTTSLTFSVLYGAVTMNNVLC  419

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGLTWDFSSEVLVILIVC+VMGVF S R+TFPLWTSF+A  LYP S+ALV
Sbjct  420  LSVFLALVYVRGLTWDFSSEVLVILIVCVVMGVFASFRTTFPLWTSFVALLLYPFSLALV  479

Query  189  YVLDYVFGWS  160
            YVLDYV GWS
Sbjct  480  YVLDYVLGWS  489



>gb|EMT26919.1| hypothetical protein F775_25869 [Aegilops tauschii]
Length=469

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 194/247 (79%), Gaps = 4/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            +EI+ D+NDAVDK+M DFDTS N  ++ DEFVAG+  WL E +  V  +   + K + D+
Sbjct  225  EEIDFDKNDAVDKIMDDFDTSGNDTVEEDEFVAGMKIWLHEAKQKVEASGAYSNKFVNDY  284

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H +TR +H  L   D+++EA E VENP W   KAV +LLLG  I AAFADPLVDAV NFS
Sbjct  285  HARTREDHDQLV--DRSDEAVESVENPGWCIAKAVGYLLLGATICAAFADPLVDAVHNFS  342

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             AT IP+FF+SFI LPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL V
Sbjct  343  NATHIPSFFVSFIGLPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCLGV  402

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLAL+Y R LTWDFSSEVLVIL+VC++MG+F S R++FPLWT  +A+ LYPL++A+VYVL
Sbjct  403  FLALIYFRELTWDFSSEVLVILLVCVIMGLFTSFRTSFPLWTCLVAYLLYPLTLAVVYVL  462

Query  180  DYVFGWS  160
            D+VFGWS
Sbjct  463  DFVFGWS  469



>gb|ADN33808.1| sodium/calcium exchanger family protein [Cucumis melo subsp. 
melo]
Length=585

 Score =   325 bits (833),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 203/250 (81%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR-----NVPVTLKHL  730
            DEI+LD +DAVDK+M DFDTS +  +D +EF  G+ +WL +VQ SR     + P T+K+L
Sbjct  336  DEIDLDHDDAVDKIMNDFDTSRDSHVDSNEFGNGIIRWLSQVQGSRTGRGDDGPHTMKYL  395

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             +FH++T+REH LL  G+Q++E  EGVE  K   IKA+LFLLLGTAIAAAFADPLVD V 
Sbjct  396  HNFHQETKREHDLLDVGEQSDEVVEGVEEGKGVLIKAILFLLLGTAIAAAFADPLVDVVH  455

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS AT IP FFISFIALPLATNSSEAVSAIIFASR K ++ASLTFSELYGAVTMNNVLC
Sbjct  456  NFSNATKIPAFFISFIALPLATNSSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLC  515

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGL W+FSSEVLVIL+V +VMGV GS R+ FPLWTS +A  LYP S+ LV
Sbjct  516  LSVFLALVYLRGLVWNFSSEVLVILVVTVVMGVMGSFRTAFPLWTSLVALLLYPFSLVLV  575

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  576  YVLDYVFGWS  585



>ref|XP_008463718.1| PREDICTED: uncharacterized protein LOC103501799 [Cucumis melo]
Length=590

 Score =   325 bits (833),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 203/250 (81%), Gaps = 5/250 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR-----NVPVTLKHL  730
            DEI+LD +DAVDK+M DFDTS +  +D +EF  G+ +WL +VQ SR     + P T+K+L
Sbjct  341  DEIDLDHDDAVDKIMNDFDTSRDSHVDSNEFGNGIIRWLSQVQGSRTGRGDDGPHTMKYL  400

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             +FH++T+REH LL  G+Q++E  EGVE  K   IKA+LFLLLGTAIAAAFADPLVD V 
Sbjct  401  HNFHQETKREHDLLDVGEQSDEVVEGVEEGKGVLIKAILFLLLGTAIAAAFADPLVDVVH  460

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS AT IP FFISFIALPLATNSSEAVSAIIFASR K ++ASLTFSELYGAVTMNNVLC
Sbjct  461  NFSNATKIPAFFISFIALPLATNSSEAVSAIIFASRDKRKTASLTFSELYGAVTMNNVLC  520

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGL W+FSSEVLVIL+V +VMGV GS R+ FPLWTS +A  LYP S+ LV
Sbjct  521  LSVFLALVYLRGLVWNFSSEVLVILVVTVVMGVMGSFRTAFPLWTSLVALLLYPFSLVLV  580

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  581  YVLDYVFGWS  590



>dbj|BAJ93500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   324 bits (830),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 194/247 (79%), Gaps = 4/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            +EI+ D+NDAVDK+M DFDTS N  ++ DEFVAG+  WL E +  V+ +   + K + D+
Sbjct  335  EEIDFDKNDAVDKIMDDFDTSGNDTVEEDEFVAGMKIWLHEAKSKVAASGAYSNKFVNDY  394

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H +TR EH  L   D+++EA E VENP W   KAV +LLLG  I AAFADPLVDAV NFS
Sbjct  395  HARTREEHDQLV--DRSDEAVESVENPGWCIAKAVGYLLLGATICAAFADPLVDAVHNFS  452

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             AT IP+FF+SFI LPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL V
Sbjct  453  NATHIPSFFVSFIGLPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCLGV  512

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLAL+Y R LTWDFSSEVLVIL+ C++MG+F S R++FPLWT  +A+ LYPL++A+VYVL
Sbjct  513  FLALIYFRELTWDFSSEVLVILLACVIMGLFTSFRTSFPLWTCLVAYLLYPLTLAIVYVL  572

Query  180  DYVFGWS  160
            D+VFGWS
Sbjct  573  DFVFGWS  579



>emb|CDM82192.1| unnamed protein product [Triticum aestivum]
Length=579

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 194/247 (79%), Gaps = 4/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            +EI+ D+NDAVDK+M DFDTS N  ++ DEFVAG+  WL E +  V  +   + K + D+
Sbjct  335  EEIDFDKNDAVDKIMDDFDTSGNDTVEEDEFVAGMKIWLHEAKQKVEASGAYSNKFVNDY  394

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H +TR +H  L   D+++EA E VENP W   KAV +LLLG  I AAFADPLVDAV NFS
Sbjct  395  HARTREDHDQLV--DRSDEAVESVENPGWCIAKAVGYLLLGATICAAFADPLVDAVHNFS  452

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             AT IP+FF+SFI LPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL V
Sbjct  453  NATHIPSFFVSFIGLPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCLGV  512

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLAL+Y R LTWDFSSEVLVIL+VC++MG+F S R++FPLWT  +A+ LYPL++A+VYVL
Sbjct  513  FLALIYFRELTWDFSSEVLVILLVCVIMGLFTSFRTSFPLWTCLVAYLLYPLTLAVVYVL  572

Query  180  DYVFGWS  160
            D+VFGWS
Sbjct  573  DFVFGWS  579



>ref|XP_002282948.1| PREDICTED: uncharacterized protein LOC100252144 [Vitis vinifera]
Length=579

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 177/250 (71%), Positives = 199/250 (80%), Gaps = 7/250 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            +EI+LD N+AVDK+M DFDTSN+Q +D  EFV G+ +W+ E +          P +   L
Sbjct  332  EEIDLDRNEAVDKVMSDFDTSNDQFVDEGEFVKGISRWITEAKRYEGSGPDAGPNSSSIL  391

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH  T+REH  L  G Q++E  E VENPKW + KAV+ LLLGT IAA FADPLVDAVD
Sbjct  392  DAFHRGTKREHNRL-EGYQSDEVVEAVENPKWITFKAVMMLLLGTLIAAVFADPLVDAVD  450

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIPTFFISFIALPLAT SSEAVSAIIFASRKK R+ SLTFS LYGAVTMNNVLC
Sbjct  451  NFSDATSIPTFFISFIALPLAT-SSEAVSAIIFASRKKRRTTSLTFSVLYGAVTMNNVLC  509

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGLTWDFSSEVLVILIVC+VMGVF S R+TFPLWTSF+A  LYP S+ALV
Sbjct  510  LSVFLALVYVRGLTWDFSSEVLVILIVCVVMGVFASFRTTFPLWTSFVALLLYPFSLALV  569

Query  189  YVLDYVFGWS  160
            YVLDYV GWS
Sbjct  570  YVLDYVLGWS  579



>ref|XP_011098255.1| PREDICTED: uncharacterized protein LOC105176958 isoform X1 [Sesamum 
indicum]
Length=576

 Score =   321 bits (823),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 169/223 (76%), Positives = 193/223 (87%), Gaps = 4/223 (2%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR--NVPVTLKHLEDFH  718
            E NLDE+DAV KLMKD D+S +  +D+ EF++ V +WL+E + ++  N   ++K ++DFH
Sbjct  326  ESNLDEDDAVVKLMKDLDSSRDSRVDLHEFISTVARWLEEAKGAKTSNHTGSMKFIDDFH  385

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFST  538
            EQTRREH LLG  DQ +EA EGV+NP+WTS+KAVL LLLGT IAA FADPLVDAVDNFST
Sbjct  386  EQTRREHDLLG--DQGDEAAEGVDNPRWTSVKAVLLLLLGTVIAAVFADPLVDAVDNFST  443

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  358
            ATSIP+FFISFI LPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF
Sbjct  444  ATSIPSFFISFIVLPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  503

Query  357  LALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSF  229
            LALVY RGL WDFSSEVLVILIVC+VMGVF S+R+TFPLWTS 
Sbjct  504  LALVYVRGLVWDFSSEVLVILIVCVVMGVFASIRTTFPLWTSL  546



>ref|XP_004294083.1| PREDICTED: uncharacterized protein LOC101314065 [Fragaria vesca 
subsp. vesca]
Length=578

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 194/247 (79%), Gaps = 3/247 (1%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV--PVTLKHLEDF  721
            D+I L+++DAV+KLM++FDTS +  +D  EF  GV KWL+  +   N   P   K L DF
Sbjct  333  DQIELNKDDAVEKLMQEFDTSRDSRVDSHEFFNGVSKWLNVAKRVANSSSPSDRKFLTDF  392

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H +T++EH LL A DQ+EEA EG +N K   +KA+  LL+GT IAA  A+PLVD VDNFS
Sbjct  393  HSRTKQEHDLLAASDQSEEAIEGRKNLKVAFLKAIGMLLVGTLIAAVVAEPLVDVVDNFS  452

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             ATSIP FF+SFI LPL T +SE VSAI FASRKK+R+ASLTFS+LYG+VTM NVLCLSV
Sbjct  453  EATSIPNFFVSFIVLPLFT-ASEGVSAITFASRKKIRTASLTFSQLYGSVTMKNVLCLSV  511

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLALVY R LTWDFS+EVLVILIVC VMGVF S+R+TFPLWTS IAF LYP S+AL+YVL
Sbjct  512  FLALVYFRELTWDFSAEVLVILIVCTVMGVFASLRTTFPLWTSSIAFILYPFSVALIYVL  571

Query  180  DYVFGWS  160
            D+VFGWS
Sbjct  572  DFVFGWS  578



>dbj|BAD19956.1| putative drought-induced protein RDI [Oryza sativa Japonica Group]
 dbj|BAD19782.1| putative drought-induced protein RDI [Oryza sativa Japonica Group]
Length=571

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/246 (65%), Positives = 191/246 (78%), Gaps = 3/246 (1%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS-RNVPVTLKHLEDFH  718
            ++I+ + N A D++M DFDTS N  I+  EFV G+ +WLDE + +  +   + K L DFH
Sbjct  328  EDIDWNSNLAADQVMADFDTSRNHFIEKGEFVNGMLRWLDEAKRTVTSGAYSKKFLNDFH  387

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFST  538
             +TR E    G  D++EE  E   NP WT IKA+L LLLGTA+AAA ADPLVDAV NFS 
Sbjct  388  ARTRDEQT--GLLDKDEEEGEADGNPTWTCIKAILLLLLGTAMAAASADPLVDAVHNFSN  445

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  358
            AT IP+FFISFI +PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL+VF
Sbjct  446  ATHIPSFFISFIVMPLATNSSEAVSAIIFASRKKKRTLSLTFSEVYGGVTMNNTLCLAVF  505

Query  357  LALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLD  178
            LALVY RGLTWDFSSEVL+IL+VCI+MG+F S R+ FPLWT F+AF LYPLS+ +VY+LD
Sbjct  506  LALVYVRGLTWDFSSEVLIILLVCIIMGLFTSFRTDFPLWTCFVAFLLYPLSLIMVYILD  565

Query  177  YVFGWS  160
            Y FGWS
Sbjct  566  YKFGWS  571



>ref|XP_002451861.1| hypothetical protein SORBIDRAFT_04g008850 [Sorghum bicolor]
 gb|EES04837.1| hypothetical protein SORBIDRAFT_04g008850 [Sorghum bicolor]
Length=562

 Score =   317 bits (812),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/243 (65%), Positives = 190/243 (78%), Gaps = 4/243 (2%)
 Frame = -3

Query  882  LDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDFHEQT  709
            ++ N AVD++M DFD S+N  I+  EF+ G+ +WL+E +  V  +   + K L+DFH +T
Sbjct  322  IENNLAVDQVMADFDRSHNFVIEKGEFIDGILRWLEEAKRSVVTSGSYSKKFLQDFHTRT  381

Query  708  RREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATS  529
            R EH LL   D N+   E +ENP WTS KA+  LLLGTA+AAAFADPLVDAV  FS ATS
Sbjct  382  RDEHNLLLGNDDNDV--EAIENPTWTSFKAISLLLLGTAMAAAFADPLVDAVHGFSNATS  439

Query  528  IPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLAL  349
            IP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL+VFL L
Sbjct  440  IPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCLAVFLGL  499

Query  348  VYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVF  169
            VY RGLTWDFSSEVL+I +VC +MG+F S R+ FPLWT F+A+ LYPLS+ +VYVLDY F
Sbjct  500  VYVRGLTWDFSSEVLIIFLVCTIMGLFTSFRTNFPLWTCFVAYLLYPLSLVIVYVLDYKF  559

Query  168  GWS  160
            GWS
Sbjct  560  GWS  562



>gb|EEE56655.1| hypothetical protein OsJ_06069 [Oryza sativa Japonica Group]
Length=575

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/246 (65%), Positives = 191/246 (78%), Gaps = 3/246 (1%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS-RNVPVTLKHLEDFH  718
            ++I+ + N A D++M DFDTS N  I+  EFV G+ +WLDE + +  +   + K L DFH
Sbjct  332  EDIDWNSNLAADQVMADFDTSRNHFIEKGEFVNGMLRWLDEAKRTVTSGAYSKKFLNDFH  391

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFST  538
             +TR E    G  D++EE  E   NP WT IKA+L LLLGTA+AAA ADPLVDAV NFS 
Sbjct  392  ARTRDEQT--GLLDKDEEEGEADGNPTWTCIKAILLLLLGTAMAAASADPLVDAVHNFSN  449

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  358
            AT IP+FFISFI +PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL+VF
Sbjct  450  ATHIPSFFISFIVMPLATNSSEAVSAIIFASRKKKRTLSLTFSEVYGGVTMNNTLCLAVF  509

Query  357  LALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLD  178
            LALVY RGLTWDFSSEVL+IL+VCI+MG+F S R+ FPLWT F+AF LYPLS+ +VY+LD
Sbjct  510  LALVYVRGLTWDFSSEVLIILLVCIIMGLFTSFRTDFPLWTCFVAFLLYPLSLIMVYILD  569

Query  177  YVFGWS  160
            Y FGWS
Sbjct  570  YKFGWS  575



>ref|XP_008645573.1| PREDICTED: uncharacterized protein LOC103626994 [Zea mays]
Length=579

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 197/248 (79%), Gaps = 6/248 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            ++++LD + AVD++M DFDTS+N  I+  EF+ G+ +WL+E +  V+ +   + K L+DF
Sbjct  335  EDVDLDSDLAVDQVMADFDTSHNSVIEKGEFIDGILRWLEEAKRSVATSGSDSRKFLQDF  394

Query  720  HEQTRREH-YLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNF  544
            H +TR E   LLG  D++ EA   +ENP WTS KA+L LLLGTA+AAAFADPLVDAV  F
Sbjct  395  HTRTRDERSQLLGKDDEDGEA---IENPTWTSFKAILLLLLGTAMAAAFADPLVDAVHGF  451

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  364
            S ATSIP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YGAVTMNN LCL+
Sbjct  452  SNATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGAVTMNNTLCLA  511

Query  363  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  184
            VFL LVY RGLTWDFSSEVL+I  VC +MG+F S R+ FPLWT  +A+ LYPLS+ +VYV
Sbjct  512  VFLGLVYVRGLTWDFSSEVLIIFSVCTIMGLFTSFRTDFPLWTCVVAYLLYPLSLVVVYV  571

Query  183  LDYVFGWS  160
            LD+ FGWS
Sbjct  572  LDFKFGWS  579



>ref|XP_009405607.1| PREDICTED: uncharacterized protein LOC103988717 [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   317 bits (812),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 207/248 (83%), Gaps = 4/248 (2%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLED  724
            +DEI+LD +DAVDK+M +FDTS N  I+ DEF+ G+ KW+DE +  V+ +   + K + +
Sbjct  348  IDEIDLDTDDAVDKIMIEFDTSQNSSIEEDEFIVGLTKWIDEAKRSVANSGAYSKKFMHE  407

Query  723  FHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNF  544
            FH +TR EH +L   DQ++E  E V+NP W  IKA+L LLLGT +AA FADPLVDAVDNF
Sbjct  408  FHMKTRDEHNMLL--DQSDEVVENVDNPMWICIKAILLLLLGTVLAAIFADPLVDAVDNF  465

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  364
            S ATSIP+FFISFIA+PLATNSSEAVS+IIFA+RKK R++SLTFSE+YG VTMNN+LCL+
Sbjct  466  SVATSIPSFFISFIAMPLATNSSEAVSSIIFATRKKQRTSSLTFSEIYGGVTMNNLLCLA  525

Query  363  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  184
            VFLALVY R LTWDFS+EVLVILIVC+VMG+F S R+TFPLWT F+AFSLYPLS+ALVYV
Sbjct  526  VFLALVYMRHLTWDFSAEVLVILIVCVVMGLFTSFRTTFPLWTCFVAFSLYPLSLALVYV  585

Query  183  LDYVFGWS  160
            LD+VFGWS
Sbjct  586  LDFVFGWS  593



>dbj|BAI94501.1| sodium/calcium exchanger protein [Dianthus caryophyllus]
Length=581

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/250 (67%), Positives = 203/250 (81%), Gaps = 6/250 (2%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTS-NNQEIDIDEFVAGVDKWLDEVQVSRNVPV---TLKHL  730
            L+ ++L+E D  +K++K FDT  ++  ID+DEF+ G+ K    V+  R++      L+HL
Sbjct  334  LEGVSLEEEDIAEKILKAFDTERHDDRIDLDEFIKGISKLFTTVRGDRSMHHNGDALEHL  393

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + + E+++REH LLG    NEE  E +ENPK T+IKAV+FL++GT IAAAFADPLVDAVD
Sbjct  394  DRYDEESKREHLLLGE--ANEEGGEEIENPKKTTIKAVIFLVIGTLIAAAFADPLVDAVD  451

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFSTATSIP+FFISFIALPLATNSSEAVSAIIFASRKK RSASLTFSELYGA TMNNVLC
Sbjct  452  NFSTATSIPSFFISFIALPLATNSSEAVSAIIFASRKKRRSASLTFSELYGAATMNNVLC  511

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFLALVY RGL+WDFSSEVLVI +VC +MG  GS +++FPLWT+ IAF LYP S+ LV
Sbjct  512  LSVFLALVYVRGLSWDFSSEVLVIFLVCTIMGALGSFKTSFPLWTASIAFFLYPFSLVLV  571

Query  189  YVLDYVFGWS  160
            YVLDYVFGWS
Sbjct  572  YVLDYVFGWS  581



>ref|XP_004951320.1| PREDICTED: uncharacterized protein LOC101782315 [Setaria italica]
Length=572

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/247 (63%), Positives = 192/247 (78%), Gaps = 4/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            ++I+LD + A +++M DFDTS N  I+  EFV G+ +WL E +  V+ +   + K L+DF
Sbjct  328  EDIDLDSSLAAEQVMADFDTSQNYAIEKAEFVDGILRWLKEAKRSVASSGAYSKKFLQDF  387

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H +TR EH LL   D  +E  E +E P WT  KA+  LLLGTA+AAAFADPLVDAV NFS
Sbjct  388  HTRTRDEHNLLLGKD--DEDGEAIEYPTWTCFKAISLLLLGTAMAAAFADPLVDAVHNFS  445

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             ATSIP+FF+SFIA+P ATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL+V
Sbjct  446  NATSIPSFFVSFIAMPFATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCLAV  505

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLALVY RGLTWDFS+EVLVI +VC +MG+F S R+ FPLWT F+A+ LYPLS+ +VYVL
Sbjct  506  FLALVYVRGLTWDFSAEVLVIFLVCTIMGLFTSFRTNFPLWTCFVAYLLYPLSLIIVYVL  565

Query  180  DYVFGWS  160
            D+ FGWS
Sbjct  566  DFKFGWS  572



>ref|XP_010535054.1| PREDICTED: uncharacterized protein LOC104810447 [Tarenaya hassleriana]
Length=573

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 165/254 (65%), Positives = 201/254 (79%), Gaps = 9/254 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ-----VSRNV-PVTLKH  733
            +EI+LD++DAV K+++DFD S ++ +D DEFV G+ +WL E         R+  P T+K 
Sbjct  320  EEIDLDKDDAVGKVLQDFDKSLDERVDQDEFVHGIKRWLIEAMREGGPAGRDAGPRTMKF  379

Query  732  LEDFHEQTRREHYLLGAGDQNEEADE---GVENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
            ++++H+QT REH LL A +  E  +E    V +PK  +IKAVL LLLGTAIAAAFADPLV
Sbjct  380  IDNYHQQTMREHALLNAEENEENDEEDVVHVADPKSVTIKAVLMLLLGTAIAAAFADPLV  439

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
            D V NFS AT IP+FFISFIALPLATNSSEAVSAIIF+SRKK+R+ASLTFSEL G VTMN
Sbjct  440  DTVQNFSVATKIPSFFISFIALPLATNSSEAVSAIIFSSRKKIRTASLTFSELCGGVTMN  499

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            N+LCLSVFLALVYAR LTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S
Sbjct  500  NILCLSVFLALVYARELTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFS  559

Query  201  IALVYVLDYVFGWS  160
            + LVY+LD+ F WS
Sbjct  560  LGLVYILDFWFSWS  573



>ref|XP_007050029.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
 gb|EOX94186.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
Length=586

 Score =   314 bits (805),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 195/245 (80%), Gaps = 3/245 (1%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHE  715
            +EI++D  DAVDK++K+FDTS +  IDIDEFV G+ KWL+EV+ +     T  HL  FHE
Sbjct  345  EEIDMDIEDAVDKVLKEFDTSCDSFIDIDEFVKGISKWLNEVRRTAEGQATSIHLHHFHE  404

Query  714  QTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTA  535
            QTR+EH+LLG   Q+    + V+NP W + KAV+ LLLGT +AA FADPLVDAV +FSTA
Sbjct  405  QTRKEHHLLGG--QSGHFGKTVKNPVWNAFKAVMTLLLGTIVAAVFADPLVDAVSSFSTA  462

Query  534  TSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFL  355
            +SIP+FF+SF+ LP+A+ +SEAVSA+ F  RK+L +ASLT+S++YG+VTM+N+L LSVFL
Sbjct  463  SSIPSFFVSFVILPIAS-TSEAVSALNFTGRKQLTTASLTYSQIYGSVTMSNILSLSVFL  521

Query  354  ALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDY  175
             LVY R LTWDF++EVLVILIVCIVMG   S R+TFPLW S +AF+LYP S+ LVYVLDY
Sbjct  522  GLVYFRDLTWDFAAEVLVILIVCIVMGAIASFRTTFPLWMSLVAFALYPFSLLLVYVLDY  581

Query  174  VFGWS  160
            +FGWS
Sbjct  582  IFGWS  586



>ref|XP_009380498.1| PREDICTED: uncharacterized protein LOC103968880 [Musa acuminata 
subsp. malaccensis]
Length=589

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 200/249 (80%), Gaps = 7/249 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVT---LKHLE  727
            + EI+LD++ AVDK+M +FDTS +  I  +EF+ G+ KW+DE    R+V  +    + L 
Sbjct  345  MGEIDLDKDGAVDKVMNEFDTSRDDNIQEEEFIEGISKWIDEAY--RSVAFSGSYSQKLH  402

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
             FH + R EH +L   DQ+EEA +G E+P W   KA+L L+LGT IAA FADPLVDAVDN
Sbjct  403  HFHVKARNEHNMLH--DQSEEAADGTESPAWICFKAILLLVLGTFIAAVFADPLVDAVDN  460

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS+AT IP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ASLTFSE+YG  TMNNVLCL
Sbjct  461  FSSATKIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTASLTFSEIYGGATMNNVLCL  520

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            +VFL+LVY R LTWDFS+EVLVIL+VCIVMG+F S+R+TFPLWT F+AF LYPLS+ LVY
Sbjct  521  AVFLSLVYVRHLTWDFSAEVLVILVVCIVMGIFTSLRTTFPLWTCFVAFLLYPLSLVLVY  580

Query  186  VLDYVFGWS  160
            VLD+VFGWS
Sbjct  581  VLDFVFGWS  589



>gb|AAK32813.1|AF361800_1 At1g53210/F12M16_12 [Arabidopsis thaliana]
 gb|AAM91449.1| At1g53210/F12M16_12 [Arabidopsis thaliana]
Length=493

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 201/252 (80%), Gaps = 7/252 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS-----RNVPVTLKHL  730
            ++I+ D++DAV K+++DFD + ++++D +EFV G+ +WL +            P T+K L
Sbjct  242  EDIDFDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKQWLIQAMGGAPSGPEAGPRTMKFL  301

Query  729  EDFHEQTRREHYLLGAGDQNEEADEG--VENPKWTSIKAVLFLLLGTAIAAAFADPLVDA  556
            ++FH QT+REH LLG  +  E  +EG  V +PKW +IKA L LLLG AIAAAFADPLVD 
Sbjct  302  DNFHVQTKREHALLGDNENGENDEEGGEVADPKWITIKAALLLLLGAAIAAAFADPLVDT  361

Query  555  VDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNV  376
            V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+
Sbjct  362  VNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNI  421

Query  375  LCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIA  196
            LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ 
Sbjct  422  LCLSVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLG  481

Query  195  LVYVLDYVFGWS  160
            LVY+LDY FGWS
Sbjct  482  LVYILDYWFGWS  493



>ref|XP_010062838.1| PREDICTED: uncharacterized protein LOC104450104 [Eucalyptus grandis]
 gb|KCW69970.1| hypothetical protein EUGRSUZ_F03285 [Eucalyptus grandis]
Length=577

 Score =   308 bits (790),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 195/252 (77%), Gaps = 9/252 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEV-------QVSRNVPVTLK  736
            +EI+LD NDAVD++M  FDTS +  +  DEF  G+ KWLDE         + R     + 
Sbjct  328  EEIDLDANDAVDEIMAAFDTSRDDRLSQDEFRKGIKKWLDEAVRAGKGFGLGRFNTTKII  387

Query  735  HLEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDA  556
             + D   +T RE  L  AG Q +E  + VEN K TS+KAV  L+LGT IAAAFADPLVDA
Sbjct  388  DVADHRAKTEREQLL--AGGQGDEVVKVVENAKMTSLKAVGLLILGTVIAAAFADPLVDA  445

Query  555  VDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNV  376
            VDNFS AT IPTFFISFIALPLATNSSEAVSAIIFASRKK  +ASLTFSELYGAVTMNN+
Sbjct  446  VDNFSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQETASLTFSELYGAVTMNNL  505

Query  375  LCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIA  196
            LCL+VFLALVY RGLTWDF+SEV+VI+IVCIVMGVFGS R+TFPLWT+ +AF LYP S+A
Sbjct  506  LCLAVFLALVYIRGLTWDFTSEVIVIVIVCIVMGVFGSFRNTFPLWTASVAFVLYPFSLA  565

Query  195  LVYVLDYVFGWS  160
            LVYVLDYV GWS
Sbjct  566  LVYVLDYVLGWS  577



>ref|XP_010276580.1| PREDICTED: uncharacterized protein LOC104611295 [Nelumbo nucifera]
Length=577

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/250 (60%), Positives = 194/250 (78%), Gaps = 9/250 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS-----RNVPVTLKHL  730
            DE++LD++  V++++KDFDTS++  I+  EF+ G+ KWL+  + S      +   +++ +
Sbjct  332  DEVDLDQDGFVEEMLKDFDTSHDSYIEESEFIEGISKWLNVAKHSVASHHNSTSDSVRFI  391

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             +   + ++E YLLG  D   E  EGV+NPKW S+KAVL LLLGT IAAAFADPLVDAVD
Sbjct  392  NELRNKAKKEEYLLGCSD---ETTEGVKNPKWDSVKAVLMLLLGTGIAAAFADPLVDAVD  448

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIP FF+SFI LPLAT SSEAVSA+IFASRKK ++ASLTFS +YG+VTM+N+L 
Sbjct  449  NFSNATSIPAFFVSFIVLPLAT-SSEAVSALIFASRKKQKTASLTFSMIYGSVTMSNILS  507

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+VFLA+VY R LTWDFSSEV +I I+C +MG+F S R+TFPLWT  +A+ LYPLS+ LV
Sbjct  508  LAVFLAVVYIRNLTWDFSSEVFIIFIICTIMGLFASFRTTFPLWTCLVAYLLYPLSLVLV  567

Query  189  YVLDYVFGWS  160
            YVLDYV GWS
Sbjct  568  YVLDYVLGWS  577



>ref|NP_564623.2| Na+/Ca 2+ exchanger-like protein [Arabidopsis thaliana]
 gb|AAM20402.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32908.1| sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Arabidopsis thaliana]
Length=585

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 201/252 (80%), Gaps = 7/252 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS-----RNVPVTLKHL  730
            ++I+ D++DAV K+++DFD + ++++D +EFV G+ +WL +            P T+K L
Sbjct  334  EDIDFDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKQWLIQAMGGAPSGPEAGPRTMKFL  393

Query  729  EDFHEQTRREHYLLGAGDQNEEADEG--VENPKWTSIKAVLFLLLGTAIAAAFADPLVDA  556
            ++FH QT+REH LLG  +  E  +EG  V +PKW +IKA L LLLG AIAAAFADPLVD 
Sbjct  394  DNFHVQTKREHALLGDNENGENDEEGGEVADPKWITIKAALLLLLGAAIAAAFADPLVDT  453

Query  555  VDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNV  376
            V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+
Sbjct  454  VNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNI  513

Query  375  LCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIA  196
            LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ 
Sbjct  514  LCLSVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLG  573

Query  195  LVYVLDYVFGWS  160
            LVY+LDY FGWS
Sbjct  574  LVYILDYWFGWS  585



>gb|AAF69532.1|AC008007_7 F12M16.12 [Arabidopsis thaliana]
Length=574

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 201/252 (80%), Gaps = 7/252 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS-----RNVPVTLKHL  730
            ++I+ D++DAV K+++DFD + ++++D +EFV G+ +WL +            P T+K L
Sbjct  323  EDIDFDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKQWLIQAMGGAPSGPEAGPRTMKFL  382

Query  729  EDFHEQTRREHYLLGAGDQNEEADEG--VENPKWTSIKAVLFLLLGTAIAAAFADPLVDA  556
            ++FH QT+REH LLG  +  E  +EG  V +PKW +IKA L LLLG AIAAAFADPLVD 
Sbjct  383  DNFHVQTKREHALLGDNENGENDEEGGEVADPKWITIKAALLLLLGAAIAAAFADPLVDT  442

Query  555  VDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNV  376
            V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN+
Sbjct  443  VNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNNI  502

Query  375  LCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIA  196
            LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+ 
Sbjct  503  LCLSVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFSLG  562

Query  195  LVYVLDYVFGWS  160
            LVY+LDY FGWS
Sbjct  563  LVYILDYWFGWS  574



>emb|CDY55841.1| BnaCnng29300D [Brassica napus]
Length=585

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 165/254 (65%), Positives = 202/254 (80%), Gaps = 10/254 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRN------VPVTLKH  733
            ++IN D++DAV ++++DFD + ++E+D +EFV G+  WL +   +         P T+K 
Sbjct  333  EDINFDKDDAVGRVLQDFDKTLDEEVDQEEFVRGIKHWLIQAMGASGHSGPDAGPRTMKF  392

Query  732  LEDFHEQTRREHYLLG---AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
            L+ FH QT+REH LLG    G+ +EE+ E V +PKW +IKA L LLLG AIAAAFADPLV
Sbjct  393  LDHFHVQTKREHALLGDNENGENDEESGE-VADPKWITIKAALLLLLGAAIAAAFADPLV  451

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
            D V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMN
Sbjct  452  DTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMN  511

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            N+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S
Sbjct  512  NILCLSVFLAIVYVRGLTWNFSSEVLVILIVCLVMGCFASFRTTYPLWTCFIAYLLYPFS  571

Query  201  IALVYVLDYVFGWS  160
            + LVY+LDY FGWS
Sbjct  572  LGLVYILDYWFGWS  585



>emb|CDY25725.1| BnaC03g69500D [Brassica napus]
Length=581

 Score =   307 bits (786),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 205/254 (81%), Gaps = 10/254 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV------PVTLKH  733
            ++I+LD++DAV K+++DFD + ++++D +EFV G+ +WL +   +         P T+K+
Sbjct  329  EDIDLDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKRWLIQAMGAAGPSGPGAGPRTMKY  388

Query  732  LEDFHEQTRREHYLLG---AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
            L+ FH QT+REH LLG    G+ +EE+ E V +PKW +IKA L LLLG AIAAAFADPLV
Sbjct  389  LDHFHVQTKREHALLGDDDNGENDEESGE-VADPKWVTIKAALLLLLGAAIAAAFADPLV  447

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
            D V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMN
Sbjct  448  DTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMN  507

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            N+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S
Sbjct  508  NILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFS  567

Query  201  IALVYVLDYVFGWS  160
            + LVY+LDY FGW+
Sbjct  568  LGLVYILDYWFGWA  581



>ref|XP_009144785.1| PREDICTED: uncharacterized protein LOC103868446 [Brassica rapa]
Length=585

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 202/254 (80%), Gaps = 10/254 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRN------VPVTLKH  733
            ++I+ D++DAV ++++DFD + ++E+D +EFV G+  WL +   +         P T+K 
Sbjct  333  EDIDFDKDDAVGRVLQDFDKTLDEEVDQEEFVRGIKHWLIQAMGASGHSGPDAGPRTMKF  392

Query  732  LEDFHEQTRREHYLLG---AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
            L+ FH QT+REH LLG    G+ +EE+ E V +PKW +IKA L LLLG AIAAAFADPLV
Sbjct  393  LDHFHVQTKREHALLGDNENGENDEESGE-VADPKWITIKAALLLLLGAAIAAAFADPLV  451

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
            D V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMN
Sbjct  452  DTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMN  511

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            N+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S
Sbjct  512  NILCLSVFLAIVYVRGLTWNFSSEVLVILIVCLVMGCFASFRTTYPLWTCFIAYLLYPFS  571

Query  201  IALVYVLDYVFGWS  160
            + LVY+LDY FGWS
Sbjct  572  LGLVYILDYWFGWS  585



>gb|KCW67441.1| hypothetical protein EUGRSUZ_F011931, partial [Eucalyptus grandis]
Length=242

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -3

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            D +EQT +EH  L +GDQ +E  EGV N K T++KAVL L+LGT IA  FADPLVDAVDN
Sbjct  54   DLNEQTTQEHARLKSGDQTDEVTEGVGNRKLTTLKAVLLLVLGTIIAGVFADPLVDAVDN  113

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IPTFFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSELYGAVTMNN+LCL
Sbjct  114  FSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSELYGAVTMNNLLCL  173

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            SVFLA+VY +GLTWDFSSEVLVILIVC VMG F S R+TFPLWT  +A  LYP S+ALVY
Sbjct  174  SVFLAIVYIKGLTWDFSSEVLVILIVCFVMGTFASFRTTFPLWTFSLALLLYPFSLALVY  233

Query  186  VLDYVFGWS  160
            +LDY+FGWS
Sbjct  234  ILDYIFGWS  242



>emb|CDY25869.1| BnaA05g14600D [Brassica napus]
Length=585

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 202/254 (80%), Gaps = 10/254 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRN------VPVTLKH  733
            ++I+ D++DAV ++++DFD + ++E+D +EFV G+  WL +   +         P T+K 
Sbjct  333  EDIDFDKDDAVGRVLQDFDKTLDEEVDQEEFVRGIKHWLIQAMGASGHSGPDAGPRTMKF  392

Query  732  LEDFHEQTRREHYLLG---AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
            L+ FH QT+REH LLG    G+ +EE+ E V +PKW +IKA L LLLG AIAAAFADPLV
Sbjct  393  LDHFHVQTKREHALLGDNENGENDEESGE-VADPKWITIKAALLLLLGAAIAAAFADPLV  451

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
            D V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMN
Sbjct  452  DTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMN  511

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            N+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S
Sbjct  512  NILCLSVFLAIVYVRGLTWNFSSEVLVILIVCLVMGCFASFRTTYPLWTCFIAYLLYPFS  571

Query  201  IALVYVLDYVFGWS  160
            + LVY+LDY FGWS
Sbjct  572  LGLVYILDYWFGWS  585



>ref|XP_008783929.1| PREDICTED: uncharacterized protein LOC103703017 [Phoenix dactylifera]
Length=641

 Score =   306 bits (785),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 205/248 (83%), Gaps = 5/248 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ---VSRNVPVTLKHLED  724
            +EI+LD +DAV+K+M +FDTS+N  I+ DEFV G+ KW++E +   V+ +   + + L D
Sbjct  396  EEIDLDRDDAVEKVMLEFDTSHNAFIEEDEFVEGIKKWINEAKRTIVTTSGAYSQRFLHD  455

Query  723  FHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNF  544
            FH +T+ EH +L   D+++EA E ++NP WT +KAVL LLLGT IAA FADPLVDAVDNF
Sbjct  456  FHMKTKEEHNMLI--DKSDEAVESIDNPTWTCLKAVLLLLLGTVIAAVFADPLVDAVDNF  513

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  364
            S AT+IP+FFISFIA+PLATNSSEAVSAIIFASRKK R++SLTFSE+YG VTMNN LCL+
Sbjct  514  SLATNIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTSSLTFSEIYGGVTMNNTLCLA  573

Query  363  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  184
            VFLALVY R LTWDFS+EVLVIL+VCIVMG+F S R+ FPLWT FIA+ LYPLS+ +VY+
Sbjct  574  VFLALVYLRHLTWDFSAEVLVILVVCIVMGLFTSFRTKFPLWTCFIAYLLYPLSLVIVYI  633

Query  183  LDYVFGWS  160
            LD+VFGWS
Sbjct  634  LDFVFGWS  641



>ref|XP_006392816.1| hypothetical protein EUTSA_v10011341mg [Eutrema salsugineum]
 gb|ESQ30102.1| hypothetical protein EUTSA_v10011341mg [Eutrema salsugineum]
Length=585

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 163/254 (64%), Positives = 204/254 (80%), Gaps = 10/254 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV------PVTLKH  733
            ++I+ D++DAV K+++DFD + ++++D +EFV G+ +WL +   +         P T+K 
Sbjct  333  EDIDFDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKQWLIQAMGAAGPAGPDAGPRTMKF  392

Query  732  LEDFHEQTRREHYLLG---AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
            L+ FH+QT+REH LLG    G+ +E++ E V +PKW +IKA L LLLG AIAAAFADPLV
Sbjct  393  LDHFHKQTKREHALLGDNENGENDEDSGE-VADPKWITIKAALLLLLGAAIAAAFADPLV  451

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
            D V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMN
Sbjct  452  DTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMN  511

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            N+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S
Sbjct  512  NILCLSVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFS  571

Query  201  IALVYVLDYVFGWS  160
            + LVY+LDY FGWS
Sbjct  572  LGLVYILDYWFGWS  585



>ref|XP_007021639.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
 gb|EOY13164.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
Length=707

 Score =   308 bits (789),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 182/225 (81%), Gaps = 5/225 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            +EI+LD++DA+ K+M DFD S +  +   EFV G++KW+ E + +    +     T K +
Sbjct  330  EEIDLDKDDALRKVMADFDISLDSLVQEGEFVRGIEKWIIEAKRTGGTYLEPNKGTFKFI  389

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH+Q +REH LLG+ +Q +E  E VENP WTS+KAVL LLLGT IAAAFADPLVDAVD
Sbjct  390  DHFHKQAKREHDLLGSEEQTDEVVEDVENPGWTSLKAVLMLLLGTLIAAAFADPLVDAVD  449

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFS ATSIP+FFISF+ALPLA+NSS+AV AIIFASRKK R+ASLTFSELY  VTMNNVLC
Sbjct  450  NFSIATSIPSFFISFVALPLASNSSKAVPAIIFASRKKKRTASLTFSELYATVTMNNVLC  509

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWT  235
            LSVFLALVYARGLTWDFSSEVLVILIVCIVMG F S R+TFPLWT
Sbjct  510  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGAFASFRTTFPLWT  554



>ref|XP_009106991.1| PREDICTED: uncharacterized protein LOC103832685 [Brassica rapa]
 emb|CDY02520.1| BnaA08g01270D [Brassica napus]
Length=583

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 203/254 (80%), Gaps = 10/254 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV------PVTLKH  733
            ++I+ D++DAV K+++DFD + ++++D +EFV G+ +WL +   +         P T+K 
Sbjct  331  EDIDFDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKRWLIQAMGAAGPSGPDAGPRTMKF  390

Query  732  LEDFHEQTRREHYLLG---AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
            L+ FH QT+REH LLG    G+ +EE+ E V +PKW +IKA L LLLG AIAAAFADPLV
Sbjct  391  LDHFHVQTKREHALLGDNENGENDEESGE-VADPKWITIKAALLLLLGAAIAAAFADPLV  449

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
            D V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMN
Sbjct  450  DTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMN  509

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            N+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S
Sbjct  510  NILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFS  569

Query  201  IALVYVLDYVFGWS  160
            + LVY+LDY FGWS
Sbjct  570  LGLVYILDYWFGWS  583



>ref|XP_009147618.1| PREDICTED: uncharacterized protein LOC103871140 [Brassica rapa]
Length=576

 Score =   303 bits (777),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 202/254 (80%), Gaps = 10/254 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV------PVTLKH  733
            ++I+ D++DAV K+++DFD + ++++D +EFV G+  WL +   +         P T+K 
Sbjct  324  EDIDFDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKHWLIQAMGAAGPSGPDAGPRTMKF  383

Query  732  LEDFHEQTRREHYLLG---AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
            L+ FH QT+REH LLG    G+ +EE+ E V +PKW +IKA L LLLG AIAAAFADPLV
Sbjct  384  LDHFHVQTKREHALLGDNENGENDEESGE-VADPKWITIKAALLLLLGAAIAAAFADPLV  442

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
            D V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMN
Sbjct  443  DTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMN  502

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            N+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S
Sbjct  503  NILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFS  562

Query  201  IALVYVLDYVFGWS  160
            + LVY+LDY FGWS
Sbjct  563  LGLVYILDYWFGWS  576



>ref|XP_008673552.1| PREDICTED: uncharacterized protein LOC103649588 [Zea mays]
Length=575

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 197/249 (79%), Gaps = 8/249 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV----TLKHLE  727
            +E++ D  DAVDK+M DFDTS N  ++ +EFV G+ KWL+E +  R+VPV    + K + 
Sbjct  331  EEVDFDRTDAVDKVMDDFDTSRNDVVEQEEFVQGMKKWLNEAK--RSVPVGGAFSTKFIN  388

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            ++HE+TR+EH  L   D+++EA E VENP W   KAV  LLLG AIAAAFADPLVDAV N
Sbjct  389  EYHERTRQEHNELV--DRSDEAVESVENPGWCIAKAVALLLLGAAIAAAFADPLVDAVHN  446

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  447  FSNATHIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  506

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYP S+ LVY
Sbjct  507  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPFSLVLVY  566

Query  186  VLDYVFGWS  160
            +LDYVFGWS
Sbjct  567  ILDYVFGWS  575



>emb|CDY24108.1| BnaA06g01060D [Brassica napus]
Length=648

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 202/254 (80%), Gaps = 10/254 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV------PVTLKH  733
            ++I+ D++DAV K+++DFD + ++++D +EFV G+  WL +   +         P T+K 
Sbjct  396  EDIDFDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKHWLIQAMGAAGPSGPDAGPRTMKF  455

Query  732  LEDFHEQTRREHYLLG---AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
            L+ FH QT+REH LLG    G+ +EE+ E V +PKW +IKA L LLLG AIAAAFADPLV
Sbjct  456  LDHFHVQTKREHALLGDNENGENDEESGE-VADPKWITIKAALLLLLGAAIAAAFADPLV  514

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
            D V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMN
Sbjct  515  DTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMN  574

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            N+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S
Sbjct  575  NILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFS  634

Query  201  IALVYVLDYVFGWS  160
            + LVY+LDY FGWS
Sbjct  635  LGLVYILDYWFGWS  648



>ref|XP_006307087.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
 gb|EOA39985.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
Length=461

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 165/253 (65%), Positives = 199/253 (79%), Gaps = 8/253 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV------PVTLKH  733
            +EI+ D++DAV K+++DFD + ++++D DEFV G+  WL +   +         P T+K 
Sbjct  209  EEIDFDKDDAVGKVLQDFDKTLDEQVDQDEFVRGIKHWLLQAMGTAGPAGPDAGPRTMKF  268

Query  732  LEDFHEQTRREHYLLG--AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
            L+ FH QT+REH LLG     +NEE    V +PKW +IKA L LLLG AIAAAFADPLVD
Sbjct  269  LDHFHVQTKREHTLLGDNENGENEEEGGEVADPKWITIKAALLLLLGAAIAAAFADPLVD  328

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
             V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN
Sbjct  329  TVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNN  388

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
            +LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+
Sbjct  389  ILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSL  448

Query  198  ALVYVLDYVFGWS  160
             LVY+LDY FGWS
Sbjct  449  GLVYILDYWFGWS  461



>gb|ACY66874.1| P20Sh095F0 [Saccharum hybrid cultivar R570]
Length=573

 Score =   300 bits (769),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 162/248 (65%), Positives = 194/248 (78%), Gaps = 7/248 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVT---LKHLED  724
            +E+  D  DAVDK+M DFDTS N  ++ +EFV G+ KWL+E +  R++PV       L +
Sbjct  330  NEVEFDRTDAVDKVMADFDTSRNDIVEEEEFVQGMKKWLNEAK--RHMPVGGAFSNKLNE  387

Query  723  FHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNF  544
            +HE+TR+EH  L   D+++EA E VENP W   KAV  LLLG AIAAAFADPLVDAV NF
Sbjct  388  YHERTRQEHNELV--DRSDEAVETVENPGWCITKAVALLLLGAAIAAAFADPLVDAVHNF  445

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  364
            S AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL 
Sbjct  446  SNATHIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCLG  505

Query  363  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  184
            VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYP S+ +VY+
Sbjct  506  VFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPFSLVIVYI  565

Query  183  LDYVFGWS  160
            LDYVFGWS
Sbjct  566  LDYVFGWS  573



>gb|ACY66868.1| P20Sh148J07 [Saccharum hybrid cultivar R570]
Length=563

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 194/246 (79%), Gaps = 5/246 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVT-LKHLEDFH  718
            +E+  D  DAVDK+M DFDTS N  ++ +EFV G+ KWL+E +  R++PV       ++H
Sbjct  322  NEVQFDSTDAVDKVMADFDTSRNDIVEEEEFVQGMKKWLNEAK--RHMPVGDASKFNEYH  379

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFST  538
            E+TR+EH  L   D+++EA E VENP W   KAV  LLLG AIAAAFADPLVDAV NFS 
Sbjct  380  ERTRQEHDQLI--DRSDEAVESVENPGWCITKAVALLLLGAAIAAAFADPLVDAVHNFSN  437

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  358
            AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R++SLTFSE+YG VTMNN LCL VF
Sbjct  438  ATHIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTSSLTFSEVYGGVTMNNTLCLGVF  497

Query  357  LALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLD  178
            LAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYP S+ +VY+LD
Sbjct  498  LALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPFSLVIVYILD  557

Query  177  YVFGWS  160
            YVFGWS
Sbjct  558  YVFGWS  563



>gb|KDP31770.1| hypothetical protein JCGZ_12231 [Jatropha curcas]
Length=577

 Score =   300 bits (768),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 194/251 (77%), Gaps = 9/251 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS-----RNVPVTLKHL  730
            +E+++D +DAVD+++KDFDTS +  +D+DEF+ G+ +WLDE   S      +   T K L
Sbjct  330  EELDIDIDDAVDQVLKDFDTSGDTRVDMDEFIHGISRWLDEANHSAKHFNNHRRGTSKLL  389

Query  729  EDFHEQTRREHYLLGAGDQNEE-ADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
             DF +QT +E     +GD+ ++ A+  +ENPKW + KAV+ LLLGT IAA FADPLVDAV
Sbjct  390  TDFDKQTEKEQA--PSGDKKDDSAETSLENPKWNATKAVMMLLLGTVIAAVFADPLVDAV  447

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            DNFSTATSIPTFF++F+ LP A+ SSE VS +IFASRK  RSASL +SE+YG+VTM+NVL
Sbjct  448  DNFSTATSIPTFFVAFVILPFAS-SSEVVSDLIFASRKNSRSASLAYSEIYGSVTMSNVL  506

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
             LSVFL LVY RGLTW+FSSEVL+ILIVC+VMG+  S R+TFP+W S +A++LYP S+ L
Sbjct  507  SLSVFLGLVYFRGLTWNFSSEVLLILIVCVVMGLIASFRTTFPVWMSLVAYALYPFSLLL  566

Query  192  VYVLDYVFGWS  160
             YVL+YV GWS
Sbjct  567  AYVLNYVLGWS  577



>ref|XP_010479874.1| PREDICTED: uncharacterized protein LOC104758667 [Camelina sativa]
Length=585

 Score =   299 bits (765),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 200/255 (78%), Gaps = 12/255 (5%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV--------PVTL  739
            +EI+ D++DAV KL++DFD + ++++D DEFV G+  WL  +Q   N         P T+
Sbjct  333  EEIDFDKDDAVGKLLQDFDKTLDEQVDQDEFVRGIKHWL--LQAMGNSAPAGPDAGPRTM  390

Query  738  KHLEDFHEQTRREHYLLG--AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPL  565
            K L+ FH QT+REH LLG     +NEE    V +PKW +IKA L L+LG AIAAAFADPL
Sbjct  391  KFLDHFHVQTKREHTLLGDNENGENEEEGGEVADPKWITIKAALLLILGAAIAAAFADPL  450

Query  564  VDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTM  385
            VD V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTM
Sbjct  451  VDTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTM  510

Query  384  NNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPL  205
            NN+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP 
Sbjct  511  NNILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGSFASFRTTYPLWTCFIAYLLYPF  570

Query  204  SIALVYVLDYVFGWS  160
            S+ LVY+LDY FGWS
Sbjct  571  SLGLVYILDYWFGWS  585



>gb|ACN36915.1| unknown [Zea mays]
Length=455

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 198/249 (80%), Gaps = 8/249 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV----TLKHLE  727
            +E++ D  DAVDK+M DFDTS N  ++ +EFV G+ KWLDE +  R+VPV    + K + 
Sbjct  211  EEVDFDRTDAVDKVMDDFDTSRNDVVEEEEFVQGMRKWLDEAR--RSVPVGGAFSSKFIH  268

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            ++HE+TR+EH  L   D+++EA E VENP W   KAV  LLLG+A AAAFADPLVDAV  
Sbjct  269  EYHERTRQEHDELV--DRSDEAVESVENPGWCIAKAVALLLLGSAAAAAFADPLVDAVHG  326

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  327  FSNATRIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  386

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A++LYPLS+ +VY
Sbjct  387  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYTLYPLSLIIVY  446

Query  186  VLDYVFGWS  160
            +LDYVFGWS
Sbjct  447  ILDYVFGWS  455



>ref|XP_006307086.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
 gb|EOA39984.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
Length=585

 Score =   298 bits (764),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 165/253 (65%), Positives = 199/253 (79%), Gaps = 8/253 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV------PVTLKH  733
            +EI+ D++DAV K+++DFD + ++++D DEFV G+  WL +   +         P T+K 
Sbjct  333  EEIDFDKDDAVGKVLQDFDKTLDEQVDQDEFVRGIKHWLLQAMGTAGPAGPDAGPRTMKF  392

Query  732  LEDFHEQTRREHYLLG--AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
            L+ FH QT+REH LLG     +NEE    V +PKW +IKA L LLLG AIAAAFADPLVD
Sbjct  393  LDHFHVQTKREHTLLGDNENGENEEEGGEVADPKWITIKAALLLLLGAAIAAAFADPLVD  452

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
             V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN
Sbjct  453  TVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNN  512

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
            +LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+
Sbjct  513  ILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSL  572

Query  198  ALVYVLDYVFGWS  160
             LVY+LDY FGWS
Sbjct  573  GLVYILDYWFGWS  585



>ref|XP_010462200.1| PREDICTED: uncharacterized protein LOC104742841 [Camelina sativa]
Length=581

 Score =   298 bits (764),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 164/253 (65%), Positives = 199/253 (79%), Gaps = 8/253 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV------PVTLKH  733
            +EI+ D++DAV K+++DFD + ++++D DEFV G+  WL +   +         P T+K 
Sbjct  329  EEIDFDKDDAVGKVLQDFDKTLDEQVDQDEFVRGIKHWLLQAMGTAGPAGPDAGPRTMKF  388

Query  732  LEDFHEQTRREHYLLG--AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
            L+ FH QT+REH LLG     +NEE    V +PKW +IKA L L+LG AIAAAFADPLVD
Sbjct  389  LDHFHVQTKREHTLLGDNENGENEEEGGEVADPKWITIKAALLLILGAAIAAAFADPLVD  448

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
             V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN
Sbjct  449  TVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNN  508

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
            +LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S+
Sbjct  509  ILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGSFASFRTTYPLWTCFIAYLLYPFSL  568

Query  198  ALVYVLDYVFGWS  160
             LVY+LDY FGWS
Sbjct  569  GLVYILDYWFGWS  581



>gb|ACN35869.1| unknown [Zea mays]
Length=432

 Score =   293 bits (751),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 197/249 (79%), Gaps = 8/249 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV----TLKHLE  727
            +E++ D  DAVDK+M DFDTS N  ++ +EFV G+ KWLDE +  R+VPV    + K + 
Sbjct  188  EEVDFDRTDAVDKVMDDFDTSRNDVVEEEEFVQGMRKWLDEAR--RSVPVGGAFSSKFIH  245

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            ++HE+TR+EH  L   D+++EA E VENP W   KAV  LLLG+A AAAFADPLVDAV  
Sbjct  246  EYHERTRQEHDELV--DRSDEAVESVENPGWCIAKAVALLLLGSAAAAAFADPLVDAVHG  303

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  304  FSNATRIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  363

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  364  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPLSLIIVY  423

Query  186  VLDYVFGWS  160
            +LDYVFGWS
Sbjct  424  ILDYVFGWS  432



>gb|ACN27225.1| unknown [Zea mays]
Length=487

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 197/249 (79%), Gaps = 8/249 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV----TLKHLE  727
            +E++ D  DAVDK+M DFDTS N  ++ +EFV G+ KWLDE +  R+VPV    + K + 
Sbjct  243  EEVDFDRTDAVDKVMDDFDTSRNDVVEEEEFVQGMRKWLDEAR--RSVPVGGAFSSKFIH  300

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            ++HE+TR+EH  L   D+++EA E VENP W   KAV  LLLG+A AAAFADPLVDAV  
Sbjct  301  EYHERTRQEHDELV--DRSDEAVESVENPGWCIAKAVALLLLGSAAAAAFADPLVDAVHG  358

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  359  FSNATRIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  418

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  419  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPLSLIIVY  478

Query  186  VLDYVFGWS  160
            +LDYVFGWS
Sbjct  479  ILDYVFGWS  487



>gb|KFK35737.1| hypothetical protein AALP_AA4G030000 [Arabis alpina]
Length=533

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/253 (64%), Positives = 197/253 (78%), Gaps = 8/253 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV------PVTLKH  733
            ++I+ D++DAV K+++DFD + ++++DI+EFV G+  WL +             P T+K 
Sbjct  281  EDIDFDKDDAVGKVLQDFDKTLDEQVDIEEFVRGIKLWLIQAMGGAGPAGPDAGPRTMKF  340

Query  732  LEDFHEQTRREHYLLGAGDQNEEADE--GVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
            L+ FH QT+REH LLG  D  E  +E   V N KW   KA L LLLG +IAAAFADPLVD
Sbjct  341  LDTFHVQTKREHALLGDNDNGENEEEGEHVGNRKWIITKAALLLLLGASIAAAFADPLVD  400

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
             V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTMNN
Sbjct  401  TVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTMNN  460

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
            +LCLSVFLA+VY RGLTW+FSSEVLVILIVCIVMG F S R+T+PLWT FIA++LYP S+
Sbjct  461  ILCLSVFLAIVYVRGLTWNFSSEVLVILIVCIVMGTFASFRTTYPLWTCFIAYALYPFSL  520

Query  198  ALVYVLDYVFGWS  160
             LVY+LDY FGWS
Sbjct  521  GLVYILDYWFGWS  533



>emb|CDY26003.1| BnaC06g06210D [Brassica napus]
Length=571

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 200/254 (79%), Gaps = 10/254 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV------PVTLKH  733
            ++I+ D++DAV K+++DFD + ++++D +EFV G+  WL +   +         P T+K 
Sbjct  319  EDIDFDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKHWLIQAMGAAGPSGPDAGPRTMKF  378

Query  732  LEDFHEQTRREHYLLG---AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
            L+ FH QT+REH LLG    G+ +EE+ E V + KW +IKA L LLLG AIAAAFADPLV
Sbjct  379  LDHFHVQTKREHALLGDNENGENDEESGE-VADRKWITIKAALLLLLGAAIAAAFADPLV  437

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
            D V+NFS AT IP+FFISFIALPLATNSSE+VSAIIFASRKK+R+ASLTFSEL G  TMN
Sbjct  438  DTVNNFSAATGIPSFFISFIALPLATNSSESVSAIIFASRKKIRTASLTFSELCGGATMN  497

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            N+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S
Sbjct  498  NILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFS  557

Query  201  IALVYVLDYVFGWS  160
            + LVY+LDY FGWS
Sbjct  558  LGLVYILDYWFGWS  571



>ref|XP_010500958.1| PREDICTED: uncharacterized protein LOC104778258 [Camelina sativa]
Length=585

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 201/255 (79%), Gaps = 12/255 (5%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV--------PVTL  739
            +EI+ D++DAV K+++DFD + ++++D DEFV G+  WL  +Q   N         P T+
Sbjct  333  EEIDFDKDDAVGKVLQDFDKTLDEQVDEDEFVRGIKHWL--LQAMGNAAPAGPDAGPRTM  390

Query  738  KHLEDFHEQTRREHYLLGAGDQNEEADEG--VENPKWTSIKAVLFLLLGTAIAAAFADPL  565
            K L+ FH QT+REH LLG  D  E  +EG  V +PKW +IKA L L+LG AIAAAFADPL
Sbjct  391  KFLDHFHVQTKREHTLLGDNDNGENEEEGGEVSDPKWITIKAALLLILGAAIAAAFADPL  450

Query  564  VDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTM  385
            VD V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G VTM
Sbjct  451  VDTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTM  510

Query  384  NNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPL  205
            NN+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP 
Sbjct  511  NNILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGSFASFRTTYPLWTCFIAYLLYPF  570

Query  204  SIALVYVLDYVFGWS  160
            S+ LVY+LDY FGWS
Sbjct  571  SLGLVYILDYWFGWS  585



>gb|KCW44589.1| hypothetical protein EUGRSUZ_L01893 [Eucalyptus grandis]
Length=422

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 163/251 (65%), Positives = 193/251 (77%), Gaps = 7/251 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS------RNVPVTLKH  733
            +EI+LD +DA DK+M  FDTS++  +  DEF  G+ K L +   S      +NV   +K 
Sbjct  173  EEIDLDASDA-DKIMAAFDTSHDNRLSYDEFRKGIKKCLKKAVRSGKGSNLKNVVDAIKI  231

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            ++    Q + EH  L  G+Q++   E VEN K TS+KAV  L+LGT IAAAFADPLVDAV
Sbjct  232  IDHAGHQAKNEHEQLLEGEQSDVVVEIVENVKMTSLKAVGLLILGTVIAAAFADPLVDAV  291

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            D FS AT IPTFFISFI LPLATNSSEAVSAIIFASRKK ++ASLTFSELYGAVT+NN+L
Sbjct  292  DYFSDATGIPTFFISFIVLPLATNSSEAVSAIIFASRKKQKTASLTFSELYGAVTVNNLL  351

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CL+VFLALVY RGLTWDF+SEV+VILIVCIVMG+F S R+TFPLWT  +AF LYP S+AL
Sbjct  352  CLAVFLALVYIRGLTWDFTSEVIVILIVCIVMGIFASFRTTFPLWTVSVAFILYPFSLAL  411

Query  192  VYVLDYVFGWS  160
            VYVLDYV GWS
Sbjct  412  VYVLDYVLGWS  422



>ref|NP_001151543.1| LOC100285177 precursor [Zea mays]
 gb|ACG43258.1| calcium ion binding protein [Zea mays]
Length=568

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 197/249 (79%), Gaps = 8/249 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV----TLKHLE  727
            +E++ D  DAVDK+M DFDTS N  ++ +EFV G+ KWLDE +  R+VPV    + K + 
Sbjct  324  EEVDFDRTDAVDKVMDDFDTSRNDVVEEEEFVQGMRKWLDEAR--RSVPVGGAFSSKFIH  381

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            ++HE+TR+EH  L   D+++EA E VENP W   KAV  LLLG+A AAAFADPLVDAV  
Sbjct  382  EYHERTRQEHDELV--DRSDEAVESVENPGWCIAKAVALLLLGSAAAAAFADPLVDAVHG  439

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  440  FSNATRIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  499

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  500  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPLSLIIVY  559

Query  186  VLDYVFGWS  160
            +LDYVFGWS
Sbjct  560  ILDYVFGWS  568



>ref|XP_008655084.1| PREDICTED: LOC100285177 isoform X1 [Zea mays]
Length=596

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 197/249 (79%), Gaps = 8/249 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV----TLKHLE  727
            +E++ D  DAVDK+M DFDTS N  ++ +EFV G+ KWLDE +  R+VPV    + K + 
Sbjct  352  EEVDFDRTDAVDKVMDDFDTSRNDVVEEEEFVQGMRKWLDEAR--RSVPVGGAFSSKFIH  409

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            ++HE+TR+EH  L   D+++EA E VENP W   KAV  LLLG+A AAAFADPLVDAV  
Sbjct  410  EYHERTRQEHDELV--DRSDEAVESVENPGWCIAKAVALLLLGSAAAAAFADPLVDAVHG  467

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  468  FSNATRIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  527

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  528  GVFLALIYFRNLTWDFSSEVLIILLVCVVMALFTSFRTTFPLWTCLVAYMLYPLSLIIVY  587

Query  186  VLDYVFGWS  160
            +LDYVFGWS
Sbjct  588  ILDYVFGWS  596



>ref|XP_002891737.1| sodium/calcium exchanger family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67996.1| sodium/calcium exchanger family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 200/254 (79%), Gaps = 9/254 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            +EI+ D++DAV KL++DFD + ++++D +EFV G+  WL +            P T+K L
Sbjct  335  EEIDFDKDDAVGKLLQDFDKTLDEQVDEEEFVRGIKHWLIQAMGGAPSGPDAGPRTMKFL  394

Query  729  EDFHEQTRREHYLLGAGDQNEEADEG----VENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
            ++FH QT+REH LLG  +  E  +EG    V +PKW +IKA L LLLG AIAAAFADPLV
Sbjct  395  DNFHVQTKREHALLGDNENGENDEEGEGGEVADPKWVTIKAALLLLLGAAIAAAFADPLV  454

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
            D V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSE+ G VTMN
Sbjct  455  DTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSEICGGVTMN  514

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            N+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ LYP S
Sbjct  515  NILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLYPFS  574

Query  201  IALVYVLDYVFGWS  160
            + LVY+LDY FGWS
Sbjct  575  LGLVYILDYWFGWS  588



>ref|XP_009409407.1| PREDICTED: uncharacterized protein LOC103991626 [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 196/247 (79%), Gaps = 4/247 (2%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            + E+NLD +  VDK+MK+FDTS++  I  +EF+ G+ KW+ +V   R+       + D++
Sbjct  345  IHEVNLDNDVVVDKIMKEFDTSHDGNIQEEEFIKGISKWITKVN-HRSSASHSNDIVDYY  403

Query  717  EQTRREHYLLGAGDQ-NEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
             + R +  +L   DQ +E A+E ++NP  T + ++L L+LGT+IAA FADPLVDAVDNFS
Sbjct  404  MEAREQRNMLI--DQIDEAAEENIKNPASTCVTSILLLILGTSIAAVFADPLVDAVDNFS  461

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             AT IP+FFISFIA+PLATNSSEAVSAIIFASRK  R+ASLTFSE+YG VTMNN LCL+V
Sbjct  462  IATKIPSFFISFIAMPLATNSSEAVSAIIFASRKTQRTASLTFSEIYGGVTMNNTLCLAV  521

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLALVY R LTWDFS+EVLVILIVC+VMG+F S+R+TFPLWT F+AF LYPL++ LVYVL
Sbjct  522  FLALVYVRHLTWDFSAEVLVILIVCVVMGIFTSLRTTFPLWTCFVAFLLYPLALVLVYVL  581

Query  180  DYVFGWS  160
            D+VFGWS
Sbjct  582  DFVFGWS  588



>ref|XP_003571165.2| PREDICTED: uncharacterized protein LOC100833492 isoform X1 [Brachypodium 
distachyon]
Length=639

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 193/247 (78%), Gaps = 4/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            ++I+LD N A D++M DFD S N  I+  EFV GV +WL+E +  V  +   + K +EDF
Sbjct  395  EDIDLDSNLAADQVMADFDRSQNSFIEKGEFVDGVLRWLEEAKRAVVASGAYSKKFMEDF  454

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H   R EH  L   +++EE  E +EN  WT  KAVL LLLG A+AAAFADPLVDAV NFS
Sbjct  455  HATARDEHAALL--NKDEEDGEAIENRTWTCFKAVLLLLLGAAMAAAFADPLVDAVHNFS  512

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
            +ATSIP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL+V
Sbjct  513  SATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCLAV  572

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLALVY RGLTWDFSSEVLVI +VCI+MG+F S R+ FPLWT F+AF LYPLS+ +VY+L
Sbjct  573  FLALVYLRGLTWDFSSEVLVIFLVCIIMGLFTSFRTKFPLWTCFVAFLLYPLSLLMVYIL  632

Query  180  DYVFGWS  160
            DY FGWS
Sbjct  633  DYKFGWS  639



>ref|XP_002279120.1| PREDICTED: uncharacterized protein LOC100253888 [Vitis vinifera]
 emb|CBI21944.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/253 (60%), Positives = 193/253 (76%), Gaps = 11/253 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR-------NVPVTLK  736
            D  +LD ++ V  +MKDFDT+ + +ID++EFV G+ +WL + + S        +  ++ +
Sbjct  328  DAADLDIDETVKSVMKDFDTTGDSQIDMNEFVRGMSRWLTKAKRSAIHAGSDGSNSLSTR  387

Query  735  HLEDFHEQTRREHYLLGAGDQNEEADE-GVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
            ++ DF+ +TR E   L   DQNEE +   ++NPKW + KAV  LLLGT +AA FADPLVD
Sbjct  388  YINDFNLRTREEQDKLE--DQNEEEEVESIKNPKWNASKAVAMLLLGTVVAAIFADPLVD  445

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
            AVDNFSTATSIP+FF+SF+ LP A+ SSEAVSA+IFASRKKLR+ASLTFSE+YG+VTM N
Sbjct  446  AVDNFSTATSIPSFFVSFVVLPFAS-SSEAVSAMIFASRKKLRTASLTFSEIYGSVTMGN  504

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
            +L LSVFL L+Y R LTWDF+SEVL+ILIVCI+MGVF   R+TFPLWTS +AF LYPLS+
Sbjct  505  ILSLSVFLGLIYFRQLTWDFASEVLIILIVCILMGVFAGTRTTFPLWTSLMAFLLYPLSL  564

Query  198  ALVYVLDYVFGWS  160
             LVYVLD   GWS
Sbjct  565  VLVYVLDNYLGWS  577



>ref|XP_010234099.1| PREDICTED: uncharacterized protein LOC100833492 isoform X2 [Brachypodium 
distachyon]
Length=666

 Score =   293 bits (751),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 193/247 (78%), Gaps = 4/247 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            ++I+LD N A D++M DFD S N  I+  EFV GV +WL+E +  V  +   + K +EDF
Sbjct  422  EDIDLDSNLAADQVMADFDRSQNSFIEKGEFVDGVLRWLEEAKRAVVASGAYSKKFMEDF  481

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            H   R EH  L   +++EE  E +EN  WT  KAVL LLLG A+AAAFADPLVDAV NFS
Sbjct  482  HATARDEHAALL--NKDEEDGEAIENRTWTCFKAVLLLLLGAAMAAAFADPLVDAVHNFS  539

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
            +ATSIP+FFISFIA+PLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL+V
Sbjct  540  SATSIPSFFISFIAMPLATNSSEAVSAIIFASRKKQRTLSLTFSEVYGGVTMNNTLCLAV  599

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLALVY RGLTWDFSSEVLVI +VCI+MG+F S R+ FPLWT F+AF LYPLS+ +VY+L
Sbjct  600  FLALVYLRGLTWDFSSEVLVIFLVCIIMGLFTSFRTKFPLWTCFVAFLLYPLSLLMVYIL  659

Query  180  DYVFGWS  160
            DY FGWS
Sbjct  660  DYKFGWS  666



>emb|CAN78652.1| hypothetical protein VITISV_033128 [Vitis vinifera]
Length=598

 Score =   291 bits (745),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 151/253 (60%), Positives = 193/253 (76%), Gaps = 11/253 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR-------NVPVTLK  736
            D  +LD ++ V  +MKDFDT+ + +ID++EFV G+ +WL + + S        +  ++ +
Sbjct  349  DAADLDIDETVKSVMKDFDTTGDSQIDMNEFVRGMSRWLTKAKRSAIHAGSDGSNSLSTR  408

Query  735  HLEDFHEQTRREHYLLGAGDQNEEADE-GVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
            ++ DF+ +TR E   L   DQNEE +   ++NPKW + KAV  LLLGT +AA FADPLVD
Sbjct  409  YINDFNLRTREEQDKLE--DQNEEEEVESIKNPKWNASKAVAMLLLGTVVAAIFADPLVD  466

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
            AVDNFSTATSIP+FF+SF+ LP A+ SSEAVSA+IFASRKKLR+ASLTFSE+YG+VTM N
Sbjct  467  AVDNFSTATSIPSFFVSFVVLPFAS-SSEAVSAMIFASRKKLRTASLTFSEIYGSVTMGN  525

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
            +L LSVFL L+Y R LTWDF+SEVL+ILIVCI+MGVF   R+TFPLWTS +AF LYPLS+
Sbjct  526  ILSLSVFLGLIYFRQLTWDFASEVLIILIVCILMGVFAGTRTTFPLWTSLMAFLLYPLSL  585

Query  198  ALVYVLDYVFGWS  160
             LVYVLD   GWS
Sbjct  586  VLVYVLDNYLGWS  598



>ref|XP_010041151.1| PREDICTED: uncharacterized protein LOC104430086 [Eucalyptus grandis]
Length=579

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 163/251 (65%), Positives = 193/251 (77%), Gaps = 7/251 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS------RNVPVTLKH  733
            +EI+LD +DA DK+M  FDTS++  +  DEF  G+ K L +   S      +NV   +K 
Sbjct  330  EEIDLDASDA-DKIMAAFDTSHDNRLSYDEFRKGIKKCLKKAVRSGKGSNLKNVVDAIKI  388

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            ++    Q + EH  L  G+Q++   E VEN K TS+KAV  L+LGT IAAAFADPLVDAV
Sbjct  389  IDHAGHQAKNEHEQLLEGEQSDVVVEIVENVKMTSLKAVGLLILGTVIAAAFADPLVDAV  448

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            D FS AT IPTFFISFI LPLATNSSEAVSAIIFASRKK ++ASLTFSELYGAVT+NN+L
Sbjct  449  DYFSDATGIPTFFISFIVLPLATNSSEAVSAIIFASRKKQKTASLTFSELYGAVTVNNLL  508

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
            CL+VFLALVY RGLTWDF+SEV+VILIVCIVMG+F S R+TFPLWT  +AF LYP S+AL
Sbjct  509  CLAVFLALVYIRGLTWDFTSEVIVILIVCIVMGIFASFRTTFPLWTVSVAFILYPFSLAL  568

Query  192  VYVLDYVFGWS  160
            VYVLDYV GWS
Sbjct  569  VYVLDYVLGWS  579



>ref|XP_002525142.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF37269.1| calcium ion binding protein, putative [Ricinus communis]
Length=543

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 185/250 (74%), Gaps = 8/250 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR-----NVPVTLKHL  730
            DE+++D + AVD+++KDFDTS +  +D+DEF  G+ KWL E + S      +   + + L
Sbjct  297  DELDIDVSVAVDQVLKDFDTSGDSCVDMDEFTRGISKWLREAKHSARYFDDHSRGSSQVL  356

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
              F +QT  E  +LG  DQ  E      NPKW + KAVL L+LGT +AA FADPLVDAVD
Sbjct  357  TGFDQQTSAEEDVLG--DQTGEISSNPGNPKWNTTKAVLMLILGTIVAAVFADPLVDAVD  414

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFSTA++IPTFF+SF+ LP A+ SSE VS +IFASRKK R ASL +SE+YG+VTM+NVL 
Sbjct  415  NFSTASNIPTFFVSFVILPFAS-SSEVVSDMIFASRKKSRYASLAYSEIYGSVTMSNVLS  473

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            LSVFL LVY RGLTW+FSSEVL+ILIVCI +G+  S+R+TFPLW S +A+++YP S+ L 
Sbjct  474  LSVFLGLVYFRGLTWNFSSEVLIILIVCIAIGLIASLRTTFPLWMSLVAYAMYPFSLLLA  533

Query  189  YVLDYVFGWS  160
            Y+ +YV GWS
Sbjct  534  YIFNYVLGWS  543



>ref|XP_004968611.1| PREDICTED: uncharacterized protein LOC101771765 [Setaria italica]
Length=575

 Score =   282 bits (722),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 197/249 (79%), Gaps = 8/249 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV----TLKHLE  727
            +E++ D+ DAV+K+M DFDTS N  ++ +EFV G+ KWL+E +  R+VP     + K + 
Sbjct  331  EELDFDKMDAVNKVMDDFDTSRNDVVEEEEFVQGMKKWLNEAK--RSVPAGGAFSHKFIN  388

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            DFHE+TR+EH  L   D+++EA E VENP W   KAV  LLLG AIAAAFADPLVD V N
Sbjct  389  DFHERTRQEHDQLI--DRSDEAVESVENPGWCITKAVALLLLGAAIAAAFADPLVDTVHN  446

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK R+ SLTFSE+YG VTMNN LCL
Sbjct  447  FSNATHIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTCSLTFSEVYGGVTMNNTLCL  506

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             VFLAL+Y R LTWDFSSEVL+IL+VC+VM +F S R+TFPLWT  +A+ LYPLS+ +VY
Sbjct  507  GVFLALIYFRNLTWDFSSEVLIILVVCVVMALFTSFRTTFPLWTCLVAYVLYPLSLVIVY  566

Query  186  VLDYVFGWS  160
            +LDYVFGWS
Sbjct  567  ILDYVFGWS  575



>ref|XP_004305436.1| PREDICTED: uncharacterized protein LOC101295737 [Fragaria vesca 
subsp. vesca]
Length=580

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 186/250 (74%), Gaps = 10/250 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR-----NVPVTLKHL  730
            ++IN+  N+A   +MKDFDT+++ +ID+DEF  G+ +W+++ + +       VP+++K L
Sbjct  330  EDINI--NEATSLVMKDFDTTHDSKIDVDEFFKGISRWINKAKHAAMMDRGKVPLSMKLL  387

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            +D+ +QT+ E    G  D  +E  E V+N  W + KAVL LLLGT +AA  ADPLVDAVD
Sbjct  388  DDYDKQTKEEQDRYG--DHIDEIVEDVKNAPWHASKAVLMLLLGTILAAVVADPLVDAVD  445

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFSTATSIPTFF+SF+ LP  + SSE VS +IF SRKK RSASL +SE+YG+VTM+N+L 
Sbjct  446  NFSTATSIPTFFVSFVILPFVS-SSEIVSTLIFVSRKKQRSASLAYSEIYGSVTMSNILS  504

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+VFL LVY R LTW FS+EVLVI+IVCI+MGV    R+TFP+W  F A  LYPLS+ LV
Sbjct  505  LAVFLGLVYIRNLTWSFSAEVLVIIIVCILMGVVACCRTTFPVWLCFGAVMLYPLSLLLV  564

Query  189  YVLDYVFGWS  160
            Y+L+YVFGWS
Sbjct  565  YILEYVFGWS  574



>ref|XP_002522156.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF40235.1| calcium ion binding protein, putative [Ricinus communis]
Length=588

 Score =   275 bits (703),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 175/249 (70%), Gaps = 7/249 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ---VSRNVPVTLKHLED  724
            +EI  D +DA  K+MK+FDTS +  IDI EF  G+ KW +E +   +S N       + D
Sbjct  343  EEIQFDRDDAAKKIMKEFDTSKDNHIDITEFENGIVKWHNEAKQAAISTNSGDHHSLIND  402

Query  723  FHEQTRREHYLLGAGDQNEEADEGVEN-PKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            FH  T++EH LLG   Q++E  EGVEN  +W   K++  LL G  + A  ADPLVDAV N
Sbjct  403  FHRHTKKEHALLGPEAQSDEEVEGVENLGRW---KSIAMLLWGAFLLAVSADPLVDAVKN  459

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS AT++P+FFISF+ LP  TNS EA SAI F S KK+R+ASLT SELYG +T+  +LCL
Sbjct  460  FSKATTVPSFFISFVTLPFITNSGEAFSAITFISHKKMRTASLTLSELYGKITVKILLCL  519

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            SVFL L+Y RGL WDF S+ +V+LIVC VMG F S ++TFPLWTS +A  LYP S+ALVY
Sbjct  520  SVFLGLIYFRGLKWDFMSKAMVLLIVCTVMGAFASFQTTFPLWTSSLACLLYPFSLALVY  579

Query  186  VLDYVFGWS  160
            VLD+V+GWS
Sbjct  580  VLDHVYGWS  588



>ref|XP_009354324.1| PREDICTED: uncharacterized protein LOC103945475 [Pyrus x bretschneideri]
Length=585

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 192/250 (77%), Gaps = 8/250 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR-----NVPVTLKHL  730
            D+I+++ ++A+ ++MKDFDTS++ +ID DEF  G+ +WL++ + +       +P ++K L
Sbjct  339  DDIDINIDEAILQVMKDFDTSHDSKIDEDEFFRGISRWLNKAKRAAIMDRGKIPQSMKLL  398

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            E++ ++T++E+   G  DQ +E  E V+N KW + KAV+ L LGT +AAA ADPLVDAVD
Sbjct  399  EEYDQKTKKEYDQFG--DQIDEVVEDVKNAKWHASKAVVLLFLGTIVAAAVADPLVDAVD  456

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFSTATSIP+FFISF+ LP A+ SSE V+ +IF SRKK R+ASL +SE+YG+VTM+N+L 
Sbjct  457  NFSTATSIPSFFISFVVLPFAS-SSEIVTTLIFVSRKKQRTASLAYSEIYGSVTMSNILS  515

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+VFL LVY R LTW FS+EVLVILIVCI+MG   S R+TFPLW S +A  LYPLS+ LV
Sbjct  516  LAVFLGLVYVRNLTWSFSAEVLVILIVCILMGAIASFRTTFPLWMSSVAILLYPLSLLLV  575

Query  189  YVLDYVFGWS  160
            Y+L+Y+ GWS
Sbjct  576  YILNYICGWS  585



>ref|XP_008362437.1| PREDICTED: uncharacterized protein LOC103426126 [Malus domestica]
Length=549

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 191/250 (76%), Gaps = 8/250 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR-----NVPVTLKHL  730
            D+I+++ ++A+ ++M+DFDTS++ +ID DEF  G+ +WL++ +         +P ++K L
Sbjct  303  DDIDINIDEAIIQVMRDFDTSHDSKIDEDEFFRGISRWLNKAKREAIXDRGKIPXSMKLL  362

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            E++ ++T++E+   G  DQ +E  E V+N KW + KAV+ L LGT +AAA ADPLVDAVD
Sbjct  363  EEYDQKTKKEYDQFG--DQIDEVVEDVKNAKWHASKAVVLLFLGTIVAAAVADPLVDAVD  420

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            +FSTATSIP+FFISF+ LP A+ SSE V+ +IF SRKK R+ASL +SE+YG+VTM+N+L 
Sbjct  421  SFSTATSIPSFFISFVVLPFAS-SSEIVTTLIFXSRKKQRTASLAYSEIYGSVTMSNILS  479

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+VFL LVY R LTW FS+EVLVILIVCI+MG   S R+TFPLW S +A  LYPLS+ LV
Sbjct  480  LAVFLGLVYVRNLTWSFSAEVLVILIVCILMGAIASFRTTFPLWMSSVAILLYPLSLLLV  539

Query  189  YVLDYVFGWS  160
            Y+LDY+ GWS
Sbjct  540  YILDYICGWS  549



>ref|XP_008368645.1| PREDICTED: uncharacterized protein LOC103432241 [Malus domestica]
Length=585

 Score =   267 bits (683),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 191/250 (76%), Gaps = 8/250 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR-----NVPVTLKHL  730
            D+I+++ ++A+ ++M+DFDTS++ +ID DEF  G+ +WL++ +         +P ++K L
Sbjct  339  DDIDINIDEAIIQVMRDFDTSHDSKIDEDEFFRGISRWLNKAKREAIXDRGKIPXSMKLL  398

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            E++ ++T++E+   G  DQ +E  E V+N KW + KAV+ L LGT +AAA ADPLVDAVD
Sbjct  399  EEYDQKTKKEYDQFG--DQIDEVVEDVKNAKWHASKAVVLLFLGTIVAAAVADPLVDAVD  456

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            +FSTATSIP+FFISF+ LP A+ SSE V+ +IF SRKK R+ASL +SE+YG+VTM+N+L 
Sbjct  457  SFSTATSIPSFFISFVVLPFAS-SSEIVTTLIFXSRKKQRTASLAYSEIYGSVTMSNILS  515

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+VFL LVY R LTW FS+EVLVILIVCI+MG   S R+TFPLW S +A  LYPLS+ LV
Sbjct  516  LAVFLGLVYVRNLTWSFSAEVLVILIVCILMGAIASFRTTFPLWMSSVAILLYPLSLLLV  575

Query  189  YVLDYVFGWS  160
            Y+LDY+ GWS
Sbjct  576  YILDYICGWS  585



>ref|XP_006852513.1| hypothetical protein AMTR_s00021p00164610 [Amborella trichopoda]
 gb|ERN13980.1| hypothetical protein AMTR_s00021p00164610 [Amborella trichopoda]
Length=574

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 191/248 (77%), Gaps = 4/248 (2%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVP--VTLKHLED  724
            L+ INLDE   V  +M DFD S +  ID+ EFV G+ KWL E +   + P   + K   D
Sbjct  329  LENINLDEEVDVANVMADFDISYDSNIDLPEFVRGITKWLYEAKNVVDHPGHYSSKFTSD  388

Query  723  FHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNF  544
            FH +T+ E   L   ++++E  EG+EN +   +KAV  LL GT IAA FADPLVDAV NF
Sbjct  389  FHLKTKEELDRLD--NESDEIVEGIENARTVCLKAVFLLLCGTVIAAVFADPLVDAVSNF  446

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  364
            STATSIP+FFISFIA+PLATNSSEAVSA+IFASRKK R+ASLTFSE+YGAVTMNN+LCL+
Sbjct  447  STATSIPSFFISFIAMPLATNSSEAVSALIFASRKKQRTASLTFSEIYGAVTMNNILCLA  506

Query  363  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  184
            VFLALVY R LTWDFS+EVLVIL+V ++MG+ GS R+TFPLW  FIA++LYPLS+ LVY+
Sbjct  507  VFLALVYVRHLTWDFSAEVLVILVVVLIMGLVGSFRTTFPLWACFIAYALYPLSLLLVYL  566

Query  183  LDYVFGWS  160
            LDY FGWS
Sbjct  567  LDYQFGWS  574



>gb|ADE75754.1| unknown [Picea sitchensis]
Length=233

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 174/235 (74%), Gaps = 6/235 (3%)
 Frame = -3

Query  852  MKDFDTSNNQEIDIDEFVAGVDKWLD----EVQVSRNVPVTLKHLEDFHEQTRREHYLLG  685
            M +FD+S ++++ ++EF AG+  WL      V  S++   + K L  F  +++ E   L 
Sbjct  1    MAEFDSSRDEKLSLEEFKAGMSSWLKIATSTVGRSKSNNYSRKFLSSFQSRSKEEVEALE  60

Query  684  AGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPTFFISF  505
              D+ +  +  V+N K   +KAV+ +L G  IA  FADPLV AVDNFS ATSIP+FFISF
Sbjct  61   NADEEDVTE--VDNRKKIYLKAVMLMLGGAIIAGIFADPLVAAVDNFSDATSIPSFFISF  118

Query  504  IALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYARGLTW  325
            I +PLATNSSE VSA+IFASRKK R+ASLTFSE+YGAVTMNN LCL VFLA++Y RGL W
Sbjct  119  IIMPLATNSSEGVSALIFASRKKKRTASLTFSEIYGAVTMNNTLCLGVFLAIIYIRGLDW  178

Query  324  DFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGWS  160
            DFS+EVLVI++V +VMG+ GS R+TFPLW SFIAF  YPL++A+VYVLDYV GWS
Sbjct  179  DFSAEVLVIVLVVLVMGLLGSFRTTFPLWMSFIAFLFYPLTLAIVYVLDYVLGWS  233



>ref|XP_010052488.1| PREDICTED: uncharacterized protein LOC104441166 isoform X2 [Eucalyptus 
grandis]
Length=491

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 186/253 (74%), Gaps = 11/253 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ-------VSRNVPVTLK  736
            +E++++ +DAV K+++DFDTS + ++D  EF+ G+ KWL   +       V  ++ +T +
Sbjct  242  EEVDINMDDAVHKVIEDFDTSRDSKLDSAEFIEGISKWLKRARRTAAGAHVQDDISLTTR  301

Query  735  HLEDFHEQTRREHYLLGAGDQNEEAD-EGVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
             L+ F E+T  E  L    DQ +E + + V+N KW + KA+L LLLGTAIAA  ADPLVD
Sbjct  302  LLDSFDERT--EQQLDQLVDQEDELEVDDVKNVKWNTAKAILMLLLGTAIAAITADPLVD  359

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
            AVDNFSTATSIP+FF+SF+ LP A  SSE VS ++F+SRKK R+ SLT+SE+YG+VTM N
Sbjct  360  AVDNFSTATSIPSFFVSFVILPFAC-SSEVVSCLMFSSRKKKRTTSLTYSEIYGSVTMGN  418

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
            VL L+VFL LVY R LTWDF SEVLV +IVC+VMG   S R+TFPLW SF+A +LYPLS+
Sbjct  419  VLSLAVFLGLVYVRQLTWDFFSEVLVTVIVCLVMGAIASFRTTFPLWMSFLALALYPLSL  478

Query  198  ALVYVLDYVFGWS  160
             LVYVLDYV G S
Sbjct  479  LLVYVLDYVLGLS  491



>gb|EMS60383.1| hypothetical protein TRIUR3_19685 [Triticum urartu]
Length=292

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 177/256 (69%), Gaps = 14/256 (5%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDF  721
            +EI+ D+ND VDK+M DFDTS N  +D +EF+AG+  W++E +  V  +     K + D+
Sbjct  40   EEIDFDKNDVVDKIMDDFDTSGNDTVDEEEFLAGMKIWINEAKRKVQASGAYANKFINDY  99

Query  720  HE---------QTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADP  568
            HE         +TR EH  L   D   E  E VENP    +KAV  +L+G AI AAFADP
Sbjct  100  HEGEEAVGGPPRTREEHDQLAVSD---EEVEPVENPGRMIVKAVGLMLVGAAIPAAFADP  156

Query  567  LVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVT  388
            LVDA+ + S AT + +FF+SF+ LPL  NSSE VSA+    +KK RSASL  SE+Y  VT
Sbjct  157  LVDAIYSLSKATHVSSFFVSFVVLPLVNNSSEVVSAVRSMRKKKRRSASLALSEVYCVVT  216

Query  387  MNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYP  208
            +NN++CL +FLALVYAR +TWDFSSE+L+IL+VCIVMG+F S R+ FPLWT  +A+ LYP
Sbjct  217  VNNLMCLGMFLALVYARDITWDFSSELLIILLVCIVMGLFTSFRTNFPLWTCLVAYLLYP  276

Query  207  LSIALVYVLDYVFGWS  160
            LS+ LV++LD VF WS
Sbjct  277  LSLVLVHILDSVFHWS  292



>ref|XP_006446746.1| hypothetical protein CICLE_v10018123mg, partial [Citrus clementina]
 gb|ESR59986.1| hypothetical protein CICLE_v10018123mg, partial [Citrus clementina]
Length=575

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 177/236 (75%), Gaps = 8/236 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDE-----VQVSRNVPVTLKHL  730
            ++++ + +DA++K+M+DFDTS +  ID  EFV G+ +WL+      +Q   +   T + +
Sbjct  331  EDVDTNIDDAIEKVMEDFDTSKDSCIDEHEFVVGISRWLNRLKHSAIQRQDDGSWTPRLI  390

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DF E+ R E+ LLG  D+N+E  E +ENPKW + KAV  LL+GT +AA  +DPLVDAVD
Sbjct  391  NDFQERARTEYDLLG--DKNDEVAELIENPKWMASKAVSILLMGTIVAAVCSDPLVDAVD  448

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFSTA++IP+ F++FI LP AT SSEAVSA+IFASRK+ R++SLT+S +YG+VTM+N+L 
Sbjct  449  NFSTASNIPSLFVAFIILPFAT-SSEAVSALIFASRKRSRTSSLTYSAIYGSVTMSNILS  507

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            LSVFL+LVY R LTW+FS+EV VIL+VCI+MG+  S R+TFPLW   +A  LYP S
Sbjct  508  LSVFLSLVYFRHLTWNFSAEVSVILLVCILMGLIASFRTTFPLWMCLVACMLYPFS  563



>ref|XP_006469050.1| PREDICTED: uncharacterized protein LOC102616350 [Citrus sinensis]
Length=577

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 177/236 (75%), Gaps = 8/236 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDE-----VQVSRNVPVTLKHL  730
            ++I+++ +DA++K+M+DFDTS +  ID  EF+ G+ +WL+      +Q   +   T + +
Sbjct  331  EDIDMNIDDAIEKVMEDFDTSKDSCIDEHEFIVGISRWLNRLKHSAIQRHDDGSWTPRLI  390

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
             DF E+ R E+ LLG  D+N+E  E +ENPKW + KAV  LL GT +AA  +DPLVDAVD
Sbjct  391  NDFQERARTEYDLLG--DKNDEVAELIENPKWRASKAVSMLLTGTIVAAVCSDPLVDAVD  448

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFSTA++IP+ F++FI LP AT SSEAVSA+IFASRK+ R++SLT+S +YG+VTM+N+L 
Sbjct  449  NFSTASNIPSLFVAFIILPFAT-SSEAVSALIFASRKRSRTSSLTYSAIYGSVTMSNILS  507

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            LSVFL+LVY R LTW+FS+EV VIL+VCI MG+  S R+TFPLW   +A  LYP+S
Sbjct  508  LSVFLSLVYFRHLTWNFSAEVSVILLVCISMGLIASFRTTFPLWMCLVACMLYPIS  563



>gb|KCW89606.1| hypothetical protein EUGRSUZ_A01890 [Eucalyptus grandis]
Length=557

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 186/253 (74%), Gaps = 11/253 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ-------VSRNVPVTLK  736
            +E++++ +DAV K+++DFDTS + ++D  EF+ G+ KWL   +       V  ++ +T +
Sbjct  308  EEVDINMDDAVHKVIEDFDTSRDSKLDSAEFIEGISKWLKRARRTAAGAHVQDDISLTTR  367

Query  735  HLEDFHEQTRREHYLLGAGDQNEEAD-EGVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
             L+ F E+T  E  L    DQ +E + + V+N KW + KA+L LLLGTAIAA  ADPLVD
Sbjct  368  LLDSFDERT--EQQLDQLVDQEDELEVDDVKNVKWNTAKAILMLLLGTAIAAITADPLVD  425

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
            AVDNFSTATSIP+FF+SF+ LP A  SSE VS ++F+SRKK R+ SLT+SE+YG+VTM N
Sbjct  426  AVDNFSTATSIPSFFVSFVILPFAC-SSEVVSCLMFSSRKKKRTTSLTYSEIYGSVTMGN  484

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
            VL L+VFL LVY R LTWDF SEVLV +IVC+VMG   S R+TFPLW SF+A +LYPLS+
Sbjct  485  VLSLAVFLGLVYVRQLTWDFFSEVLVTVIVCLVMGAIASFRTTFPLWMSFLALALYPLSL  544

Query  198  ALVYVLDYVFGWS  160
             LVYVLDYV G S
Sbjct  545  LLVYVLDYVLGLS  557



>ref|XP_010052481.1| PREDICTED: uncharacterized protein LOC104441166 isoform X1 [Eucalyptus 
grandis]
Length=576

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 186/253 (74%), Gaps = 11/253 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ-------VSRNVPVTLK  736
            +E++++ +DAV K+++DFDTS + ++D  EF+ G+ KWL   +       V  ++ +T +
Sbjct  327  EEVDINMDDAVHKVIEDFDTSRDSKLDSAEFIEGISKWLKRARRTAAGAHVQDDISLTTR  386

Query  735  HLEDFHEQTRREHYLLGAGDQNEEAD-EGVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
             L+ F E+T  E  L    DQ +E + + V+N KW + KA+L LLLGTAIAA  ADPLVD
Sbjct  387  LLDSFDERT--EQQLDQLVDQEDELEVDDVKNVKWNTAKAILMLLLGTAIAAITADPLVD  444

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
            AVDNFSTATSIP+FF+SF+ LP A  SSE VS ++F+SRKK R+ SLT+SE+YG+VTM N
Sbjct  445  AVDNFSTATSIPSFFVSFVILPFAC-SSEVVSCLMFSSRKKKRTTSLTYSEIYGSVTMGN  503

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
            VL L+VFL LVY R LTWDF SEVLV +IVC+VMG   S R+TFPLW SF+A +LYPLS+
Sbjct  504  VLSLAVFLGLVYVRQLTWDFFSEVLVTVIVCLVMGAIASFRTTFPLWMSFLALALYPLSL  563

Query  198  ALVYVLDYVFGWS  160
             LVYVLDYV G S
Sbjct  564  LLVYVLDYVLGLS  576



>ref|XP_008229131.1| PREDICTED: uncharacterized protein LOC103328510 [Prunus mume]
Length=575

 Score =   254 bits (648),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 192/250 (77%), Gaps = 8/250 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ----VSR-NVPVTLKHL  730
            D+I+++ ++A+ ++M+DFDTS++ +ID+DEF  G+ KW+++ +    + R  +P ++K L
Sbjct  329  DDIDINIDEAISQVMRDFDTSHDSKIDVDEFFKGISKWINKAKRVAIMERGKLPPSMKLL  388

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            EDF ++T++E       DQ +E  E V+N KW   KAV  LLLGT +AA FADPLVDAVD
Sbjct  389  EDFDKKTKKEQDQFM--DQMDEVVEDVKNVKWHGSKAVGLLLLGTIVAAVFADPLVDAVD  446

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            +FSTATSIP+FFISF+ LP A+ SSE VS +IF SRKK R+ASL +SE+YG+VTM+N+L 
Sbjct  447  DFSTATSIPSFFISFVILPFAS-SSEIVSTLIFVSRKKQRTASLAYSEIYGSVTMSNILS  505

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+VFL LVY R LTW FS+EVLVI++VCI+MG   S R+TFPLW S +A  LYPLS+ LV
Sbjct  506  LAVFLGLVYIRNLTWSFSAEVLVIVVVCILMGAIASFRTTFPLWMSLVAMLLYPLSLLLV  565

Query  189  YVLDYVFGWS  160
            Y+LDYVFGWS
Sbjct  566  YILDYVFGWS  575



>ref|XP_007213018.1| hypothetical protein PRUPE_ppa023026mg [Prunus persica]
 gb|EMJ14217.1| hypothetical protein PRUPE_ppa023026mg [Prunus persica]
Length=575

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 193/250 (77%), Gaps = 8/250 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ----VSR-NVPVTLKHL  730
            D+++++ ++A+ ++M+DFDTS++ +ID+DEF  G+ +W+++ +    + R  +P ++K L
Sbjct  329  DDMDINIDEAISQVMRDFDTSHDSKIDVDEFFKGISRWINKAKRVAIMERGKLPPSMKLL  388

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            EDF ++T++E       DQ +E  E V+N KW + KAV  LLLGT +AA FADPLVDAVD
Sbjct  389  EDFDKKTKKEQDQFM--DQMDEVVEDVKNVKWHASKAVGLLLLGTIVAAVFADPLVDAVD  446

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            NFSTATSIP+FF+SF+ LP A+ SSE VS +IF SRKK R+ASL +SE+YG+VTM+N+L 
Sbjct  447  NFSTATSIPSFFVSFVILPFAS-SSEIVSTLIFVSRKKQRTASLAYSEIYGSVTMSNILS  505

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+VFL LVY R LTW FS+EVLVI++VCI+MG   S R+TFPLW S +A  LYPLS+ LV
Sbjct  506  LAVFLGLVYIRNLTWSFSAEVLVIVVVCILMGAIASFRTTFPLWMSLVAMLLYPLSLLLV  565

Query  189  YVLDYVFGWS  160
            Y+LDYVFGWS
Sbjct  566  YILDYVFGWS  575



>gb|ADM77106.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77107.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77108.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77109.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77110.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77111.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77112.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77113.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77114.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77116.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77117.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77118.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77119.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77120.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77121.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77122.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77123.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77124.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77125.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77126.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77127.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77128.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77129.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77130.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77132.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77133.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77134.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77135.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77136.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77137.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77138.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77139.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77140.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77141.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77142.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77143.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77144.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77145.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77146.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77147.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77148.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77149.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77150.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77151.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77152.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
 gb|ADM77153.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
Length=227

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 169/229 (74%), Gaps = 6/229 (3%)
 Frame = -3

Query  834  SNNQEIDIDEFVAGVDKWLD----EVQVSRNVPVTLKHLEDFHEQTRREHYLLGAGDQNE  667
            S ++++ ++EF AG+  WL      V  S++   + K L  F  +++ E   L   D+ +
Sbjct  1    SRDEKLSLEEFKAGMSSWLKIATSTVGRSKSNNYSRKFLSSFQSRSKEEVEALENADEED  60

Query  666  EADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPTFFISFIALPLA  487
              +  V+N K   +KAV+ +L G  IA  FADPLV AVDNFS ATSIP+FFISFI +PLA
Sbjct  61   VTE--VDNRKKIYLKAVMLMLGGAIIAGIFADPLVAAVDNFSDATSIPSFFISFIIMPLA  118

Query  486  TNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEV  307
            TNSSE VSA+IFASRKK R+ASLTFSE+YGAVTMNN LCL VFLA++Y RGL WDFS+EV
Sbjct  119  TNSSEGVSALIFASRKKKRTASLTFSEIYGAVTMNNTLCLGVFLAIIYIRGLDWDFSAEV  178

Query  306  LVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGWS  160
            LVI++V +VMG+ GS R+TFPLW SFIAF  YPL++A+VYVLDYV GWS
Sbjct  179  LVIVLVVLVMGLLGSFRTTFPLWMSFIAFLFYPLTLAIVYVLDYVLGWS  227



>gb|ADM77115.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
Length=227

 Score =   239 bits (610),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 169/229 (74%), Gaps = 6/229 (3%)
 Frame = -3

Query  834  SNNQEIDIDEFVAGVDKWLD----EVQVSRNVPVTLKHLEDFHEQTRREHYLLGAGDQNE  667
            S ++++ ++EF AG+  WL      V  S++   + K L  F  +++ E   L   D+ +
Sbjct  1    SRDEKLSLEEFKAGMSSWLKIATSTVGRSKSNNYSRKFLSSFQSRSKEEVEALENADEED  60

Query  666  EADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPTFFISFIALPLA  487
              +  V+N K   +KAV+ +L G  IA  FADPLV AVDNFS ATSIP+FFISFI +PLA
Sbjct  61   VTE--VDNRKKIYLKAVMLMLGGAIIAGIFADPLVAAVDNFSDATSIPSFFISFIIMPLA  118

Query  486  TNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEV  307
            TNSSE VSA+IFASRKK R+ASLT+SE+YGAVTMNN LCL VFLA++Y RGL WDFS+EV
Sbjct  119  TNSSEGVSALIFASRKKKRTASLTYSEIYGAVTMNNTLCLGVFLAIIYIRGLDWDFSAEV  178

Query  306  LVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGWS  160
            LVI++V +VMG+ GS R+TFPLW SFIAF  YPL++A+VYVLDYV GWS
Sbjct  179  LVIVLVVLVMGLLGSFRTTFPLWMSFIAFLFYPLTLAIVYVLDYVLGWS  227



>gb|ADM77131.1| sodium/calcium exchanger family-like protein, partial [Picea 
sitchensis]
Length=227

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 168/229 (73%), Gaps = 6/229 (3%)
 Frame = -3

Query  834  SNNQEIDIDEFVAGVDKWLD----EVQVSRNVPVTLKHLEDFHEQTRREHYLLGAGDQNE  667
            S ++++ ++EF AG+  WL      V  S++   + K L  F  +++ E   L   D+ +
Sbjct  1    SRDEKLSLEEFKAGMSSWLKIATSTVGRSKSNNYSRKFLSSFQSRSKEEVEALENADEED  60

Query  666  EADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPTFFISFIALPLA  487
              +  V+N K   +KAV+ +L G  IA  FADPLV AVDNFS ATSIP+FFISFI +PLA
Sbjct  61   VTE--VDNRKKIYLKAVMLMLGGAIIAGIFADPLVAAVDNFSDATSIPSFFISFIIMPLA  118

Query  486  TNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEV  307
            TNSSE VSA+IFASRKK R+ASLTFSE+YGAVTMNN LCL VFLA++Y R L WDFS+EV
Sbjct  119  TNSSEGVSALIFASRKKKRTASLTFSEIYGAVTMNNTLCLGVFLAIIYIRSLDWDFSAEV  178

Query  306  LVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGWS  160
            LVI++V +VMG+ GS R+TFPLW SFIAF  YPL++A+VYVLDYV GWS
Sbjct  179  LVIVLVVLVMGLLGSFRTTFPLWMSFIAFLFYPLTLAIVYVLDYVLGWS  227



>emb|CAN76642.1| hypothetical protein VITISV_042742 [Vitis vinifera]
Length=152

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  615  LFLLLGTAIAAAFADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKK  436
            + LLLGT IAA FADPLVDAVDNFS ATSIPTFFISFIALPLATNSSEAVSAIIFASRKK
Sbjct  1    MMLLLGTLIAAVFADPLVDAVDNFSDATSIPTFFISFIALPLATNSSEAVSAIIFASRKK  60

Query  435  LRSASLTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMR  256
             R+ SLTFSELYGAVTMNNVLCLSVFLALVY RGLTWDFSSEVLVI+IVC+VMGVF S R
Sbjct  61   NRTTSLTFSELYGAVTMNNVLCLSVFLALVYVRGLTWDFSSEVLVIVIVCVVMGVFASFR  120

Query  255  STFPLWTSFIAFSLYPLSIALVYVLDYVFGWS  160
            +TFPLWTSF+A  LYP S+ALVYVLDYV GWS
Sbjct  121  TTFPLWTSFVALLLYPFSLALVYVLDYVLGWS  152



>dbj|BAD43479.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43742.1| unknown protein, partial [Arabidopsis thaliana]
 dbj|BAD43909.1| unknown protein, partial [Arabidopsis thaliana]
Length=148

 Score =   228 bits (582),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -3

Query  573  DPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGA  394
            DPLVD V+NFS AT IP+FFISFIALPLATNSSEAVSAIIFASRKK+R+ASLTFSEL G 
Sbjct  11   DPLVDTVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGG  70

Query  393  VTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSL  214
            VTMNN+LCLSVFLA+VY RGLTW+FSSEVLVILIVC+VMG F S R+T+PLWT FIA+ L
Sbjct  71   VTMNNILCLSVFLAIVYVRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLL  130

Query  213  YPLSIALVYVLDYVFGWS  160
            YP S+ LVY+LDY FGWS
Sbjct  131  YPFSLGLVYILDYWFGWS  148



>ref|XP_002992821.1| hypothetical protein SELMODRAFT_42349, partial [Selaginella moellendorffii]
 gb|EFJ06111.1| hypothetical protein SELMODRAFT_42349, partial [Selaginella moellendorffii]
Length=531

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 168/247 (68%), Gaps = 8/247 (3%)
 Frame = -3

Query  882  LDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTRR  703
            L + + V   M DFD S++ +I   EF++G  +W  ++Q  +       +  D   Q+ +
Sbjct  286  LPKEEEVKAWMSDFDRSSDDKISESEFISGFTRWTKDLQQPKEEHRDNDNGWDTEAQSAQ  345

Query  702  EHYLLGAGDQNEEADEGVENPKWTSI-------KAVLFLLLGTAIAAAFADPLVDAVDNF  544
              Y+    D     +E  E     S+       KAVL ++LG  IA  FADPLVD+++NF
Sbjct  346  TSYM-ALMDGQGGGEEKEEEESGESMTKNQIITKAVLLIVLGALIAGIFADPLVDSIENF  404

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  364
            S+AT IP+FFI+F+A PLATNSSEA+S+++FA++KK ++ SLT+S++YG VTMNN LCL 
Sbjct  405  SSATGIPSFFIAFVATPLATNSSEAISSVLFAAKKKKQNISLTYSQIYGGVTMNNTLCLG  464

Query  363  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  184
            +FLA+V  RGLTWDFSSEVLVI +V ++MG+FG  R+TFPLWTSFI  +LYPLSI +V +
Sbjct  465  IFLAVVAYRGLTWDFSSEVLVITLVALIMGIFGGTRTTFPLWTSFIPLALYPLSILVVAL  524

Query  183  LDYVFGW  163
            LDYV GW
Sbjct  525  LDYVLGW  531



>ref|XP_002987555.1| hypothetical protein SELMODRAFT_42348, partial [Selaginella moellendorffii]
 gb|EFJ11391.1| hypothetical protein SELMODRAFT_42348, partial [Selaginella moellendorffii]
Length=531

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 169/247 (68%), Gaps = 8/247 (3%)
 Frame = -3

Query  882  LDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTRR  703
            L + + +   M DFD S++ +I   EF++G  +W+ ++Q  +       +  D   Q+ +
Sbjct  286  LPKEEELKAWMSDFDRSSDDKISESEFISGFTRWIKDLQQPKEEHRDNDNGWDTEAQSAQ  345

Query  702  EHYLLGAGDQNEEADEGVENPKWTSI-------KAVLFLLLGTAIAAAFADPLVDAVDNF  544
              Y+    D     +E  E     S+       KAVL ++LG  IA  FADPLVD+++NF
Sbjct  346  TSYM-ALMDGQGGGEEKEEEESGESMTKNQIITKAVLLIVLGALIAGIFADPLVDSIENF  404

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  364
            S+AT IP+FFI+F+A PLATNSSEA+S+++FA++KK ++ SLT+S++YG VTMNN LCL 
Sbjct  405  SSATGIPSFFIAFVATPLATNSSEAISSVLFAAKKKKQNISLTYSQIYGGVTMNNTLCLG  464

Query  363  VFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYV  184
            +FLA+V  RGLTWDFSSEVLVI +V ++MG+FG  R+TFPLWTSFI  +LYPLSI +V +
Sbjct  465  IFLAVVAYRGLTWDFSSEVLVITLVALIMGIFGGTRTTFPLWTSFIPLALYPLSILVVAL  524

Query  183  LDYVFGW  163
            LDYV GW
Sbjct  525  LDYVLGW  531



>ref|XP_002974272.1| hypothetical protein SELMODRAFT_52345, partial [Selaginella moellendorffii]
 gb|EFJ24494.1| hypothetical protein SELMODRAFT_52345, partial [Selaginella moellendorffii]
Length=525

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 161/258 (62%), Gaps = 27/258 (10%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            E +L E + V   +K+FDTS + ++  +EFVA + KW+   +            +D H  
Sbjct  280  ETHLPEEEEVQNWLKEFDTSRDDKVSQEEFVAAITKWMRSFRA-----------KDSHRD  328

Query  711  TRREHYLLGAGDQNEEADEGV---------------ENPKWTSIKAVLFLLLGTAIAAAF  577
               E++   A D     D  +               +NPK   +KA  F+L G  IA  F
Sbjct  329  NP-EYWDSQAKDARSSLDALLEQQPDDDEDDDEQDKQNPKQVILKASAFILAGAVIAGVF  387

Query  576  ADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYG  397
            ADPLVDA+DNFS A+ IP+FF++F+A PLATNSSEAVS+++FA+RKK R+ S+T+S++YG
Sbjct  388  ADPLVDAIDNFSKASKIPSFFVAFVATPLATNSSEAVSSLMFAARKKKRNISMTYSQIYG  447

Query  396  AVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFS  217
            AVT+NN LCL VFLA+V AR L WDFSSEV VI +V  ++G+ G  R+TF L+ +    S
Sbjct  448  AVTLNNTLCLGVFLAIVCARRLVWDFSSEVTVIAVVTFLVGLLGGKRTTFRLYMALAVLS  507

Query  216  LYPLSIALVYVLDYVFGW  163
            LYPLSIALV  LDY  GW
Sbjct  508  LYPLSIALVAGLDYGLGW  525



>ref|XP_009340418.1| PREDICTED: uncharacterized protein LOC103932516 [Pyrus x bretschneideri]
Length=725

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/244 (48%), Positives = 172/244 (70%), Gaps = 4/244 (2%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            +I  D +++V KL+++ DTS +Q I  +EFV G+ KW++  + +   P +L+  +D +++
Sbjct  486  KIPGDVDESVVKLIEELDTSGDQLISEEEFVTGLTKWIN--KSNDQAPPSLESEDDIYQR  543

Query  711  TRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTAT  532
            T  E   L   D+   +   V+  KW  +KA+ +L++G  + A  A+PL+D+V +FSTA 
Sbjct  544  TWDETDKLV--DEEYSSGGAVDKSKWAWMKAITYLVVGFVVLAVLAEPLIDSVQDFSTAA  601

Query  531  SIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLA  352
            SIP+FF+SF+ +PLATN+ +A SAI  ASRK  R+ SLTFSE+YG V MNNVL  SV LA
Sbjct  602  SIPSFFVSFVLVPLATNARQAASAIKAASRKTPRTTSLTFSEIYGGVFMNNVLGFSVLLA  661

Query  351  LVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYV  172
            ++YAR +TWDFS+EVLV+LIVC VMG+  S  STF LWTSF+A+ LYP+S+ LVY+L+ V
Sbjct  662  IIYAREMTWDFSAEVLVVLIVCTVMGLIASFVSTFSLWTSFLAYLLYPISLLLVYILNDV  721

Query  171  FGWS  160
              ++
Sbjct  722  LNYT  725



>ref|XP_008386229.1| PREDICTED: uncharacterized protein LOC103448738 [Malus domestica]
 ref|XP_008359329.1| PREDICTED: uncharacterized protein LOC103423037 [Malus domestica]
Length=725

 Score =   226 bits (575),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/244 (48%), Positives = 171/244 (70%), Gaps = 4/244 (2%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            +I  D +++V KL+++ DTS +Q I  +EFV G+ KW++  + +   P +L+  +D +++
Sbjct  486  KIPGDVDESVVKLIEELDTSGDQLISEEEFVTGLTKWIN--KSNDQAPPSLESEDDIYQR  543

Query  711  TRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTAT  532
            T  E   L   D+   +   V+  KW  +KA+ +L+LG  + A  A+PL+D+V +FSTA 
Sbjct  544  TWDETDKLV--DEEYSSGGAVDKSKWAWMKAITYLVLGFVVLAVLAEPLIDSVQDFSTAA  601

Query  531  SIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLA  352
            SIP+FF+SF+ +PLATN+ +A SAI  ASRK  R+ SLTFSE+YG V MNNVL  SV LA
Sbjct  602  SIPSFFVSFVLVPLATNARQATSAIKAASRKTPRTTSLTFSEIYGGVFMNNVLGFSVLLA  661

Query  351  LVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYV  172
            ++YAR + WDFS+EVLV+LIVC VMG+  S  STF LWTSF+A+ LYP+S+ LVY+L+ V
Sbjct  662  IIYAREMAWDFSAEVLVVLIVCTVMGLIASFVSTFSLWTSFLAYLLYPISLLLVYILNDV  721

Query  171  FGWS  160
              ++
Sbjct  722  LNYT  725



>ref|XP_002985644.1| hypothetical protein SELMODRAFT_181929 [Selaginella moellendorffii]
 gb|EFJ13222.1| hypothetical protein SELMODRAFT_181929 [Selaginella moellendorffii]
Length=528

 Score =   221 bits (564),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 165/252 (65%), Gaps = 15/252 (6%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS---RNVPVTLKHLEDF  721
            E +L E + V   +++FDTS + ++  +EFVA + KW+   +     R+ P      E +
Sbjct  282  ETHLPEEEEVQSWLREFDTSRDDKVSREEFVAAITKWMRSFRAKDSHRDNP------EYW  335

Query  720  HEQTRREHYLLGA------GDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVD  559
            H Q +     L A       D  ++ ++  + PK   +KA  F+L G  IA  FADPLVD
Sbjct  336  HSQAKDARSSLDALLEQQPDDDQDDDEQDKQAPKQVILKASAFILAGAVIAGVFADPLVD  395

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
            A+DNFS A+ IP+FF++F+A PLATNSSEAVS+++FA+RKK R+ S+T+S++YGAVT+NN
Sbjct  396  AIDNFSKASKIPSFFVAFVATPLATNSSEAVSSLMFAARKKKRNISMTYSQIYGAVTLNN  455

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
             LCL VFLA+V AR L WDFSSEV VI +V  ++G+ G  R+TF L+ +    SLYPLSI
Sbjct  456  TLCLGVFLAIVCARRLVWDFSSEVTVIAVVTFLVGLLGGRRTTFRLYMALAVLSLYPLSI  515

Query  198  ALVYVLDYVFGW  163
            ALV  LDY  GW
Sbjct  516  ALVAGLDYGLGW  527



>gb|KJB13247.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=506

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 136/169 (80%), Gaps = 5/169 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            +EI+LD++DAV K++ DFDTS +  +  DEFV G+ KW++E + +    +     T K +
Sbjct  329  EEIDLDQDDAVSKVIADFDTSRDNLVQEDEFVEGIMKWINEAKQTGGAYLESNAGTFKFI  388

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH+QT+REH LLG+ +Q++E  E VENP+W SIKAVL LLLGT IAAAFADPLVDAVD
Sbjct  389  DHFHQQTKREHALLGSEEQSDEVVENVENPRWISIKAVLMLLLGTLIAAAFADPLVDAVD  448

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSEL  403
            NFS ATSIP+FFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSE+
Sbjct  449  NFSEATSIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSEV  497



>gb|KJB13245.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=505

 Score =   218 bits (554),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 136/169 (80%), Gaps = 5/169 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            +EI+LD++DAV K++ DFDTS +  +  DEFV G+ KW++E + +    +     T K +
Sbjct  329  EEIDLDQDDAVSKVIADFDTSRDNLVQEDEFVEGIMKWINEAKQTGGAYLESNAGTFKFI  388

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH+QT+REH LLG+ +Q++E  E VENP+W SIKAVL LLLGT IAAAFADPLVDAVD
Sbjct  389  DHFHQQTKREHALLGSEEQSDEVVENVENPRWISIKAVLMLLLGTLIAAAFADPLVDAVD  448

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSEL  403
            NFS ATSIP+FFISFIALPLATNSSEAVSAIIFASRKK R+ASLTFSE+
Sbjct  449  NFSEATSIPSFFISFIALPLATNSSEAVSAIIFASRKKQRTASLTFSEV  497



>ref|XP_001762095.1| predicted protein [Physcomitrella patens]
 gb|EDQ73199.1| predicted protein [Physcomitrella patens]
Length=573

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 161/245 (66%), Gaps = 4/245 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHE  715
            D   + + + +   M +FD S +  I +DEF+ G+ +W   ++ S+++ +   +      
Sbjct  331  DNGQVPDEEELQHWMLEFDVSRDNRISVDEFLEGIKRW---IKSSKSISLPKTNTVKVDR  387

Query  714  QTRREHYLLGAGDQNEEADEGVENPKWTSI-KAVLFLLLGTAIAAAFADPLVDAVDNFST  538
             +  EH+   A D ++E +   +  K   I KA+ +LL G A+AA FADPLVDA+  FS 
Sbjct  388  SSPSEHHADEANDDDDENESNSDPTKAQVITKAIFYLLSGAAVAAIFADPLVDAISGFSE  447

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  358
            A+ I  FFISFIA PLATNSSEA+S++IFA RK+ ++ S+T+S++YGAVTMNN +CL +F
Sbjct  448  ASGISPFFISFIATPLATNSSEAISSLIFAKRKRKKNISMTYSQIYGAVTMNNTMCLGIF  507

Query  357  LALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLD  178
            LA+VY R L WDFS+E+ VI    ++MG   ++R+TFPLW +FI  +LYP SI LV  LD
Sbjct  508  LAIVYFRSLQWDFSAEIFVIFFATLLMGSVAALRTTFPLWMAFIGIALYPASIGLVAFLD  567

Query  177  YVFGW  163
            YV GW
Sbjct  568  YVCGW  572



>ref|XP_010277716.1| PREDICTED: uncharacterized protein LOC104612096 [Nelumbo nucifera]
Length=688

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 161/244 (66%), Gaps = 23/244 (9%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            +I +D++  V +L ++ DT+++  I  +EF+ G+++WL E ++         H + F  +
Sbjct  468  KIQVDKDGLVKELFEELDTNHDHNISEEEFIGGIERWLSEHKL---------HKQGFASK  518

Query  711  TRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTAT  532
             R               D G  +  W  IKAVL LLLG  I +  A+PL+++V NFS++ 
Sbjct  519  DR--------------LDLGTVDHPWIRIKAVLLLLLGITILSLLAEPLIESVQNFSSSA  564

Query  531  SIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLA  352
            +IP+FF+SF+ +PLATNS EA S II ASRKK  + S TFSE+YG V MNN+L LSV L 
Sbjct  565  NIPSFFVSFVMVPLATNSREAASRIISASRKKSTTTSWTFSEIYGGVFMNNILGLSVLLC  624

Query  351  LVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYV  172
            L++ RGLTWDFS+E LV+L+VC VMG+F S RSTFPLWT F+A+ +YP S+ LVYV +Y 
Sbjct  625  LIFFRGLTWDFSTEALVVLVVCTVMGLFASFRSTFPLWTCFMAYLMYPFSLVLVYVFNYA  684

Query  171  FGWS  160
             GWS
Sbjct  685  LGWS  688


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 2/61 (3%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLEDFH  718
             IN+D++DA+ +++ +FDT ++ +I +DEFV G+ KWL E +  +    P  LK  ED +
Sbjct  338  RINVDKDDAIAEVINEFDTDDDHKITMDEFVNGLVKWLSEAKDIIGNQAPHQLKSSEDLY  397

Query  717  E  715
            +
Sbjct  398  K  398



>gb|KDP36272.1| hypothetical protein JCGZ_09837 [Jatropha curcas]
Length=522

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 150/203 (74%), Gaps = 6/203 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDE----VQVSRNVPVTLKH-L  730
            ++++L+ NDAVD +MKDFD S +  ID  EFV G+ KW+ +    +  S    V ++  +
Sbjct  294  EDLHLNWNDAVDLIMKDFDVSRDNAIDRQEFVNGISKWIHKAKQSIAASSESSVGMRRFI  353

Query  729  EDFHEQTRREHYLLGAGD-QNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAV  553
             +F +QTR+EH LLG  D +++E  E VENPKW + KA+  LLLG AI A FADPLVD V
Sbjct  354  YEFDKQTRKEHTLLGPQDVRSDEVVEEVENPKWNTFKAIALLLLGAAIVAFFADPLVDVV  413

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
            DNFS  TSIP FFISFIALPLATNS +AVSAI FA RKK+R+ASLTFSE+YG +T+  +L
Sbjct  414  DNFSKQTSIPPFFISFIALPLATNSGDAVSAINFARRKKMRAASLTFSEIYGKITVKILL  473

Query  372  CLSVFLALVYARGLTWDFSSEVL  304
            CL+VF ALVY RGL WDFS+EVL
Sbjct  474  CLTVFFALVYFRGLEWDFSAEVL  496



>gb|KJB45757.1| hypothetical protein B456_007G325800 [Gossypium raimondii]
Length=511

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 135/169 (80%), Gaps = 5/169 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHL  730
            +EI+ D++DAV K+M DFDTS +  I  +EFV G+ KW++E + +    +     T K +
Sbjct  329  EEIDFDKDDAVMKVMADFDTSLDSYIQEEEFVKGITKWINEAKQTGGAYLEPNAGTFKFI  388

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH+QT+REH LLG+ +Q++E  E VENP+W S KAVL LL+GT IAAAFADPLVDAVD
Sbjct  389  DQFHQQTKREHALLGSEEQSDEVVEHVENPRWISFKAVLMLLVGTLIAAAFADPLVDAVD  448

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSEL  403
            NFSTATSIP+FFISFIALPLATNSSEAVSAIIFA+RKK R+ASLTFSE+
Sbjct  449  NFSTATSIPSFFISFIALPLATNSSEAVSAIIFATRKKQRTASLTFSEV  497



>ref|XP_001751608.1| predicted protein [Physcomitrella patens]
 gb|EDQ83925.1| predicted protein [Physcomitrella patens]
Length=576

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 158/252 (63%), Gaps = 13/252 (5%)
 Frame = -3

Query  885  NLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS---RNVPVTL------KH  733
             + + D +   M +FD S +  I +DEF+ G+ +W+     +   +N  V +       H
Sbjct  326  QVPDEDELQHWMSEFDVSRDNRISVDEFLQGIKRWMKSSSTATKKKNGAVAIDSQSSDHH  385

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSI--KAVLFLLLGTAIAAAFADPLVD  559
              DF  Q   +    G   ++EE DE    P    +  KA+ +L+ G A+AA FADPLVD
Sbjct  386  GWDFEAQVWNQ--FRGHSIEDEEDDESKGTPTRGQVIAKAICYLIAGAAVAAIFADPLVD  443

Query  558  AVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNN  379
            A+  FS A+ I  FFISFIA PLATNSSEA+S++IFA RK+ ++ S+T+S++YGAVTMNN
Sbjct  444  AIGGFSKASGISPFFISFIATPLATNSSEAISSLIFAKRKRKKNISMTYSQIYGAVTMNN  503

Query  378  VLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSI  199
             LCL +FL +VY RGL WDFS+E+ VI     +MG   + R+TFPLW +FI  +LYPLS+
Sbjct  504  TLCLGIFLTIVYFRGLLWDFSAEISVIFFATFIMGTVAAFRTTFPLWMAFIGLALYPLSV  563

Query  198  ALVYVLDYVFGW  163
             LV  LD+V GW
Sbjct  564  GLVVFLDFVCGW  575



>ref|XP_011000237.1| PREDICTED: uncharacterized protein LOC105107867 isoform X3 [Populus 
euphratica]
Length=702

 Score =   215 bits (547),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 158/246 (64%), Gaps = 7/246 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-PVTLKHLEDF  721
            + +I  D ++A +K+M+  DTS +Q ID  EF  G+ +WL  +  S NV P + +  +D 
Sbjct  462  IGKICWDVDEAAEKIMEALDTSGDQMIDEKEFAEGIVRWL--INTSENVTPGSTRSRDDN  519

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            +  T  E   L      +E    V+   W   KA++ ++LG AI +  A+PL+ +V NFS
Sbjct  520  NRGTWEEVDKL----LKDEKTNAVDKSSWAWFKAIMSMVLGAAILSVLAEPLIHSVQNFS  575

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
                IP+FF+SF+  PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  SV
Sbjct  576  EDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGCSV  635

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
             L L+YARGLTW+FS+EVLV+LI C +M + GS RS FPLWTSF+AF LYP S+ LVYVL
Sbjct  636  LLFLIYARGLTWEFSAEVLVVLITCAIMSLAGSFRSDFPLWTSFMAFLLYPFSLLLVYVL  695

Query  180  DYVFGW  163
            + V  +
Sbjct  696  NDVLDY  701



>ref|XP_011000236.1| PREDICTED: uncharacterized protein LOC105107867 isoform X2 [Populus 
euphratica]
Length=711

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 158/246 (64%), Gaps = 7/246 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-PVTLKHLEDF  721
            + +I  D ++A +K+M+  DTS +Q ID  EF  G+ +WL  +  S NV P + +  +D 
Sbjct  471  IGKICWDVDEAAEKIMEALDTSGDQMIDEKEFAEGIVRWL--INTSENVTPGSTRSRDDN  528

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            +  T  E   L      +E    V+   W   KA++ ++LG AI +  A+PL+ +V NFS
Sbjct  529  NRGTWEEVDKL----LKDEKTNAVDKSSWAWFKAIMSMVLGAAILSVLAEPLIHSVQNFS  584

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
                IP+FF+SF+  PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  SV
Sbjct  585  EDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGCSV  644

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
             L L+YARGLTW+FS+EVLV+LI C +M + GS RS FPLWTSF+AF LYP S+ LVYVL
Sbjct  645  LLFLIYARGLTWEFSAEVLVVLITCAIMSLAGSFRSDFPLWTSFMAFLLYPFSLLLVYVL  704

Query  180  DYVFGW  163
            + V  +
Sbjct  705  NDVLDY  710



>ref|XP_011000235.1| PREDICTED: uncharacterized protein LOC105107867 isoform X1 [Populus 
euphratica]
Length=719

 Score =   214 bits (546),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 158/246 (64%), Gaps = 7/246 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-PVTLKHLEDF  721
            + +I  D ++A +K+M+  DTS +Q ID  EF  G+ +WL  +  S NV P + +  +D 
Sbjct  479  IGKICWDVDEAAEKIMEALDTSGDQMIDEKEFAEGIVRWL--INTSENVTPGSTRSRDDN  536

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            +  T  E   L      +E    V+   W   KA++ ++LG AI +  A+PL+ +V NFS
Sbjct  537  NRGTWEEVDKL----LKDEKTNAVDKSSWAWFKAIMSMVLGAAILSVLAEPLIHSVQNFS  592

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
                IP+FF+SF+  PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  SV
Sbjct  593  EDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGCSV  652

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
             L L+YARGLTW+FS+EVLV+LI C +M + GS RS FPLWTSF+AF LYP S+ LVYVL
Sbjct  653  LLFLIYARGLTWEFSAEVLVVLITCAIMSLAGSFRSDFPLWTSFMAFLLYPFSLLLVYVL  712

Query  180  DYVFGW  163
            + V  +
Sbjct  713  NDVLDY  718



>ref|XP_006370033.1| hypothetical protein POPTR_0001s38420g [Populus trichocarpa]
 gb|ERP66602.1| hypothetical protein POPTR_0001s38420g [Populus trichocarpa]
Length=632

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 158/247 (64%), Gaps = 11/247 (4%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-PVTLKHLEDF  721
            + +I+ D ++A +K+M+  DTS +Q ID  EF  G+  WL  +  S NV PV+ +  +D 
Sbjct  392  IGKISWDVDEAAEKIMEALDTSGDQMIDEKEFAEGIVSWL--INTSENVTPVSSRSQDDN  449

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            + +T  E   L      +E    V+   W   KA++ ++LG AI +  A+PL+ +V NFS
Sbjct  450  NRRTWEEVDKL----LKDEKTNAVDKSSWAWFKAIMSMVLGVAILSVLAEPLIHSVQNFS  505

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
                IP+FF+SF+ +PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  SV
Sbjct  506  EDAGIPSFFVSFVLVPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGCSV  565

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY--  187
             L LVYARGLTW+FS+EVLV+LI C +M +  S  S FPLWTSF+AF LYP S+ L Y  
Sbjct  566  LLFLVYARGLTWEFSAEVLVVLITCAIMSLVVSFHSDFPLWTSFMAFLLYPFSLLLAYVF  625

Query  186  --VLDYV  172
              VLDYV
Sbjct  626  NDVLDYV  632



>ref|XP_008226451.1| PREDICTED: uncharacterized protein LOC103326025 [Prunus mume]
Length=725

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/243 (45%), Positives = 168/243 (69%), Gaps = 1/243 (0%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            +I  D +++V KL+++ DTS ++ I  +EFV G+ KW+++   ++    + +  +D +++
Sbjct  483  KIAGDVDESVVKLIEELDTSGDKMISEEEFVTGLTKWINKSHGTQPPSSSHESEDDIYQR  542

Query  711  TRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTAT  532
            T  E   L   ++  +    V+   W  +KA+ +L+LG  + A  A+PL+D+V  FSTA 
Sbjct  543  TWEETDRL-VDEEKSKGGSAVDKSIWAWLKAITYLVLGFVVLAVLAEPLIDSVQAFSTAV  601

Query  531  SIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLA  352
            SIP+F ++F+ +PLATN+ +A SAI  ASRK  R+ SLTFSE+YG V MNNVL +SV LA
Sbjct  602  SIPSFCVAFVLVPLATNARQATSAIKAASRKTPRTTSLTFSEIYGGVFMNNVLGVSVLLA  661

Query  351  LVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYV  172
            ++YAR +TW+FS+E+LV+LIVC VMGV  S  STF LWT+F+A+ LYP+S+ LVY+L+ V
Sbjct  662  IIYAREMTWEFSAELLVVLIVCTVMGVTASSVSTFSLWTAFLAYLLYPVSLLLVYLLNDV  721

Query  171  FGW  163
              +
Sbjct  722  LNY  724



>ref|XP_010279180.1| PREDICTED: uncharacterized protein LOC104613163 [Nelumbo nucifera]
Length=565

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 162/248 (65%), Gaps = 7/248 (3%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ-VSRNVPVTLKHLEDFH  718
            +EI L ++    ++MK+FDTS +  ID  EFV G+ KWL E Q  + N     ++L    
Sbjct  320  EEIGLIKDGFTVQVMKEFDTSGDAHIDEAEFVRGISKWLQESQQTTENQSHHRRNLSRKP  379

Query  717  EQTRREH---YLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
             Q   E     L+   D++   D+      W+  KA   LLLGT I A  ++PL+DA  +
Sbjct  380  SQKSSEEEQEKLVNRQDKSIAVDD---KSLWSYAKAAFLLLLGTTILAVLSEPLLDAAQS  436

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FSTA +IP+FFISF+ LPLA N  EAVSAI  A +KK RSASLTFSE+Y AV MNN++ +
Sbjct  437  FSTAANIPSFFISFVFLPLAVNYREAVSAITAARQKKQRSASLTFSEIYSAVFMNNIVGI  496

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            S+FL LVY RGL WDFS+EVLV+LIVCIVMG+     + FPLWTS +A+ LYP S+ LV+
Sbjct  497  SIFLVLVYIRGLAWDFSAEVLVVLIVCIVMGLVSGFCNVFPLWTSIVAYLLYPFSLLLVF  556

Query  186  VLDYVFGW  163
            +L Y FGW
Sbjct  557  ILIYFFGW  564



>ref|XP_010657148.1| PREDICTED: uncharacterized protein LOC100245468 [Vitis vinifera]
Length=289

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 146/200 (73%), Gaps = 9/200 (5%)
 Frame = -3

Query  873  NDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ----VSRNVPVTLKHLED-FHEQT  709
            NDAV ++M+DFD+  +  I+ID F+ G+  WL + +     S +  +  + + D F+   
Sbjct  85   NDAVGEVMRDFDSCGDSNINIDAFIKGISSWLAKAKHSAICSSDYDLKTRLVVDHFNLAK  144

Query  708  RREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATS  529
             +E  LLG   Q++E  + +ENPKW+  KAVL LLLG+ IAA FADPLV+AV NFSTAT+
Sbjct  145  NKEQKLLGV--QSDEVAK-IENPKWSVSKAVLMLLLGSLIAATFADPLVNAVGNFSTATN  201

Query  528  IPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLAL  349
            IP+F  SF  LP A+ SSEAVSA++FAS+KKLR  SLTFS++YGAV+MN +LCLSVFL L
Sbjct  202  IPSFLFSFAVLPFAS-SSEAVSALMFASQKKLRITSLTFSKIYGAVSMNKLLCLSVFLGL  260

Query  348  VYARGLTWDFSSEVLVILIV  289
            +Y R LTW+F+SEVL+ILI+
Sbjct  261  LYFRHLTWNFTSEVLIILII  280



>ref|XP_006370034.1| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
 gb|ERP66603.1| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
Length=499

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/244 (47%), Positives = 155/244 (64%), Gaps = 6/244 (2%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-PVTLKHLEDF  721
            + +I+ D ++A +K+++  DTS +Q ID  EF  G+ +W   +    NV PV+ +  +D 
Sbjct  258  IGKISWDVDEAAEKIIEALDTSGDQMIDEKEFAEGIVRW--SINPPENVTPVSTRSQDDN  315

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            + +T  E       D+   A   V+   W   KA++ ++LG AI +  A+PL  +V NFS
Sbjct  316  NRRTPWEEVDKLLKDEKTNA---VDKSSWAWFKAIMSMVLGVAILSVLAEPLTQSVQNFS  372

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
                IP+FF+SF+  PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  SV
Sbjct  373  EDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGCSV  432

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
             L LVYARGLTW+FS+EVLV+LI C +M +  S RS FPLWTSF+AF LYP S+ LVYV 
Sbjct  433  LLFLVYARGLTWEFSAEVLVVLITCAIMSLAVSFRSDFPLWTSFMAFLLYPFSLFLVYVF  492

Query  180  DYVF  169
            + V 
Sbjct  493  NDVL  496



>ref|XP_011460411.1| PREDICTED: uncharacterized protein LOC105350345 [Fragaria vesca 
subsp. vesca]
Length=162

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = -3

Query  576  ADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYG  397
            ADPLVDAVDNFSTATSIPTFF+SF+ LP   +SSE VS +IF SRKK RSASL +SE+YG
Sbjct  25   ADPLVDAVDNFSTATSIPTFFVSFVILPF-VSSSEIVSTLIFVSRKKQRSASLAYSEIYG  83

Query  396  AVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFS  217
            +VTM+++L L+VFL LVY R LTW FS+EVLVI+IVCI+MGV  S R+TFP+W  F A  
Sbjct  84   SVTMSDILSLAVFLGLVYIRNLTWSFSAEVLVIIIVCILMGVVASCRTTFPVWMCFGAVM  143

Query  216  LYPLSIALVYVLDYVFGWS  160
            LYPLS+ LVY+L+YVFGWS
Sbjct  144  LYPLSLLLVYILEYVFGWS  162



>ref|XP_007213499.1| hypothetical protein PRUPE_ppa022096mg, partial [Prunus persica]
 gb|EMJ14698.1| hypothetical protein PRUPE_ppa022096mg, partial [Prunus persica]
Length=645

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 166/244 (68%), Gaps = 1/244 (0%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            +I  D +++V KL+++ DT+ ++ I  +EFV G+ KW+++   ++    + +  +D +++
Sbjct  403  KIPGDMDESVVKLIEELDTNGDKMISEEEFVTGLTKWINKSNGTQPPSSSRESEDDIYQR  462

Query  711  TRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTAT  532
            T  E   L   ++  E    V+   W  +KA+ +L+LG  + A  A+PL+D+V  FS A 
Sbjct  463  TWEETDRL-VDEEKGEGGSSVDKSIWAWLKAITYLVLGFVVLAVLAEPLIDSVQAFSEAA  521

Query  531  SIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLA  352
             IP+F ++F+ +PLATN+ +A SAI  ASRK  R+ SLTFSE+YG V MNNVL +SV LA
Sbjct  522  GIPSFCVAFVLVPLATNARQATSAIKAASRKTPRTTSLTFSEIYGGVFMNNVLGVSVLLA  581

Query  351  LVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYV  172
            ++YAR +TW+FS+E+LV+LIVC VMG+  S  STF LWT+F+ + LYP+S+ LVY+L+ V
Sbjct  582  IIYAREMTWEFSAELLVVLIVCTVMGIIASFVSTFSLWTAFLTYLLYPVSLLLVYLLNDV  641

Query  171  FGWS  160
              ++
Sbjct  642  LKYT  645



>gb|EMT26602.1| hypothetical protein F775_16567 [Aegilops tauschii]
Length=241

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 138/186 (74%), Gaps = 3/186 (2%)
 Frame = -3

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFST  538
            ++TR EH  L   D   E  E VENP    +KAV  +L+G AI AAFADPLVDA+ + S 
Sbjct  59   QRTREEHDQLAVSD---EEVEPVENPGRMIVKAVGLMLVGAAIPAAFADPLVDAIYSLSK  115

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  358
            AT + +FF+SF+ LPL  NSSE VSA+    +K+ RSASL  SE+Y  VT+NN++CL +F
Sbjct  116  ATHVSSFFVSFVVLPLVNNSSEVVSAVRSMRKKRRRSASLALSEVYCVVTVNNLMCLGMF  175

Query  357  LALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLD  178
            LALVYAR +TWDFSSE+L+IL+VC+VMG+F S R+ FPLWT  +A+SLYPLS+ LV++LD
Sbjct  176  LALVYARDITWDFSSELLIILLVCVVMGLFTSFRTNFPLWTCLVAYSLYPLSLVLVHILD  235

Query  177  YVFGWS  160
             VF WS
Sbjct  236  SVFHWS  241



>ref|XP_002298902.2| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
 gb|EEE83707.2| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
Length=690

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 156/246 (63%), Gaps = 10/246 (4%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-PVTLKHLEDF  721
            + +I+ D ++A +K+++  DTS +Q ID  EF  G+ +W   +    NV PV+ +  +D 
Sbjct  449  IGKISWDVDEAAEKIIEALDTSGDQMIDEKEFAEGIVRW--SINPPENVTPVSTRSQDDN  506

Query  720  HEQTRREHYLLGAGDQ--NEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            + +T  E       D+   +E    V+   W   KA++ ++LG AI +  A+PL  +V N
Sbjct  507  NRRTPWEEV-----DKLLKDEKTNAVDKSSWAWFKAIMSMVLGVAILSVLAEPLTQSVQN  561

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS    IP+FF+SF+  PLATN+  A SAI  A RKK  + SLTFSE+YG V MNNVL  
Sbjct  562  FSEDAGIPSFFVSFVLAPLATNARAATSAITTACRKKSITTSLTFSEIYGGVFMNNVLGC  621

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            SV L LVYARGLTW+FS+EVLV+LI C +M +  S RS FPLWTSF+AF LYP S+ LVY
Sbjct  622  SVLLFLVYARGLTWEFSAEVLVVLITCAIMSLAVSFRSDFPLWTSFMAFLLYPFSLFLVY  681

Query  186  VLDYVF  169
            V + V 
Sbjct  682  VFNDVL  687



>emb|CDP05977.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   206 bits (524),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 154/237 (65%), Gaps = 13/237 (5%)
 Frame = -3

Query  885  NLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLED--FHEQ  712
            +L  +DAV K+M++ DT  ++ ++ +EF  G+ KWL   Q + N     K  ED  F + 
Sbjct  483  SLSVDDAVAKMMEELDTDGDRMLNEEEFATGLSKWL---QKNDNASTNSKESEDEIFQKS  539

Query  711  TRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTAT  532
              +   LL     N+          WT  KA+  L+LGT +    A+PL+++V NFS A 
Sbjct  540  WEQTDQLLEVESINKSL------LAWT--KAIFLLVLGTGMLGILAEPLIESVQNFSEAA  591

Query  531  SIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLA  352
            ++P+FFISFI +PLATN+  A+SAI  A RKK R+ SLTFSE+YG V MNN+L  SV L+
Sbjct  592  NMPSFFISFILVPLATNARVAISAISEARRKKPRTTSLTFSEIYGGVFMNNMLGFSVLLS  651

Query  351  LVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            L+Y RGLTW FS+EVL++LIV  +MG+ GS RS  PLWTS +A+ LYPLS+ LVY+L
Sbjct  652  LIYFRGLTWIFSAEVLIVLIVSAIMGLLGSFRSIIPLWTSLVAYFLYPLSLVLVYLL  708



>ref|XP_002275961.1| PREDICTED: uncharacterized protein LOC100260847 [Vitis vinifera]
Length=539

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 143/202 (71%), Gaps = 9/202 (4%)
 Frame = -3

Query  879  DENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHLEDFHE  715
            D ++AV K++ DFD   + +I++D F+ G+ KW D+ + S          T   ++DF+ 
Sbjct  333  DIDEAVGKVLTDFDACGDSKINLDAFIIGISKWYDKAKHSAVCSSDSDFQTRIIIDDFNT  392

Query  714  QTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTA  535
             T + + LLG   Q   A E +ENPKW++ K V  LLLGT IAA F DPLV+AV NF +A
Sbjct  393  PTSKGNELLGI--QFYTA-EKIENPKWSAFKGVFILLLGTLIAATFVDPLVNAVGNFYSA  449

Query  534  TSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFL  355
            T+IP FF+SFI LP A+ SSEAVSA+IFAS+KKLR A LT SE+YGAV MNN+LCLSVFL
Sbjct  450  TNIPPFFVSFIVLPFAS-SSEAVSALIFASQKKLRIAPLTVSEIYGAVNMNNLLCLSVFL  508

Query  354  ALVYARGLTWDFSSEVLVILIV  289
             L+Y R LTW+F+SEVL+ILI+
Sbjct  509  GLLYFRHLTWNFTSEVLIILII  530



>gb|KDO45773.1| hypothetical protein CISIN_1g0423001mg, partial [Citrus sinensis]
Length=147

 Score =   189 bits (479),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = -3

Query  609  LLLGTAIAAAFADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLR  430
            LL+GT +AA  +DPLVDAVDNFSTA++IP+ F++FI LP AT SSEAVSA+IFASRK+ R
Sbjct  4    LLMGTIVAAVCSDPLVDAVDNFSTASNIPSLFVAFIILPFAT-SSEAVSALIFASRKRSR  62

Query  429  SASLTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRST  250
            ++SLT+S +YG+VTM+N+L LSVFL+LVY R LTW+FS+EV VIL+VCI+MG+  S R+T
Sbjct  63   TSSLTYSAIYGSVTMSNILSLSVFLSLVYFRHLTWNFSAEVSVILLVCILMGLIASFRTT  122

Query  249  FPLWTSFIAFSLYPLSIALVYVLD  178
            FPLW   +A  LYP S+ L+YVLD
Sbjct  123  FPLWMCLVACMLYPFSLLLLYVLD  146



>emb|CAN66793.1| hypothetical protein VITISV_034151 [Vitis vinifera]
Length=354

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 124/167 (74%), Gaps = 7/167 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNV-----PVTLKHL  730
            +EI+LD N+AVDK+M DFDTSN+Q +D  EFV G+ +W+ E +          P +   L
Sbjct  182  EEIDLDRNEAVDKVMSDFDTSNDQFVDEGEFVKGISRWITEAKRYEGSGPDAGPNSSSIL  241

Query  729  EDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
            + FH  T+REH  L  G Q++E  E VENPKW + KAV+ LLLGT IAA FADPLVDAVD
Sbjct  242  DAFHRGTKREHNRL-EGYQSDEVVEAVENPKWITFKAVMMLLLGTLIAAVFADPLVDAVD  300

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFS  409
            NFS ATSIPTFFISFIALPLAT SSEAVSAIIFASRKK R+ SLTFS
Sbjct  301  NFSDATSIPTFFISFIALPLAT-SSEAVSAIIFASRKKRRTTSLTFS  346



>emb|CBI21945.3| unnamed protein product [Vitis vinifera]
Length=892

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 141/202 (70%), Gaps = 9/202 (4%)
 Frame = -3

Query  879  DENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHLEDFHE  715
            D ++AV K++ DFD   + +I++D F+ G+ KW D+ + S          T   ++DF+ 
Sbjct  390  DIDEAVGKVLTDFDACGDSKINLDAFIIGISKWYDKAKHSAVCSSDSDFQTRIIIDDFNT  449

Query  714  QTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTA  535
             T + + LLG         E +ENPKW++ K V  LLLGT IAA F DPLV+AV NF +A
Sbjct  450  PTSKGNELLGI---QFYTAEKIENPKWSAFKGVFILLLGTLIAATFVDPLVNAVGNFYSA  506

Query  534  TSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFL  355
            T+IP FF+SFI LP A+ SSEAVSA+IFAS+KKLR A LT SE+YGAV MNN+LCLSVFL
Sbjct  507  TNIPPFFVSFIVLPFAS-SSEAVSALIFASQKKLRIAPLTVSEIYGAVNMNNLLCLSVFL  565

Query  354  ALVYARGLTWDFSSEVLVILIV  289
             L+Y R LTW+F+SEVL+ILI+
Sbjct  566  GLLYFRHLTWNFTSEVLIILII  587



>emb|CBI21946.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   201 bits (510),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 143/205 (70%), Gaps = 14/205 (7%)
 Frame = -3

Query  873  NDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSR--------NVPVTLKHLEDFH  718
            NDAV ++M+DFD+  +  I+ID F+ G+  WL + + S            + + H     
Sbjct  597  NDAVGEVMRDFDSCGDSNINIDAFIKGISSWLAKAKHSAICSSDYDLKTRLVVDHFNLVC  656

Query  717  EQTR--REHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNF  544
             Q R   +  LLG   Q++E  + +ENPKW+  KAVL LLLG+ IAA FADPLV+AV NF
Sbjct  657  HQCRVIPKQKLLGV--QSDEVAK-IENPKWSVSKAVLMLLLGSLIAATFADPLVNAVGNF  713

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLS  364
            STAT+IP+F  SF  LP A+ SSEAVSA++FAS+KKLR  SLTFS++YGAV+MN +LCLS
Sbjct  714  STATNIPSFLFSFAVLPFAS-SSEAVSALMFASQKKLRITSLTFSKIYGAVSMNKLLCLS  772

Query  363  VFLALVYARGLTWDFSSEVLVILIV  289
            VFL L+Y R LTW+F+SEVL+ILI+
Sbjct  773  VFLGLLYFRHLTWNFTSEVLIILII  797


 Score =   163 bits (413),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 121/160 (76%), Gaps = 5/160 (3%)
 Frame = -3

Query  771  VQVSRNVPVTLKHLEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTA  592
            V +S  + V+L      ++   REH LLG   Q++E  + ++NPKW++ KAVL LLLG+ 
Sbjct  167  VLISLIISVSLLLAYCLYQAANREHELLGV--QSDEVAK-IKNPKWSASKAVLMLLLGSL  223

Query  591  IAAAFADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTF  412
            IAA FAD L++AV NFST T+IP+F +SF  LP A  SSEAV+A++FAS+ K+R  SLTF
Sbjct  224  IAATFADSLINAVGNFSTDTNIPSFLVSFTVLPFAI-SSEAVAALMFASQNKMR-ISLTF  281

Query  411  SELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILI  292
            S++YGAV+MNN+LCLSVFL L+Y R L+W+F+S+VL+ILI
Sbjct  282  SKIYGAVSMNNLLCLSVFLGLLYFRHLSWNFTSDVLIILI  321


 Score =   138 bits (348),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = -3

Query  609  LLLGTAIAAAFADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLR  430
            LLLG+ IAA FA PLV+AV  FSTAT+IP+FF+SF+ LP A+  SEAVSA  FAS+KKLR
Sbjct  2    LLLGSLIAATFAGPLVNAVGKFSTATNIPSFFVSFLVLPFAS-FSEAVSAQNFASQKKLR  60

Query  429  SASLTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLV  301
             ASLTFS++YGA++MNN LC+SVFL LVY R LTW+F+SEVL+
Sbjct  61   IASLTFSKIYGAMSMNNFLCMSVFLGLVYFRQLTWNFTSEVLI  103



>emb|CAN78275.1| hypothetical protein VITISV_037788 [Vitis vinifera]
Length=529

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 153/247 (62%), Gaps = 3/247 (1%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLK-HLEDF  721
            L+E  L   D V+K+M+DFD S N +ID  EF  G+ KWL E     N     +  L   
Sbjct  285  LEEAGLRNEDFVEKVMEDFDASGNAQIDETEFHRGISKWLXEANHPDNNQYDERPKLFSR  344

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
              Q+  +  LL    + ++  +  +N  +   KA   L++GTA+ +  A PL+  ++ FS
Sbjct  345  SAQSEEQQSLLA--KKAKQQSQTAQNSWFNYFKAAFLLIIGTAVMSLLAQPLIQTINEFS  402

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
            +A +IP+F IS++ +P+A +  E + AI  A  K  ++ SLTFSE+Y AV MNN++ L++
Sbjct  403  SAVNIPSFIISYVIIPVAMSYRETLGAIKSARXKTKQAISLTFSEIYNAVFMNNMMGLAM  462

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FL LVY R L+WD S+E+LV+LI+C +MG+  S  + FP+WT+ IA+ +YP+S+ L+YVL
Sbjct  463  FLLLVYIRDLSWDVSAEILVVLIICTLMGLLTSCSTKFPIWTAIIAYLMYPISLGLLYVL  522

Query  180  DYVFGWS  160
              V GWS
Sbjct  523  TEVLGWS  529



>ref|XP_002272134.1| PREDICTED: uncharacterized protein LOC100243523 [Vitis vinifera]
 emb|CBI30651.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 153/247 (62%), Gaps = 3/247 (1%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLK-HLEDF  721
            L+E  L   D V+K+M+DFD S N +ID  EF  G+ KWL E     N     +  L   
Sbjct  315  LEEAGLRNEDFVEKVMEDFDASGNAQIDETEFHRGISKWLYEANHPDNNQYDERPKLFSR  374

Query  720  HEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
              Q+  +  LL    + ++  +  +N  +   KA   L++GTA+ +  A PL+  ++ FS
Sbjct  375  SAQSEEQQSLLA--KKAKQQSQTAQNSWFNYFKAAFLLIIGTAVMSLLAQPLIQTINEFS  432

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
            +A +IP+F IS++ +P+A +  E + AI  A  K  ++ SLTFSE+Y AV MNN++ L++
Sbjct  433  SAVNIPSFIISYVIIPVAMSYRETLGAIKSARLKTKQAISLTFSEIYNAVFMNNMMGLAM  492

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FL LVY R L+WD S+E+LV+LI+C +MG+  S  + FP+WT+ IA+ +YP+S+ L+YVL
Sbjct  493  FLLLVYIRDLSWDVSAEILVVLIICTLMGLLTSCSTKFPIWTAIIAYLMYPISLGLLYVL  552

Query  180  DYVFGWS  160
              V GWS
Sbjct  553  TEVLGWS  559



>ref|XP_009605371.1| PREDICTED: uncharacterized protein LOC104099939 [Nicotiana tomentosiformis]
Length=706

 Score =   198 bits (503),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/244 (41%), Positives = 156/244 (64%), Gaps = 1/244 (0%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            E+ ++ +D+V K+++DFD   N  ID  EFV G+ KWL+E     N P   + ++D+ + 
Sbjct  464  EVEINRDDSVKKVLRDFDKDGNNMIDEHEFVHGMTKWLNEAVKVTNCPDKKRAIDDYDKI  523

Query  711  TRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTAT  532
               E   L   +  ++ +   +   W   KAVL +LLG AI    A PLV ++++ S A 
Sbjct  524  KWSEVDKL-VYEVEKDGEIKYKLLTWAFNKAVLQVLLGIAILTLCAKPLVISIEDLSDAM  582

Query  531  SIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLA  352
             +P+F I F+ +PLA N+  A++AI  AS+K  ++ASLTFSE+YG V MNN++ ++  LA
Sbjct  583  GMPSFLIPFVMVPLALNARMAIAAIFPASQKSSKTASLTFSEIYGGVIMNNIMGMTTLLA  642

Query  351  LVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYV  172
             V+ + L WD+S+EVL++L+VC V+G+     +T+PLWT  +AFSLYP S+ L Y+L+ V
Sbjct  643  AVFIKDLRWDYSAEVLIVLVVCSVVGLLAFFTTTYPLWTCLLAFSLYPFSVLLFYLLECV  702

Query  171  FGWS  160
            FGW+
Sbjct  703  FGWA  706



>ref|XP_001752917.1| predicted protein [Physcomitrella patens]
 gb|EDQ82421.1| predicted protein [Physcomitrella patens]
Length=601

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 155/239 (65%), Gaps = 4/239 (2%)
 Frame = -3

Query  879  DENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTRRE  700
            DE D ++  M +FD  N+++I   EF+  + +W+     S +     +     H  T  +
Sbjct  366  DEED-LEHWMSEFDVDNDEKITEAEFLRAIRRWMKN---SSSRKPKRRANAKMHYTTLED  421

Query  699  HYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPT  520
                   D +EE   G  + K T  KA+ FL+ G A+AA FADPLVDA+D FS A+ I  
Sbjct  422  EANDDDDDDDEEGKGGAPSRKQTITKAICFLIAGAALAAIFADPLVDAIDGFSRASGISP  481

Query  519  FFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYA  340
            FFISFIA PLATNSSEA+S++IFA +K+ ++ S+T+S++YGAVTMNN +CL +FL++VY 
Sbjct  482  FFISFIATPLATNSSEAISSLIFAKKKRKKNISMTYSQIYGAVTMNNTMCLGIFLSIVYF  541

Query  339  RGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGW  163
            R L WDFS+EV VI    ++MG   + R+T PLW +FI  +LYPLSIALV  LDYV GW
Sbjct  542  RHLLWDFSAEVSVIFFATLIMGSVAAFRTTLPLWMAFIGLALYPLSIALVAFLDYVCGW  600



>ref|XP_007025465.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
 gb|EOY28087.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
Length=574

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 149/246 (61%), Gaps = 2/246 (1%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            ++E+ LDE D   K+M++FD S + +I+  EFV GV  WL++V         L H+    
Sbjct  331  IEEVGLDEEDFETKVMEEFDFSGDSDINETEFVRGVSNWLNKVNDQAQGERRLFHVN--A  388

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFST  538
            ++   E   L    +  +A +G +NP W   KA   + LGTAI    A+PL+  +  FST
Sbjct  389  KKNDEEKRSLLPAKKRSKARKGTDNPWWNYTKAFFLITLGTAITVLLANPLMITLQEFST  448

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  358
            + +IP+F +S++ +P A +   A  AI  A +K   +ASLTFSELYGAV MNNV+ L +F
Sbjct  449  SANIPSFLVSYVVIPWALSFRLAFRAISSARQKTENAASLTFSELYGAVFMNNVMGLVIF  508

Query  357  LALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLD  178
            L+LVY R + W  S+EVLV+L++C  MG+F +  +   LWT  + + LYP+S+ L+YVL 
Sbjct  509  LSLVYIRNIPWGVSAEVLVVLLICTAMGLFATFSTKIELWTCILVYLLYPISLLLIYVLT  568

Query  177  YVFGWS  160
             V GWS
Sbjct  569  NVLGWS  574



>ref|XP_004233846.1| PREDICTED: uncharacterized protein LOC101251749 [Solanum lycopersicum]
Length=716

 Score =   196 bits (497),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/247 (42%), Positives = 155/247 (63%), Gaps = 7/247 (3%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            E+ ++  D V K+++DFD + N  ID DEFV G+ +WL+E       P   + ++++ + 
Sbjct  474  EVEINHEDTVKKVLRDFDRNGNDMIDEDEFVHGMTRWLNEAISVTKCPDKKRAIDEYDKI  533

Query  711  TRREHYLLGAGDQNEEADEGVENPK---WTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
               E   +      E   +G  N K   WT  K+VL +LLG AI    A PLV ++++ S
Sbjct  534  KWSEVDKI----VYEVESDGEINYKLLTWTFNKSVLQVLLGIAIMTLCAKPLVISIEDLS  589

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             A  IP+F I F+ +PLA N+  A++AI  AS+K   +ASLTFSE+YG V MNN++ ++ 
Sbjct  590  DAMGIPSFLIPFVMVPLALNARMAIAAIFPASQKSSITASLTFSEIYGGVIMNNIMGMAT  649

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
             LA+V  + L WD+S+EVL+IL+VC V+G+     +T+PLWT  +AFSLYP S+ L Y+L
Sbjct  650  LLAVVCIKDLRWDYSAEVLIILVVCSVIGLLAFFSTTYPLWTCLVAFSLYPFSVVLFYLL  709

Query  180  DYVFGWS  160
            + VFGW+
Sbjct  710  ECVFGWA  716



>ref|XP_001755925.1| predicted protein [Physcomitrella patens]
 gb|EDQ79210.1| predicted protein [Physcomitrella patens]
Length=568

 Score =   192 bits (489),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 151/236 (64%), Gaps = 5/236 (2%)
 Frame = -3

Query  870  DAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTRREHYL  691
            D V+  M++FD   +  I   EF+ G+ KW   V   +   ++L+         R  ++ 
Sbjct  337  DQVETWMREFDLDVDGTISEHEFLTGIKKWSKRVAQDK---LSLQAQRASAVSIRDSNFW  393

Query  690  LGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPTFFI  511
                D+ + +DE   +P     KA L +L G A+AA FADP+VD + NFS A+ IP FF+
Sbjct  394  AAKSDEAKTSDE--LDPPQIYKKAALLMLAGAAVAATFADPMVDTIGNFSAASKIPPFFV  451

Query  510  SFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYARGL  331
            +F+  P A+N+SE VS+IIFA R++ R+ SLTFS++YGA+TMNN LC+++FLALVY RGL
Sbjct  452  AFVVTPFASNASELVSSIIFAKRRRKRNISLTFSQVYGAITMNNTLCMAIFLALVYIRGL  511

Query  330  TWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGW  163
            TWDFSSEV VI++    +G+ G  RSTFP W +    +LYPL+IA V VLD V GW
Sbjct  512  TWDFSSEVTVIVLCTFAVGMMGGTRSTFPSWFALPVLALYPLAIAGVAVLDNVLGW  567



>ref|XP_009803286.1| PREDICTED: uncharacterized protein LOC104248681 [Nicotiana sylvestris]
Length=706

 Score =   194 bits (492),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/247 (41%), Positives = 155/247 (63%), Gaps = 7/247 (3%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            E+ ++ +D+V K+++DFD   N  ID  EFV G+ KWL+E       P   + ++++ + 
Sbjct  464  EVEINRDDSVKKVLRDFDKDGNNMIDEHEFVHGMTKWLNEAISVTKCPDKKRAIDEYEKI  523

Query  711  TRREHYLLGAGDQNEEADEGVENPK---WTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
               E   L      E   +G  N K   W   K+VL +LLG AI    A PLV ++++ S
Sbjct  524  KWSEVDKL----VYEVEKDGEINYKLLTWAFNKSVLQVLLGIAILTLCAKPLVISIEDLS  579

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             A  +P+F I F+ +PLA N+  A++AI  AS+K  ++ASLTFSE+YG V MNN++ ++ 
Sbjct  580  DAMGMPSFLIPFVMVPLALNARMAIAAIFPASQKSSKTASLTFSEIYGGVIMNNIMGMTT  639

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
             LA+V  + L WD+S+EVL++L+VC V+G+     +T+PLWT  +AFSLYP S+ L Y+L
Sbjct  640  LLAVVCIKDLRWDYSAEVLIVLVVCSVVGLLAFFSTTYPLWTCLLAFSLYPFSVLLFYLL  699

Query  180  DYVFGWS  160
            + VFGW+
Sbjct  700  ECVFGWA  706



>emb|CAN78651.1| hypothetical protein VITISV_033127 [Vitis vinifera]
Length=533

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 134/197 (68%), Gaps = 9/197 (5%)
 Frame = -3

Query  879  DENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPV-----TLKHLEDFHE  715
            D ++AV K+  DFD   + +I++D F+ G+ KW D+ + S          T   ++DF+ 
Sbjct  270  DIDEAVGKVXTDFDACGDSKINLDAFIIGISKWYDKAKHSAVCSSDSDFQTRIIIDDFNT  329

Query  714  QTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTA  535
             T + + LLG         E +ENPKW++ K V  LLLGT IAA F DPLV+AV NF +A
Sbjct  330  PTSKGNELLGI---QFYTAEKIENPKWSAFKGVFILLLGTLIAATFVDPLVNAVGNFYSA  386

Query  534  TSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFL  355
            T+IP FF+SFI LP A+ SSEAVSA+IFAS+KKLR A LT SE+YGAV MNN+LCLSVFL
Sbjct  387  TNIPPFFVSFIVLPFAS-SSEAVSALIFASQKKLRIAXLTVSEIYGAVNMNNLLCLSVFL  445

Query  354  ALVYARGLTWDFSSEVL  304
             L+Y R LTW+F+SE +
Sbjct  446  GLLYFRHLTWNFTSETV  462



>gb|EYU44996.1| hypothetical protein MIMGU_mgv1a025835mg [Erythranthe guttata]
Length=651

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 150/240 (63%), Gaps = 10/240 (4%)
 Frame = -3

Query  879  DENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRN-VPVTLKHLEDFHEQTRR  703
            D ++A  K+M++ D S ++ I+ DEFV G+  WL+ + +++   P  +    D+H     
Sbjct  409  DIDEAASKMMEELDISGDKLINEDEFVTGLSNWLNAISINQTPKPEQINEESDYHNHFL-  467

Query  702  EHYLLGAGDQN-EEADEGVENP-----KWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
              +++    QN EE D+ VE+       +  IKA+  L+LG  +    A+PL+ +V + S
Sbjct  468  --FIITTMQQNWEETDKLVESKFVDKSPFAWIKAISLLVLGIVMLGLLAEPLIHSVQSLS  525

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             A SIP+FFI+FI +PLATN+   +SAI    RKKL   SLTFSE+YG V MNN+L  SV
Sbjct  526  KAASIPSFFIAFIFVPLATNARITISAIGEVRRKKLNITSLTFSEIYGTVLMNNLLGFSV  585

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
             L+L+Y RG +WDFS EVL++LIVC VMG   S  + FP+WT+  A  LYPLS+ LV VL
Sbjct  586  LLSLIYFRGFSWDFSVEVLMVLIVCAVMGCLASFSTVFPVWTAVFACMLYPLSLVLVTVL  645



>ref|XP_002979757.1| hypothetical protein SELMODRAFT_111442, partial [Selaginella 
moellendorffii]
 gb|EFJ19159.1| hypothetical protein SELMODRAFT_111442, partial [Selaginella 
moellendorffii]
Length=147

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -3

Query  600  GTAIAAAFADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSAS  421
            G+ +AAAFADPLV++++ F+ A+ IP FFI+F+  PLA+N+SE VS+I FA +K+ R+ S
Sbjct  1    GSLLAAAFADPLVNSINGFAQASQIPPFFIAFVFTPLASNASELVSSISFAQKKRKRNIS  60

Query  420  LTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPL  241
            LTFS++YGAVTMNN LCL +FL LVY RGLTWDFSSEV  ILI    +G  G  R TFP 
Sbjct  61   LTFSQIYGAVTMNNTLCLGIFLGLVYTRGLTWDFSSEVTAILITTFFVGALGGSRMTFPS  120

Query  240  WTSFIAFSLYPLSIALVYVLDYVFGW  163
            W S    +LYPLSIA +  LD V GW
Sbjct  121  WLSLPVLALYPLSIASIAFLDNVLGW  146



>ref|XP_002965139.1| hypothetical protein SELMODRAFT_82683 [Selaginella moellendorffii]
 gb|EFJ33977.1| hypothetical protein SELMODRAFT_82683 [Selaginella moellendorffii]
Length=546

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/251 (40%), Positives = 150/251 (60%), Gaps = 15/251 (6%)
 Frame = -3

Query  885  NLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLED------  724
            N+ E       M++FD   + ++ + EF  G+  WL+    S  + +  ++         
Sbjct  300  NIPEGLEAKIWMEEFDHERDGKLSLVEFEEGMANWLN----SSKLGLEFRYFHSWSAILF  355

Query  723  ----FHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDA  556
                F ++ +   Y L   D+   A E  E+P    + A   LL G A+A  FA PLVD 
Sbjct  356  IYFFFVQEAQSSLYAL-LEDEEVHAPEDTEDPNGILVTATACLLGGMALACIFAAPLVDT  414

Query  555  VDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNV  376
            +D+FS A+ IP FF+SF+  P+AT+SSE +S+I FAS+K+ R  S+T+S+LYG+V +NN 
Sbjct  415  IDDFSRASHIPAFFVSFVVTPIATSSSEVISSITFASKKQKRGISVTYSQLYGSVVLNNT  474

Query  375  LCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIA  196
            LCL +FLA+V ARGL WDFS+EVL++ +  + MG  G + +T PL+ +F AF LYPLS+ 
Sbjct  475  LCLGLFLAIVAARGLVWDFSAEVLIMALATMAMGCVGGIFTTIPLFMAFGAFLLYPLSLG  534

Query  195  LVYVLDYVFGW  163
            LV +L+   GW
Sbjct  535  LVVLLNQYLGW  545



>emb|CAN78650.1| hypothetical protein VITISV_033126 [Vitis vinifera]
Length=541

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 142/198 (72%), Gaps = 11/198 (6%)
 Frame = -3

Query  864  VDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLE------DFHEQTRR  703
            V  +M+D     + +I+I+ F  G+ KWL++ + S  V  +  H++       F+  + +
Sbjct  340  VGDIMRDVHACGDAKINIEAFTKGISKWLNKAKNSA-VCSSYNHMKTRLVVDHFNLVSNK  398

Query  702  EHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIP  523
            EH  LG   Q++E  + +E+PKW++ KAV+ LLLG+ IAA FA PLV+AV  FSTAT+IP
Sbjct  399  EHEQLGI--QSDEVVK-IESPKWSACKAVVMLLLGSLIAATFAGPLVNAVGKFSTATNIP  455

Query  522  TFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVY  343
            +FF+SF+ LP A+  SEAVSA  FAS+KKLR ASLTFS++YGA++MNN LC+SVFL LVY
Sbjct  456  SFFVSFLVLPFAS-FSEAVSAQNFASQKKLRIASLTFSKIYGAMSMNNFLCMSVFLGLVY  514

Query  342  ARGLTWDFSSEVLVILIV  289
             R LTW+F+SEVL++LI+
Sbjct  515  FRQLTWNFTSEVLIVLII  532



>ref|XP_002275985.2| PREDICTED: uncharacterized protein LOC100255777 [Vitis vinifera]
Length=541

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 142/198 (72%), Gaps = 11/198 (6%)
 Frame = -3

Query  864  VDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLE------DFHEQTRR  703
            V  +M+D     + +I+I+ F  G+ KWL++ + S  V  +  H++       F+  + +
Sbjct  340  VGDIMRDVHACGDAKINIEAFTKGISKWLNKAKNSA-VCSSYNHMKTRLVVDHFNLVSNK  398

Query  702  EHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIP  523
            EH  LG   Q++E  + +E+PKW++ KAV+ LLLG+ IAA FA PLV+AV  FSTAT+IP
Sbjct  399  EHEQLGI--QSDEVVK-IESPKWSACKAVVMLLLGSLIAATFAGPLVNAVGKFSTATNIP  455

Query  522  TFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVY  343
            +FF+SF+ LP A+  SEAVSA  FAS+KKLR ASLTFS++YGA++MNN LC+SVFL LVY
Sbjct  456  SFFVSFLVLPFAS-FSEAVSAQNFASQKKLRIASLTFSKIYGAMSMNNFLCMSVFLGLVY  514

Query  342  ARGLTWDFSSEVLVILIV  289
             R LTW+F+SEVL++LI+
Sbjct  515  FRQLTWNFTSEVLIVLII  532



>ref|XP_002962226.1| hypothetical protein SELMODRAFT_76965 [Selaginella moellendorffii]
 gb|EFJ37486.1| hypothetical protein SELMODRAFT_76965 [Selaginella moellendorffii]
Length=546

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/251 (40%), Positives = 150/251 (60%), Gaps = 15/251 (6%)
 Frame = -3

Query  885  NLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLED------  724
            N+ E       M++FD   + ++ + EF  G+  WL+    S  + +  ++         
Sbjct  300  NIPEGLEAKIWMEEFDHERDGKLSLVEFEEGMANWLN----SSKLGLEFRYFHSWSAILF  355

Query  723  ----FHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDA  556
                F ++ +   Y L   D+   A E  E+P    + A   LL G A+A  FA PLVD 
Sbjct  356  IYSFFVQEAQSSLYAL-LEDEEVHALEDTEDPNGILVTATACLLGGMALACIFAAPLVDT  414

Query  555  VDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNV  376
            +D+FS A+ IP FF+SF+  P+AT+SSE +S+I FAS+K+ R  S+T+S+LYG+V +NN 
Sbjct  415  IDDFSRASHIPAFFVSFVVTPIATSSSEVISSITFASKKQKRGISVTYSQLYGSVVLNNT  474

Query  375  LCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIA  196
            LCL +FLA+V ARGL WDFS+EVL++ +  + MG  G + +T PL+ +F AF LYPLS+ 
Sbjct  475  LCLGLFLAIVAARGLVWDFSAEVLIMALATMAMGCVGGLFTTIPLFMAFGAFLLYPLSLG  534

Query  195  LVYVLDYVFGW  163
            LV +L+   GW
Sbjct  535  LVVLLNQFLGW  545



>ref|XP_002985423.1| hypothetical protein SELMODRAFT_122258, partial [Selaginella 
moellendorffii]
 gb|EFJ13553.1| hypothetical protein SELMODRAFT_122258, partial [Selaginella 
moellendorffii]
Length=147

 Score =   176 bits (447),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -3

Query  600  GTAIAAAFADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSAS  421
            G+ +AAAFADPLV++++ F+ A+ IP FFI+F+  PLA+N+SE VS+I FA +++ R+ S
Sbjct  1    GSLLAAAFADPLVNSINGFAQASQIPPFFIAFVFTPLASNASELVSSISFAQKRRKRNIS  60

Query  420  LTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPL  241
            LTFS++YGAVTMNN LCL +FL LVY RGLTWDFSSEV  ILI    +GV G  R TFP 
Sbjct  61   LTFSQIYGAVTMNNTLCLGIFLGLVYTRGLTWDFSSEVTAILITTFFVGVLGGSRMTFPS  120

Query  240  WTSFIAFSLYPLSIALVYVLDYVFGW  163
            W S     LYPLSIA +  LD V GW
Sbjct  121  WLSLPVLVLYPLSIASIAFLDNVLGW  146



>gb|KCW69971.1| hypothetical protein EUGRSUZ_F03285 [Eucalyptus grandis]
Length=498

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 120/171 (70%), Gaps = 9/171 (5%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEV-------QVSRNVPVTLK  736
            +EI+LD NDAVD++M  FDTS +  +  DEF  G+ KWLDE         + R     + 
Sbjct  328  EEIDLDANDAVDEIMAAFDTSRDDRLSQDEFRKGIKKWLDEAVRAGKGFGLGRFNTTKII  387

Query  735  HLEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDA  556
             + D   +T RE  L  AG Q +E  + VEN K TS+KAV  L+LGT IAAAFADPLVDA
Sbjct  388  DVADHRAKTEREQLL--AGGQGDEVVKVVENAKMTSLKAVGLLILGTVIAAAFADPLVDA  445

Query  555  VDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSEL  403
            VDNFS AT IPTFFISFIALPLATNSSEAVSAIIFASRKK  +ASLTFSE+
Sbjct  446  VDNFSDATGIPTFFISFIALPLATNSSEAVSAIIFASRKKQETASLTFSEV  496



>ref|XP_011082730.1| PREDICTED: uncharacterized protein LOC105165425 [Sesamum indicum]
Length=724

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 151/240 (63%), Gaps = 9/240 (4%)
 Frame = -3

Query  879  DENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTRRE  700
            D + A  K+M++ D S +Q I+ +EFV G+ KWL    V++     +     + E+  + 
Sbjct  493  DIDAAASKMMEELDVSGDQLINEEEFVTGLSKWLKSSYVNQTTTPEIYKDSGYQEKWEQT  552

Query  699  HYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPT  520
              L+    +++  D+ V    WT  KA+  ++LG  +    A+PL+ +V N S A +IP+
Sbjct  553  EKLV----EDKLIDKSVL--AWT--KAIALVVLGIVMLGLLAEPLIHSVQNLSEAANIPS  604

Query  519  FFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYA  340
            FFI+FI +PLATN+  A+SAI    RKKL   SLTFSE+YG V MNN+L  SV L+L+Y 
Sbjct  605  FFIAFIFVPLATNARIAISAISEVRRKKLNINSLTFSEIYGTVLMNNLLGFSVLLSLIYF  664

Query  339  RGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGWS  160
            RGL+WDFS EVL++LIV  VMG   S  + FP+WTSF+A+ LYP+S+ LV VL   F WS
Sbjct  665  RGLSWDFSVEVLMVLIVSAVMGCLASFSTIFPVWTSFLAYLLYPMSLVLVNVLGD-FKWS  723



>ref|XP_002276006.2| PREDICTED: uncharacterized protein LOC100250594 [Vitis vinifera]
Length=516

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 144/198 (73%), Gaps = 8/198 (4%)
 Frame = -3

Query  873  NDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKH---LEDFHEQTRR  703
            +D V ++M+DFD+  + +I+ID F+  + KW  +   + +    LK    ++ F+    R
Sbjct  315  DDDVGEVMRDFDSCGDSKINIDVFIKEISKWRSKNSAACSSDNDLKTRLVVDHFNLAANR  374

Query  702  EHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIP  523
            EH LLG   Q++E  + ++NPKW++ KAVL LLLG+ IAA FAD L++AV NFST T+IP
Sbjct  375  EHELLGV--QSDEVAK-IKNPKWSASKAVLMLLLGSLIAATFADSLINAVGNFSTDTNIP  431

Query  522  TFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVY  343
            +F +SF  LP A  SSEAV+A++FAS+ K+R  SLTFS++YGAV+MNN+LCLSVFL L+Y
Sbjct  432  SFLVSFTVLPFAI-SSEAVAALMFASQNKMR-ISLTFSKIYGAVSMNNLLCLSVFLGLLY  489

Query  342  ARGLTWDFSSEVLVILIV  289
             R L+W+F+S+VL+ILIV
Sbjct  490  FRHLSWNFTSDVLIILIV  507



>ref|XP_011096403.1| PREDICTED: uncharacterized protein LOC105175606 [Sesamum indicum]
Length=719

 Score =   187 bits (474),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 150/249 (60%), Gaps = 9/249 (4%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHE  715
            +E  L   + V K +KDFDT  +  ID  EF+ G+ KWL++           K +++F +
Sbjct  476  EESPLSCQEMVKKFIKDFDTDGDDIIDEQEFMHGMTKWLNKAVDVTKCKDAKKSIDEFDK  535

Query  714  QTRREH----YLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
                E     Y +G   QNE     ++   W   K+ L ++LG AI    + PL+ ++  
Sbjct  536  MMWGEVDDLVYEVG---QNENTK--LKLMTWEFNKSTLEVILGIAILTFLSAPLMTSIQQ  590

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS A  +P+FFISF+ +P+A N+  A+ AI  AS+K  R++SLTFSE+YG V MNN++ L
Sbjct  591  FSDAIGVPSFFISFVIVPVAMNARSAILAIFPASQKSSRTSSLTFSEIYGGVVMNNMMGL  650

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            S  LA+VY + L WD+S+EVL IL+VC ++G+    ++T+PLWT  +AF LYP S+A+ Y
Sbjct  651  STLLAIVYIKELEWDYSAEVLTILVVCGIIGLLAYSQTTYPLWTCVLAFFLYPFSLAMYY  710

Query  186  VLDYVFGWS  160
             L Y+ GW 
Sbjct  711  ALQYILGWG  719



>ref|XP_008225191.1| PREDICTED: uncharacterized protein LOC103324855 [Prunus mume]
Length=563

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/259 (40%), Positives = 147/259 (57%), Gaps = 25/259 (10%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            ++E+ LD++D   K+M++FD S + +I   EFV G+ KW++  + S N         + H
Sbjct  317  IEEVGLDDDDYAAKVMEEFDISGDSQIVETEFVNGISKWINPAKPSAN--------GNSH  368

Query  717  EQTRREHYLLGAGDQNEEADEGVENP------------KWTS-IKAVLFLLLGTAIAAAF  577
            E      +      +NE+  E  + P             WT+ +KA   L+LGT I    
Sbjct  369  EH----KWFFRRNPKNEKTKEDQKMPVAKKKKAKGADKSWTNLVKAAYLLILGTGITVLL  424

Query  576  ADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYG  397
            A PL++ +  FSTA SIP+F  S+I +P +TN   A+ ++  A  K   + SLT SE+Y 
Sbjct  425  AVPLMETMQEFSTAASIPSFLTSYILIPWSTNYRLALRSVTSAREKTDNAISLTLSEIYN  484

Query  396  AVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFS  217
             V MNN   L +FLALVY R L+W+ S+E LV+LI+C VMG+  S    FP WTS IA+ 
Sbjct  485  GVFMNNTTGLIIFLALVYIRNLSWEVSAECLVVLIICTVMGLSTSFSRKFPFWTSIIAYI  544

Query  216  LYPLSIALVYVLDYVFGWS  160
            LYP+S+ LVYVL   FGWS
Sbjct  545  LYPVSLLLVYVLTTFFGWS  563



>gb|KDP21052.1| hypothetical protein JCGZ_21523 [Jatropha curcas]
Length=571

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/253 (37%), Positives = 148/253 (58%), Gaps = 8/253 (3%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS---RNVPVTLKHLE  727
            ++E+ L+E+D V K+ ++FD S +  I  +EF+ G+ KW+    VS        T+K L 
Sbjct  318  IEEVGLNEDDFVSKVFEEFDISGDSNISENEFIQGLSKWISNANVSGKNNQATQTVKKLT  377

Query  726  DFHEQT-----RREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLV  562
              +  +      ++  +    + N+ +    +N  W+ IKA   +L GTA+    A PL+
Sbjct  378  SSNSNSKGNSEEQQSLVAKKAEGNQASKNTNKNAWWSYIKAAFLILSGTAVTFLLATPLM  437

Query  561  DAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMN  382
              +  F+T  +IP+F +S+  +PLA +  +A  AI  A  K  ++ SLT SELYG V MN
Sbjct  438  QTLQEFATDINIPSFLVSYFVVPLALSFKQAYRAITSAREKTEKAVSLTLSELYGGVFMN  497

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            NV+ L++FLALV  + L+WD S+E+L +LI+C  MG+  +  S FP WT  IA++LYP+S
Sbjct  498  NVMGLAIFLALVCIKDLSWDVSAEILTVLIICSGMGLSATFSSKFPFWTCIIAYALYPIS  557

Query  201  IALVYVLDYVFGW  163
            +A +YVL    GW
Sbjct  558  LAFIYVLTTFCGW  570



>gb|EAZ04370.1| hypothetical protein OsI_26513 [Oryza sativa Indica Group]
Length=502

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = -3

Query  894  DEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVS-RNVPVTLKHLEDFH  718
            ++I+ + N A D++M DFDTS N  I+  EFV G+ +WLDE + +  +   + K L DFH
Sbjct  332  EDIDWNSNLAADQVMADFDTSRNHFIEKGEFVNGMLRWLDEAKRTVTSGAYSKKFLNDFH  391

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFST  538
             +TR E    G  D++EE  E   NP WT IKA+L LLLGTA+AAA ADPLVDAV NFS 
Sbjct  392  ARTRDEQT--GLLDKDEEEGEADGNPTWTCIKAILLLLLGTAMAAASADPLVDAVHNFSN  449

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSEL  403
            AT IP+FFISFI +PLATNSSEAVSAIIFASRKK R+ SLTFSE+
Sbjct  450  ATHIPSFFISFIVMPLATNSSEAVSAIIFASRKKKRTLSLTFSEV  494



>ref|XP_011083284.1| PREDICTED: uncharacterized protein LOC105165819 [Sesamum indicum]
Length=714

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 149/243 (61%), Gaps = 23/243 (9%)
 Frame = -3

Query  888  INLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQT  709
            I  D + A  K+M++ D S +Q ID +EFV G+ +WL+    +RN        ED   Q 
Sbjct  481  IPYDADVAASKIMEELDISGDQLIDEEEFVTGLSRWLN---TARNQSPNSDESEDNDYQK  537

Query  708  RREHYLLGAGDQNEEADEGVENP-------KWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
              E           + D+ VE+         WT  KA+  L+LG  +    A+PL+ +V 
Sbjct  538  TWE-----------QTDKLVEDKFIDKSPLAWT--KAITLLVLGIIMLGVLAEPLIQSVH  584

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
            +FS A  IP+F+++FI +PLAT +  AVSAI  A RKKL + SLT SE+YG V MNN+L 
Sbjct  585  DFSKAARIPSFYVAFIFVPLATTARLAVSAINEARRKKLHTTSLTLSEIYGTVFMNNILG  644

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L+V L+L+Y RGL+W+FS+EVL++L+V  ++G   S  + FP+WTS +A+ LYPLS+ LV
Sbjct  645  LAVLLSLIYFRGLSWNFSAEVLMVLLVSAIIGFLASFNTVFPVWTSILAYMLYPLSLILV  704

Query  189  YVL  181
            Y+L
Sbjct  705  YIL  707



>ref|XP_007214217.1| hypothetical protein PRUPE_ppa023212mg [Prunus persica]
 gb|EMJ15416.1| hypothetical protein PRUPE_ppa023212mg [Prunus persica]
Length=535

 Score =   181 bits (459),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 146/251 (58%), Gaps = 9/251 (4%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            ++E+ LD++D   K+M++FD   + +I   EFV G+ KW++  + S N   + +H   F 
Sbjct  289  IEEVGLDDDDYAAKVMEEFDIPGDSQIVETEFVNGISKWINPAKPSAN-GSSHEHKWFFR  347

Query  717  EQTRREHYLLGAGDQNE----EADEGVENPKWTS-IKAVLFLLLGTAIAAAFADPLVDAV  553
               + E       DQ      +      +  WT+ +KA   L+LGT I    A PL+  +
Sbjct  348  RNPKDEK---TKEDQKRLVAKKKKAKGADKSWTNLVKAAYLLILGTGITVLLAVPLMQTM  404

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
              FSTA SIP+F  S+I +P ATN   A+ ++  A  K   + SLT SE+Y  V MNN++
Sbjct  405  KEFSTAASIPSFLTSYILIPWATNYRLALRSVTSAREKTDNAISLTLSEIYNGVFMNNIM  464

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
             L++FLALVY R L+W+ S+E LV+LI+C  MG+  S    FP WTS IA+ LYP+S+ L
Sbjct  465  GLTIFLALVYIRNLSWEVSAESLVVLIICTAMGLSTSFSRKFPFWTSIIAYILYPVSLLL  524

Query  192  VYVLDYVFGWS  160
            VYVL   FGWS
Sbjct  525  VYVLTTFFGWS  535



>ref|XP_008383659.1| PREDICTED: uncharacterized protein LOC103446347 [Malus domestica]
Length=563

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/260 (40%), Positives = 151/260 (58%), Gaps = 25/260 (10%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            ++EI LD++D  +++MK FD S + +I   EFV G+ KW++  +   N     +H   F 
Sbjct  315  IEEIGLDDDDYAEEVMKQFDLSGDAQIAETEFVNGISKWINPDKTPANGKGN-EHRSLF-  372

Query  717  EQTRREHYLLGAGDQNEEADEGVENP-------------KWTSI-KAVLFLLLGTAIAAA  580
               RR H       +NE + E  + P              W ++ KA   ++LGTAI   
Sbjct  373  ---RRNH------SKNETSMEDQQTPLISKKKKTRGADTSWMNLLKAAFLIILGTAITVF  423

Query  579  FADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELY  400
             + PL+ ++  FSTA SIP+F  S++ +PLATN   A+ ++  A  K   + SLT SE+Y
Sbjct  424  LSMPLMVSLQEFSTAASIPSFTTSYVVIPLATNYRLALMSVSSAKEKTENAISLTLSEIY  483

Query  399  GAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAF  220
             A  MNN++ L +FLALVY R L+WD ++EVLV+LI+ I +G+  S    FP WTS +A+
Sbjct  484  NAAFMNNIVGLIIFLALVYIRNLSWDVAAEVLVVLIISIAVGLSASFSRKFPFWTSILAY  543

Query  219  SLYPLSIALVYVLDYVFGWS  160
             LYP+S+ LVYVL  V GWS
Sbjct  544  ILYPISLLLVYVLTIVIGWS  563



>ref|XP_008358657.1| PREDICTED: uncharacterized protein LOC103422380 [Malus domestica]
Length=410

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/246 (40%), Positives = 148/246 (60%), Gaps = 13/246 (5%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            ++EI LD++D  +++MK FD S + +I   EFV G+ KW++  +       ++   ED  
Sbjct  178  IEEIGLDDDDYAEEVMKQFDLSGDAQITETEFVNGISKWINPDKTPAKNETSM---ED--  232

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFST  538
                ++  L+    +   AD    N     +KA   ++LGTAI    + PL+ ++  FST
Sbjct  233  ----QQIPLIVKKKKTRGADTSWMNL----LKAAFLIILGTAITVFLSMPLMVSLQEFST  284

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  358
            A SIP+F  S++ +PLATN   A+ +++ A  K   + SLT SE+Y A  MNN++ L +F
Sbjct  285  AASIPSFMASYVVIPLATNYRLALMSVLSAKDKTENAISLTLSEIYNAAFMNNIVGLIIF  344

Query  357  LALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLD  178
            LALVY R L+WD ++EVLV+LI+ I +G+  S    FP WTS +A+ LYP+S+ LVYVL 
Sbjct  345  LALVYIRNLSWDVAAEVLVVLIISIAVGLSASFSRKFPFWTSILAYILYPISLLLVYVLT  404

Query  177  YVFGWS  160
             V GWS
Sbjct  405  IVIGWS  410



>ref|XP_006594741.1| PREDICTED: uncharacterized protein LOC100798009 isoform X1 [Glycine 
max]
Length=712

 Score =   181 bits (459),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 147/242 (61%), Gaps = 5/242 (2%)
 Frame = -3

Query  885  NLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTR  706
            +++  +AV  ++++ D   ++ I+  EFVAG +KWL     S   PV+    ++   QT 
Sbjct  476  SMEVEEAVALVIEELDIDKDRTINEKEFVAGFEKWLS--STSAPAPVSDSESQEDMFQTW  533

Query  705  REHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSI  526
             E  ++    QN      V+   W  IKA+ +++LG A+ +  A+PL ++V NFS +   
Sbjct  534  EEADIVVEERQNNAV---VDKSIWAWIKAITYVMLGIAMLSILAEPLTESVHNFSNSAGF  590

Query  525  PTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALV  346
              FF+SFI  PLATN+ EA SAI  AS KK R+ SL  SE+YG V MNN+L       L+
Sbjct  591  HPFFMSFILAPLATNAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGFFAISVLI  650

Query  345  YARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFG  166
            + R +TW FS+E+LV+ IVC + G+  S  S FP+W+SFIA  LYPLS+ LV++LD+V  
Sbjct  651  FVREVTWQFSAELLVVAIVCAITGITASFHSIFPIWSSFIAILLYPLSLVLVFILDHVLN  710

Query  165  WS  160
            ++
Sbjct  711  YN  712



>ref|XP_006594742.1| PREDICTED: uncharacterized protein LOC100798009 isoform X2 [Glycine 
max]
Length=705

 Score =   181 bits (459),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 147/242 (61%), Gaps = 5/242 (2%)
 Frame = -3

Query  885  NLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTR  706
            +++  +AV  ++++ D   ++ I+  EFVAG +KWL     S   PV+    ++   QT 
Sbjct  469  SMEVEEAVALVIEELDIDKDRTINEKEFVAGFEKWLS--STSAPAPVSDSESQEDMFQTW  526

Query  705  REHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSI  526
             E  ++    QN      V+   W  IKA+ +++LG A+ +  A+PL ++V NFS +   
Sbjct  527  EEADIVVEERQNNAV---VDKSIWAWIKAITYVMLGIAMLSILAEPLTESVHNFSNSAGF  583

Query  525  PTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALV  346
              FF+SFI  PLATN+ EA SAI  AS KK R+ SL  SE+YG V MNN+L       L+
Sbjct  584  HPFFMSFILAPLATNAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGFFAISVLI  643

Query  345  YARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFG  166
            + R +TW FS+E+LV+ IVC + G+  S  S FP+W+SFIA  LYPLS+ LV++LD+V  
Sbjct  644  FVREVTWQFSAELLVVAIVCAITGITASFHSIFPIWSSFIAILLYPLSLVLVFILDHVLN  703

Query  165  WS  160
            ++
Sbjct  704  YN  705



>ref|XP_006594743.1| PREDICTED: uncharacterized protein LOC100798009 isoform X3 [Glycine 
max]
Length=694

 Score =   181 bits (458),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 147/242 (61%), Gaps = 5/242 (2%)
 Frame = -3

Query  885  NLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTR  706
            +++  +AV  ++++ D   ++ I+  EFVAG +KWL     S   PV+    ++   QT 
Sbjct  458  SMEVEEAVALVIEELDIDKDRTINEKEFVAGFEKWLS--STSAPAPVSDSESQEDMFQTW  515

Query  705  REHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSI  526
             E  ++    QN      V+   W  IKA+ +++LG A+ +  A+PL ++V NFS +   
Sbjct  516  EEADIVVEERQNNAV---VDKSIWAWIKAITYVMLGIAMLSILAEPLTESVHNFSNSAGF  572

Query  525  PTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALV  346
              FF+SFI  PLATN+ EA SAI  AS KK R+ SL  SE+YG V MNN+L       L+
Sbjct  573  HPFFMSFILAPLATNAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGFFAISVLI  632

Query  345  YARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFG  166
            + R +TW FS+E+LV+ IVC + G+  S  S FP+W+SFIA  LYPLS+ LV++LD+V  
Sbjct  633  FVREVTWQFSAELLVVAIVCAITGITASFHSIFPIWSSFIAILLYPLSLVLVFILDHVLN  692

Query  165  WS  160
            ++
Sbjct  693  YN  694



>ref|XP_002522528.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39828.1| conserved hypothetical protein [Ricinus communis]
Length=521

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 148/258 (57%), Gaps = 16/258 (6%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRN------------  754
            ++E    +++ V K+M++FD S +  I  +EFV G+ KWL E  VS N            
Sbjct  266  IEEAGSSKDEFVSKVMEEFDISGDSSISENEFVQGLSKWLSEANVSGNDQTKKTNKKSST  325

Query  753  -VPVTLKHLEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAF  577
                +     +    T  +  L+    ++++ D  V    W   KAV  ++ GTA+    
Sbjct  326  ATSNSTSTSSNSKGTTEEQQGLVTKSQESKDTDNSV---LWDYAKAVFLIISGTAVTFLI  382

Query  576  ADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYG  397
            A PL+  + +F+TA +IP+F +S+  +PLA +  +A  AI  A  K   +ASLT SELYG
Sbjct  383  ATPLMTTLQDFATAINIPSFLVSYFVVPLALSFKQAYRAITSAREKTENAASLTLSELYG  442

Query  396  AVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFS  217
             V MNNV+ L++FL LV  + L+WD S+E+LV+LI+C  MG++ +  + FP WTS IA++
Sbjct  443  GVFMNNVMGLAIFLLLVCIKDLSWDVSAEILVVLIICSGMGIYATFSTKFPFWTSIIAYA  502

Query  216  LYPLSIALVYVLDYVFGW  163
            LYP+S+A +YVL    GW
Sbjct  503  LYPISLAFIYVLTTYCGW  520



>ref|XP_004293919.1| PREDICTED: uncharacterized protein LOC101312324 [Fragaria vesca 
subsp. vesca]
Length=562

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/259 (37%), Positives = 144/259 (56%), Gaps = 29/259 (11%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            + E+ LD +D VDK M+DFD S + +I   EFV G+ KW++    +              
Sbjct  320  IGEVGLD-SDYVDKAMEDFDISGDSQISEQEFVDGISKWVNATPSANG-----------Q  367

Query  717  EQTRREHYLLGAGDQNEEADEG------------VENPKWTS-IKAVLFLLLGTAIAAAF  577
             Q  R         + EEA  G            + +  WT+ +KA   L+LG  I    
Sbjct  368  GQGHRRFL----SSKTEEALGGKQKQVSKKKKSKLTDKTWTNQLKAACLLILGIGIMILL  423

Query  576  ADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYG  397
            A PL++ + +FSTA SIP+FF S++ +PLA N  +A+  I  A  K   + SL+ SE+Y 
Sbjct  424  ATPLMETIQDFSTAASIPSFFTSYVLIPLAINYGQALQLITSAQDKTENAVSLSLSEIYN  483

Query  396  AVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFS  217
             V MNNV+ L++FLALVY R L+WD  + VL +LI+C VMG++ S  + FP WT  +A+ 
Sbjct  484  GVFMNNVMGLTIFLALVYIRNLSWDVCAAVLAVLIICSVMGLYTSFSTKFPFWTCILAYI  543

Query  216  LYPLSIALVYVLDYVFGWS  160
            +YP+S+ ++YVL    GW+
Sbjct  544  MYPISLLMIYVLTSYLGWT  562



>ref|XP_009352959.1| PREDICTED: uncharacterized protein LOC103944258 [Pyrus x bretschneideri]
Length=564

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 151/260 (58%), Gaps = 25/260 (10%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            +++I LD++D V ++MK FD S + +ID  EFV G+ KW++  +     P   K  E  H
Sbjct  316  INDIGLDDDDYVAEVMKQFDLSGDAQIDETEFVNGISKWINLAKP----PANGKGHE--H  369

Query  717  EQTRREHYLLGAGDQNEEADEGVENP-------------KWTSI-KAVLFLLLGTAIAAA  580
                R +       +NE++ E    P              W ++ KA   ++LGTA+   
Sbjct  370  RSLFRRN-----NSKNEKSIEDQLTPLISKKKETKGATTSWMNLLKAAFLIILGTAMTVF  424

Query  579  FADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELY  400
             + PL++++  FSTA SIP+F +S++ +PLATN   A+ ++  A  K   + SLT SE+Y
Sbjct  425  LSTPLMESLQKFSTAASIPSFAVSYVVIPLATNYRLALMSVTSAKEKTENAISLTLSEIY  484

Query  399  GAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAF  220
             A  MNN++ L +FLALVY R L+WD +++VLV+L++   +G+       FP WTS +A+
Sbjct  485  NATFMNNIVGLVIFLALVYIRNLSWDVAADVLVVLLISTAVGLSACFSRKFPFWTSILAY  544

Query  219  SLYPLSIALVYVLDYVFGWS  160
             LYPLS+ LVYVL  V GWS
Sbjct  545  ILYPLSLLLVYVLTTVIGWS  564



>gb|KCW67432.1| hypothetical protein EUGRSUZ_F01188 [Eucalyptus grandis]
Length=502

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 161/249 (65%), Gaps = 11/249 (4%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHL--EDFH  718
            +I  D ++ V K+++ FD S N +I+ +EFVAG+   LD       +  +  +   +DF+
Sbjct  260  DIPFDVDEVVSKVIEVFDRSGNCQINEEEFVAGLVNLLDTSGEGNKIRASKLNTSQDDFY  319

Query  717  EQTRREHYLLGAGDQNEEADEG---VENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            ++T  E       D+  + D+G    E   W  +K++  LLLG  I A  A+PL+ +V +
Sbjct  320  QRTWEEI------DKLVDEDKGKGDAEKASWIWVKSMSSLLLGVIILAVLAEPLISSVQS  373

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS +  IP+FFISFI +PLATN+  A +AI  A  KK R+ SLT SE+YG V M+N+L  
Sbjct  374  FSKSAGIPSFFISFILVPLATNARGASAAIKAARHKKERTTSLTLSEIYGEVFMSNMLGF  433

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             V L+L+YAR LTW+FS+EVLV+LIVC V+G+  S RSTFP+WTS +A+ LYPLS+ LVY
Sbjct  434  CVLLSLIYARDLTWEFSAEVLVVLIVCGVVGLIASFRSTFPVWTSILAYLLYPLSLLLVY  493

Query  186  VLDYVFGWS  160
            VLD V  +S
Sbjct  494  VLDDVLNYS  502



>gb|KCW67433.1| hypothetical protein EUGRSUZ_F01189 [Eucalyptus grandis]
Length=502

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 161/249 (65%), Gaps = 11/249 (4%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHL--EDFH  718
            +I+ D ++ V K+++ FD S N +I+ +EFVAG+   LD       +  +  +   +DF+
Sbjct  260  DISFDVDEVVSKVIEVFDRSGNSQINEEEFVAGLVNLLDTSGEGSKIQASKLNTSQDDFY  319

Query  717  EQTRREHYLLGAGDQNEEADEGVENPK---WTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            ++T  E       D+  + D+G  + K   W  +K++  LLLG  I A  A+PL+ +V +
Sbjct  320  QRTWEE------TDKLVDEDKGKGDAKKASWIWVKSMSSLLLGVIILAVLAEPLISSVQS  373

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS +  IP FFISFI +PLATN+  A +AI  A  KK R+ SLT SE+YG V M+N+L  
Sbjct  374  FSKSAGIPPFFISFILVPLATNARGASAAIKAARHKKERTTSLTLSEIYGEVFMSNMLGF  433

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             V L+L+Y R LTW+FS+EVLV+LIVC ++G+  S RSTFP+WTS +A+ LYPLS+ LVY
Sbjct  434  CVLLSLIYVRDLTWEFSAEVLVVLIVCSLVGLIASFRSTFPVWTSILAYLLYPLSLLLVY  493

Query  186  VLDYVFGWS  160
            VLD V  +S
Sbjct  494  VLDDVLNYS  502



>ref|XP_010060649.1| PREDICTED: uncharacterized protein LOC104448505 [Eucalyptus grandis]
Length=727

 Score =   174 bits (441),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 161/249 (65%), Gaps = 11/249 (4%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHL--EDFH  718
            +I+ D ++ V K+++ FD S N +I+ +EFVAG+   LD       +  +  +   +DF+
Sbjct  485  DISFDVDEVVSKVIEVFDRSGNSQINEEEFVAGLVNLLDTSGEGSKIQASKLNTSQDDFY  544

Query  717  EQTRREHYLLGAGDQNEEADEGVENPK---WTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            ++T  E       D+  + D+G  + K   W  +K++  LLLG  I A  A+PL+ +V +
Sbjct  545  QRTWEET------DKLVDEDKGKGDAKKASWIWVKSMSSLLLGVIILAVLAEPLISSVQS  598

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS +  IP FFISFI +PLATN+  A +AI  A  KK R+ SLT SE+YG V M+N+L  
Sbjct  599  FSKSAGIPPFFISFILVPLATNARGASAAIKAARHKKERTTSLTLSEIYGEVFMSNMLGF  658

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
             V L+L+Y R LTW+FS+EVLV+LIVC ++G+  S RSTFP+WTS +A+ LYPLS+ LVY
Sbjct  659  CVLLSLIYVRDLTWEFSAEVLVVLIVCSLVGLIASFRSTFPVWTSILAYLLYPLSLLLVY  718

Query  186  VLDYVFGWS  160
            VLD V  +S
Sbjct  719  VLDDVLNYS  727



>gb|KDP21053.1| hypothetical protein JCGZ_21524 [Jatropha curcas]
Length=686

 Score =   174 bits (441),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 144/247 (58%), Gaps = 29/247 (12%)
 Frame = -3

Query  888  INLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQT  709
            + LD +D V+K+MK FD +N++E+  DEF  G+ K L                       
Sbjct  465  VKLDHDDLVEKMMKAFDVNNDKELHEDEFTNGLKKRLSS-------------------DG  505

Query  708  RREHYLLGAGDQNEEADEGVENPKWTSI----KAVLFLLLGTAIAAAFADPLVDAVDNFS  541
               H++    D+  E ++G  N K  S+    KA+L +++G AI ++   PLV+     S
Sbjct  506  NNSHFI----DECIEKEKG--NIKKLSLRSLMKALLRVVIGIAIVSSLGLPLVNNTQLLS  559

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
                IP+FF+SF+ LP A N   A++ I  AS+KK  ++S+ FSE+YGAV MNN+L L  
Sbjct  560  ERIGIPSFFVSFVVLPFAVNFKTAMATIFPASQKKEGASSIMFSEIYGAVFMNNILGLVT  619

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
             + L++ARG TW +S+EVLVI+++  ++G+    R  +PLWT  +AFSLYPLS+ L Y++
Sbjct  620  LVGLIWARGFTWVYSAEVLVIVVISAIIGLIAFRRIKYPLWTCIVAFSLYPLSLLLFYII  679

Query  180  DYVFGWS  160
             Y+ GW 
Sbjct  680  RYIVGWK  686



>ref|XP_006340117.1| PREDICTED: uncharacterized protein LOC102587762 [Solanum tuberosum]
Length=703

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/245 (38%), Positives = 146/245 (60%), Gaps = 17/245 (7%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            +  L+   +V ++MKDFD +++  ID +EF+ GV  WL      RN   T K   D    
Sbjct  469  QARLNHKTSVKEIMKDFDQNDDHMIDENEFLRGVTYWL------RNAKQTTKEHHDKVMW  522

Query  711  TRREHYLLGAGDQNEEADEGVENP----KWTSIKAVLFLLLGTAIAAAFADPLVDAVDNF  544
               E +L    D+ E  +    N     KW   K+VL ++LG AI    ADP++D +   
Sbjct  523  GEVEKFL----DEAERGNHRCFNHSLVLKWDICKSVLQVILGIAILTLCADPIMDNIIQL  578

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIF---ASRKKLRSASLTFSELYGAVTMNNVL  373
            ++A  +P+FF+SF+ +PLA N+  A++AI     A+++   ++SLTFSE+Y  V MNN++
Sbjct  579  ASAIGVPSFFLSFVIVPLAINARTAITAITLLSSANQQSCTTSSLTFSEIYVGVIMNNIM  638

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
             +S  L ++YA+ L W++S EVLV +++C V G F   R+T+PLWT  +AF  YP+++AL
Sbjct  639  GMSTVLTVLYAKDLRWEYSPEVLVSMVICAVNGSFAFTRTTYPLWTCIVAFLFYPIALAL  698

Query  192  VYVLD  178
            +Y+L 
Sbjct  699  LYILQ  703



>gb|EYU28050.1| hypothetical protein MIMGU_mgv1a023246mg [Erythranthe guttata]
Length=682

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/244 (38%), Positives = 135/244 (55%), Gaps = 16/244 (7%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            E      D + +L  DFD  +N  ID  EFV GV KWL++     N P   + +++F + 
Sbjct  455  EFKPKREDIIKELFNDFDKDDNNSIDEREFVEGVKKWLNKAIHVANTPDKTRSIDEFDQI  514

Query  711  TRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTAT  532
              ++                V N     I ++  ++ G  I      PL+ ++   S A 
Sbjct  515  VWKK---------------AVHN-NGALIVSIFQVVFGIGILTFLGGPLMGSILQLSYAM  558

Query  531  SIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLA  352
             +P+F ISF+ +PLA N+  A++A + AS+K  RSASLTFSE+YG V MNN+  L+  LA
Sbjct  559  GLPSFGISFVIVPLAMNARAALTAFLPASQKSERSASLTFSEIYGGVIMNNIAGLTTLLA  618

Query  351  LVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYV  172
            +VYA+ LTWDFS+EVL IL+VC ++G       T+PLWTS +AF LYP S+ L Y +   
Sbjct  619  IVYAKDLTWDFSAEVLTILVVCAIIGYLSYSSPTYPLWTSIVAFFLYPFSMGLCYFVQVY  678

Query  171  FGWS  160
              W+
Sbjct  679  LSWN  682



>ref|XP_009352820.1| PREDICTED: uncharacterized protein LOC103944133 [Pyrus x bretschneideri]
Length=567

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 147/260 (57%), Gaps = 25/260 (10%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            ++ I LD++D  +++MK  D S + +I   EFV G+ KW++  +   N        ++ H
Sbjct  319  IEAIGLDDDDYAEEVMKQLDLSGDAQIAETEFVNGLSKWINPDKSPANGK------DNEH  372

Query  717  EQTRREHYLLGAGDQNEEADEGVENP-------------KWTSI-KAVLFLLLGTAIAAA  580
                R +       +NE   E  + P              W ++ KA   ++LGTAI A 
Sbjct  373  RSLFRRN-----NSKNETPMEDQQTPLISKKKKTRGADTSWMNLLKAAFLIILGTAITAF  427

Query  579  FADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELY  400
             + PL+ ++  FSTA SIPTF  S++ +PLATN   A+ ++  A  K   + SLT SE+Y
Sbjct  428  LSMPLMVSLQEFSTAASIPTFTTSYVVIPLATNYRVALMSVSSAKEKTENAISLTLSEIY  487

Query  399  GAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAF  220
             A  MNN++ L +FLALVY R L+W  ++EVLV+LI+ I +G+  S    FPLWT  +A+
Sbjct  488  NAAFMNNIVGLVIFLALVYIRNLSWHVAAEVLVVLIISIAVGLSASFSRRFPLWTCILAY  547

Query  219  SLYPLSIALVYVLDYVFGWS  160
             LYP+S+ LVYVL  V GWS
Sbjct  548  ILYPISLLLVYVLTIVIGWS  567



>ref|XP_010101519.1| hypothetical protein L484_008850 [Morus notabilis]
 gb|EXB88531.1| hypothetical protein L484_008850 [Morus notabilis]
Length=536

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 148/247 (60%), Gaps = 1/247 (0%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            ++E  L ++D V ++M+ FDTS + +I+  EFV G+  WL   + S + P       +  
Sbjct  290  IEESGLRQDDLVARVMEQFDTSQDHQINEQEFVTGLSNWLIVARDSISHPHHGIFRRNSA  349

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTS-IKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
            + T  E   L A +   ++        W + +KA L ++LGTAI      PLV  +  FS
Sbjct  350  KTTTEEQQSLIAKNVATQSAANDGRKDWLNYVKAGLLIILGTAITLTLGQPLVGTLVQFS  409

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
             A ++P+F IS++ +PLA N  +AV AI  A  K  ++ SL  SE+Y  + MNN++ L  
Sbjct  410  FAANVPSFLISYVVIPLALNFGQAVRAISSAREKTEKAISLMLSEIYNRIFMNNLMGLVG  469

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            FLALVY R ++WD S+EVLV+LI+C +MG++ S  + FP+WTS +AF LYP+S+  +Y+L
Sbjct  470  FLALVYIRNVSWDVSAEVLVVLIICTLMGLYTSFSTKFPVWTSIVAFLLYPISLLSLYLL  529

Query  180  DYVFGWS  160
              V GWS
Sbjct  530  TSVLGWS  536



>ref|XP_008383883.1| PREDICTED: uncharacterized protein LOC103446524 [Malus domestica]
Length=594

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/263 (38%), Positives = 148/263 (56%), Gaps = 31/263 (12%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            ++EI LD++D V ++MK FD S + +I   EFV G+ KW++  +   N        +  H
Sbjct  346  IEEIGLDDDDYVSEVMKQFDLSGDAQIAETEFVNGISKWINPAKPPAN--------DKGH  397

Query  717  EQT---RREHYLLGAGDQNEEADE--------------GVENPKWTSIKAVLFLLLGTAI  589
            E T   RR +       +NE++ E              G +      +KA   ++LGTAI
Sbjct  398  EHTSLFRRNN------SKNEKSMEDQLTLLISKKNGTKGADTSWMNLLKAAFLIILGTAI  451

Query  588  AAAFADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFS  409
                + PL+ ++  FSTA SIP+F  S++ +PLATN   A+ ++  A  K   + SLT S
Sbjct  452  TVFLSMPLMVSLRKFSTAASIPSFAASYVVIPLATNYRLALMSVTSAKEKTEDAISLTLS  511

Query  408  ELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSF  229
            E+Y A  MNN++ L +FLALVY R L+WD ++EVLV+L++   +G   S    FP WT  
Sbjct  512  EIYTAAFMNNIVGLVIFLALVYIRNLSWDVAAEVLVVLLISTAVGFSASFSRKFPFWTCI  571

Query  228  IAFSLYPLSIALVYVLDYVFGWS  160
            +A+ LYP+S+ LV+VL  V GWS
Sbjct  572  LAYILYPISLLLVHVLTTVIGWS  594



>ref|XP_004234097.2| PREDICTED: uncharacterized protein LOC101254062 isoform X1 [Solanum 
lycopersicum]
Length=694

 Score =   172 bits (437),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/244 (37%), Positives = 145/244 (59%), Gaps = 13/244 (5%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            ++ L+ +D+V K+M DFDT+ N  ID  EFV G+ +WL+E        + +   +D    
Sbjct  458  DVQLNSDDSVMKVMNDFDTNRNNMIDEHEFVEGMTRWLNE-------AIRVTDCKDKKRA  510

Query  711  TRREHYLLGAGDQN---EEADEGVENPK---WTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
                  ++ +  +N   E   +G  N K   W   K++  L+LG A+    + PLVD++ 
Sbjct  511  IDEYDKIMWSKVENLVYEVEKDGKINYKLLTWAFNKSIFQLILGVAMMTLCSKPLVDSIK  570

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
              S A  +P+F I F+ +PLA N+   ++AI  AS+K  ++ASLTFSE+Y  V  NN++ 
Sbjct  571  KLSEAIGMPSFLIPFVIVPLALNARMTIAAIYPASQKCSKTASLTFSEIYVGVIRNNIMG  630

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            ++  LA+VYA+ LTWD+S++VL++L+ C ++GV     + +PLWTS +AFSLYP  +   
Sbjct  631  MTTLLAIVYAKDLTWDYSAQVLIVLVACGIIGVLALFSTRYPLWTSLLAFSLYPSCVMFF  690

Query  189  YVLD  178
            Y+L 
Sbjct  691  YLLQ  694



>ref|XP_007021646.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
 gb|EOY13171.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
Length=714

 Score =   171 bits (434),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 131/201 (65%), Gaps = 6/201 (3%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            ++ LD N+ V K++++ DTS ++ ID  EFV G+ KWL   +   + P + +  +D + +
Sbjct  482  QVPLDANEVVTKVIEELDTSGDRRIDQQEFVIGISKWLKTSEKEAS-PSSFESQDDIYLK  540

Query  711  TRREHYLLGAGDQNEEADEGV-ENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTA  535
            T  E   L     +EE+  GV +  KW  IKA++++++G  I A  A+PL+ +V +FS A
Sbjct  541  TWEETDKL----VDEESSNGVVDASKWAWIKAIMYMVIGIIILAVLAEPLIYSVQSFSEA  596

Query  534  TSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFL  355
              IP+FF SFI +P ATN+  A SAI  A RKK R+ SLTFSE+YG V MNN L  SV +
Sbjct  597  AGIPSFFTSFILVPFATNARAATSAISAARRKKPRTTSLTFSEIYGGVFMNNTLGFSVLI  656

Query  354  ALVYARGLTWDFSSEVLVILI  292
            ALVYARGLTW+FS EVL +L+
Sbjct  657  ALVYARGLTWEFSGEVLAVLL  677



>ref|XP_011460767.1| PREDICTED: uncharacterized protein LOC105350439 [Fragaria vesca 
subsp. vesca]
Length=730

 Score =   171 bits (434),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 176/247 (71%), Gaps = 11/247 (4%)
 Frame = -3

Query  888  INLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQT  709
            I LD +++V+KL+++ DTS +  I+ +EFV G+ KW+++   S+ +P +L+  +D +++T
Sbjct  491  IPLDVDESVNKLVEELDTSGDHMINEEEFVTGLTKWMNKSHDSQGLP-SLESEDDLYQRT  549

Query  708  RREHYLLGAGDQ--NEEADEG--VENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFS  541
                    A D+  +EE   G  V+   W   KA+ ++++G  + A  A+PL+D V +FS
Sbjct  550  ------WDATDKLVDEETSSGRPVDKSLWGWFKAISYMVIGFVVLAVLAEPLIDNVQDFS  603

Query  540  TATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSV  361
            TA  IP+FF++F+ +PLATN+ +A SAI  ASR+  R+  LTFSE+YG V MNNVL  SV
Sbjct  604  TAAGIPSFFVAFVLVPLATNARQAASAISAASRQTPRTTDLTFSEIYGGVFMNNVLGFSV  663

Query  360  FLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
             LA++Y R +TW+FS+EVLV+LIVC+V+G+  S+RSTFPLWT+F+AF LYPLS+ LVY+L
Sbjct  664  LLAIIYVREMTWEFSAEVLVVLIVCLVVGLIASVRSTFPLWTAFVAFLLYPLSLLLVYIL  723

Query  180  DYVFGWS  160
            + V G++
Sbjct  724  NDVIGYT  730



>ref|XP_009352958.1| PREDICTED: uncharacterized protein LOC103944256 [Pyrus x bretschneideri]
Length=594

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 144/249 (58%), Gaps = 5/249 (2%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            ++EI LD++D   ++MK FD S + +I   EFV G+ KW++  +   N  V  +H   F 
Sbjct  346  IEEIGLDDDDYAAEVMKQFDLSGDAQIAEMEFVNGISKWINPAKPPANDKVH-EHRSLFR  404

Query  717  EQ-TRREHYL---LGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVD  550
               ++ E  +   L      +   +G +      +KA   ++LGT I    + PL+ ++ 
Sbjct  405  RNNSKNEKSMEDQLAPLISKKNVTKGADTSWMNLLKAAFLIILGTGITVFLSMPLMVSLR  464

Query  549  NFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLC  370
             FSTA SIP+F  S++ +PLATN   A+ ++  A  K   + SLT SE+Y A  MNN++ 
Sbjct  465  EFSTAASIPSFAASYVVIPLATNYRLALMSVTSAKEKTEDAISLTLSEIYTAAFMNNIVG  524

Query  369  LSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALV  190
            L +FLALVY R L+WD ++EVLV+L++   +G   S    FP WTS +A+ LYP+S+ LV
Sbjct  525  LVIFLALVYIRNLSWDVAAEVLVVLLISTAVGFSASFSRKFPFWTSVLAYILYPISLLLV  584

Query  189  YVLDYVFGW  163
            YVL  V GW
Sbjct  585  YVLSTVIGW  593



>ref|XP_007149413.1| hypothetical protein PHAVU_005G068200g, partial [Phaseolus vulgaris]
 gb|ESW21407.1| hypothetical protein PHAVU_005G068200g, partial [Phaseolus vulgaris]
Length=578

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/244 (40%), Positives = 144/244 (59%), Gaps = 9/244 (4%)
 Frame = -3

Query  885  NLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHE--Q  712
            +++  +AV  ++K+ D  N++ I+ DEFVAG  KWL     S + P  + H E   +  Q
Sbjct  342  SMEVEEAVALVIKELDIDNDRIINEDEFVAGFHKWLS----STSAPAPVSHSESQEDMYQ  397

Query  711  TRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTAT  532
            T  E  ++    Q +     V+   W   KA+L+++LG  + +   +PL ++V NFS + 
Sbjct  398  TWEEADMVVEERQRKAV---VDKSTWAWFKAILYVMLGIVMLSILTEPLTESVHNFSNSV  454

Query  531  SIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLA  352
             +  FF+SFI +PLATN+ EA SAI  AS KK R+ SL  SE+YG V MNN+L       
Sbjct  455  GLHPFFMSFILVPLATNAREATSAIKEASHKKPRTTSLAISEIYGGVFMNNILGFFAISV  514

Query  351  LVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYV  172
            L+    +TW +S+E+LV+ IVC + G+  S  S FPL +SF A  LYPLS+ LV+VLD V
Sbjct  515  LISVGQVTWQYSAELLVVGIVCAIAGLTASFLSIFPLCSSFFAILLYPLSLVLVFVLDQV  574

Query  171  FGWS  160
              ++
Sbjct  575  LRYN  578



>ref|XP_006343216.1| PREDICTED: uncharacterized protein LOC102593213 [Solanum tuberosum]
Length=695

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/243 (36%), Positives = 147/243 (60%), Gaps = 11/243 (5%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            ++ L+ +D+V K+M DFDT+ N  ID  EFV G+ +WL+E     N     + ++++   
Sbjct  459  DVQLNSDDSVRKVMNDFDTNCNNMIDEHEFVDGMTRWLNEAIRVTNCKDKKRAIDEY---  515

Query  711  TRREHYLLGAGDQ--NEEADEGVENPK---WTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
               +  + G  ++   E   +G  N K   W   K++  ++LG A+    + PLV+++  
Sbjct  516  ---DKIMWGEVEKLVYEVEKDGKINYKLLTWAFNKSIFQVILGIAMMTLCSKPLVNSIKK  572

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
             S A  +P+F I F+ +PLA N+   ++AI  AS+K  ++ASLTFSE+Y  V  NN++ +
Sbjct  573  LSEAIGMPSFLIPFVIVPLALNARMTIAAIYPASQKCSKTASLTFSEIYVGVMRNNIMGM  632

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            +  LA+VYA+ LTWD+S++VL++L+ C ++G+     + +PLWTS +AFSLYP  +   Y
Sbjct  633  TTLLAIVYAKDLTWDYSAQVLIVLVACSIIGLLALFSTRYPLWTSLLAFSLYPSCVVFFY  692

Query  186  VLD  178
            +L 
Sbjct  693  LLQ  695



>gb|EYU26347.1| hypothetical protein MIMGU_mgv1a002045mg [Erythranthe guttata]
Length=723

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/236 (39%), Positives = 147/236 (62%), Gaps = 7/236 (3%)
 Frame = -3

Query  888  INLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQT  709
            I  D +    K+M++ D S +  I  +EFV G+ KWL+ +    +     +  +D +++T
Sbjct  484  IPYDADTVASKIMEELDISGDHLISEEEFVTGLTKWLNTIYNLHHNSEENEEEDDSYQKT  543

Query  708  RREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATS  529
              +       D+  E D+ ++      +KA+  L+LG  +    A+PL+ +V +FS + +
Sbjct  544  WEQ------TDKLIE-DKFIDKSPLAWVKALALLILGIVMLGVLAEPLIRSVRDFSKSAN  596

Query  528  IPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLAL  349
            +P+F+++F+ +PLAT +  AVSAI  A +KKL + SLT SE+YG V MNNVL L V L+L
Sbjct  597  LPSFYVAFVFVPLATTARLAVSAISEARKKKLHTNSLTLSEIYGTVFMNNVLGLIVLLSL  656

Query  348  VYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVL  181
            +Y RGL+W FS+EV ++L+V  VMG   S  +  P+WT+F+A+ +YPLS+ LVYVL
Sbjct  657  IYFRGLSWSFSTEVTMVLVVSAVMGFLASYSTVLPVWTAFLAYLMYPLSLVLVYVL  712



>gb|KCW67434.1| hypothetical protein EUGRSUZ_F01190 [Eucalyptus grandis]
Length=493

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 139/225 (62%), Gaps = 11/225 (5%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHL--EDFH  718
            +I  D ++ V K+++ FD   N +I+ +EFVAG+   LD       +  +  +   +DF+
Sbjct  251  DIPFDVDEVVSKVIEVFDRRGNSQINEEEFVAGLVNLLDTSGEGNKIRASKLNTSQDDFY  310

Query  717  EQTRREHYLLGAGDQNEEADEG---VENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
            ++T  E       D+  + D+G    E   W  +K++  LLLG  I A  A+PL+ +V +
Sbjct  311  QRTWEE------TDKLVDEDKGKGDAEKASWIWVKSMSSLLLGVIILAVLAEPLISSVQS  364

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FS +  IP FFISFI +PLATN+  A  AI  A  KK R+ SLT SE+YG V M+N+L  
Sbjct  365  FSKSAGIPPFFISFILVPLATNARGASLAIKAARHKKERTTSLTLSEIYGEVFMSNMLGF  424

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTS  232
             V L+L+YAR LTW+FS+E LV+LIVC ++G+  S RSTFP+WTS
Sbjct  425  CVLLSLIYARDLTWEFSAEFLVVLIVCGLVGLIASFRSTFPVWTS  469



>ref|XP_006594744.1| PREDICTED: uncharacterized protein LOC100799062 [Glycine max]
Length=503

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 140/244 (57%), Gaps = 19/244 (8%)
 Frame = -3

Query  882  LDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLD----EVQVSRNVPVTLKHLEDFHE  715
            ++  +AV KL++D D + + EI   EFV G  KW+D    +   S++    +    +  E
Sbjct  274  VETEEAVTKLVQDLDLNRDNEISETEFVEGFTKWMDSNSSQAANSKSSSHEIHQTWEDVE  333

Query  714  QTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTA  535
            +   E+   GA               W  + A+ +++LG  I A  A+PL+ +V  FS  
Sbjct  334  KVMEENQTKGAS-------------AW--LTAIAYVVLGVTILALLAEPLIASVQKFSEE  378

Query  534  TSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFL  355
              I +FFISFI +PLATN  EA SAI  AS KK  + S T  E+YGAV MNN+L   V  
Sbjct  379  AGISSFFISFILVPLATNFREATSAIKEASHKKSSNTSQTMYEIYGAVFMNNILGFVVIS  438

Query  354  ALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDY  175
             L+Y R +TW+FS++VLV+ IVC VMG+  S R TFPLWTSF A+ +Y +++ LV+VL  
Sbjct  439  ILIYMREITWEFSADVLVVAIVCAVMGLTASFRPTFPLWTSFPAYLMYLIALLLVFVLKD  498

Query  174  VFGW  163
            V  +
Sbjct  499  VLNY  502



>ref|XP_002522529.1| calmodulin, putative [Ricinus communis]
 gb|EEF39829.1| calmodulin, putative [Ricinus communis]
Length=703

 Score =   168 bits (426),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 91/242 (38%), Positives = 140/242 (58%), Gaps = 11/242 (5%)
 Frame = -3

Query  885  NLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTR  706
             LD +D V K+MK FD   ++EI ++EF  G+ K L             + +++  E   
Sbjct  473  KLDHDDVVKKMMKVFDVDKDKEIHVEEFTDGMKKRLSG---------DFQLIDECIESLI  523

Query  705  REHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSI  526
             E  +     Q E++ + +     T  K+ + ++LG AI ++   PL++     S    I
Sbjct  524  SESCISSLKLQKEKSIKKMSLRALT--KSGILVVLGVAIVSSLGMPLINNTQLLSERIGI  581

Query  525  PTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALV  346
             +F+ISF+ LP A N   A++ I  AS+KK  ++S+ FSE+YGAV MNNV  L   LAL+
Sbjct  582  SSFYISFVVLPFAVNFKTAMATIFPASQKKEEASSIMFSEIYGAVFMNNVSGLLTLLALI  641

Query  345  YARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFG  166
            +ARG TWD+S+EV+V+L+V  ++G    +R  +PLWT  +AFS YPLS+ L YV+ +V G
Sbjct  642  WARGFTWDYSAEVIVLLVVSAIIGAIAFLRRIYPLWTCLLAFSFYPLSLVLFYVIRFVLG  701

Query  165  WS  160
            W 
Sbjct  702  WK  703



>ref|XP_011027726.1| PREDICTED: uncharacterized protein LOC105127946 isoform X2 [Populus 
euphratica]
Length=507

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 135/243 (56%), Gaps = 5/243 (2%)
 Frame = -3

Query  888  INLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQT  709
            + L  +  V K+M +FD S +  I  +EF+ G+ KWLDE     N     +        +
Sbjct  270  VGLIGDHCVSKVMAEFDFSGDHGISKEEFIRGISKWLDEANGVENNGNQTELFNSNLPGS  329

Query  708  RREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATS  529
            R E  +  A  Q+ +  +     +W   KA  F+LLGTAIA   A PL   +   +TA  
Sbjct  330  REEQQIWEAEQQDSKNSD-----EWNYSKATYFILLGTAIAVLLAKPLTKTLQELATAIK  384

Query  528  IPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLAL  349
            +P+F +S+  +P A N  +   +II  S KK +S SLT S++Y  V MNNVL L+ FL +
Sbjct  385  VPSFLVSYFLVPFALNFRQGYKSIISVSDKKEKSVSLTLSQIYCGVFMNNVLGLTSFLTI  444

Query  348  VYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVF  169
            VY R + WD ++E+LV+L++C  +G+  S  S FP WT  +A++LYP+S+  +YVL    
Sbjct  445  VYIREVEWDITAEILVVLVICSGIGLSSSFSSKFPFWTCLVAYALYPISLGFLYVLTISL  504

Query  168  GWS  160
            GW 
Sbjct  505  GWG  507



>ref|XP_005839482.1| hypothetical protein GUITHDRAFT_159252 [Guillardia theta CCMP2712]
 gb|EKX52502.1| hypothetical protein GUITHDRAFT_159252 [Guillardia theta CCMP2712]
Length=503

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/257 (37%), Positives = 147/257 (57%), Gaps = 19/257 (7%)
 Frame = -3

Query  891  EINLDENDA-VDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHE  715
            + ++ E D  ++ LM++ D   + +I  DE   G+ +WL +++  R      K     H 
Sbjct  253  QTSIGEIDGDLEYLMQELDADGDGQITFDEMRGGLRRWLRDLEKER------KSQGGLHG  306

Query  714  QTRREHYLLGAGDQNEEADEGVE-------NPKWTSIKAVLFLLLGTAIAAAFADPLVDA  556
                   L+   DQ E  +   E        P+   + +   ++ GT + A F+DP+VDA
Sbjct  307  SIESTPLLVAGADQEEAEESDDEEEGEEALTPRQIYMNSAKLMIGGTFLVALFSDPMVDA  366

Query  555  VDNFST-----ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAV  391
            V +         + IP FF+SF+  P A+N+SE VS++ FA +KK ++ SLT+S++YGAV
Sbjct  367  VSSVRGRVEEETSHIPAFFVSFLVTPFASNASELVSSLQFAKKKKKKNISLTYSQVYGAV  426

Query  390  TMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLY  211
            TMNN +CL +FL +V+ R L W+FSSEV+  + +   +GV    R TFPL+ +F + SLY
Sbjct  427  TMNNTMCLGLFLLVVWYRNLDWNFSSEVVTTMSMIFALGVVACTRVTFPLYMAFFSLSLY  486

Query  210  PLSIALVYVLDYVFGWS  160
            P+++ALVY LDYV GW 
Sbjct  487  PIALALVYFLDYVVGWQ  503



>ref|XP_011027724.1| PREDICTED: uncharacterized protein LOC105127946 isoform X1 [Populus 
euphratica]
 ref|XP_011027725.1| PREDICTED: uncharacterized protein LOC105127946 isoform X1 [Populus 
euphratica]
Length=554

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 135/243 (56%), Gaps = 5/243 (2%)
 Frame = -3

Query  888  INLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQT  709
            + L  +  V K+M +FD S +  I  +EF+ G+ KWLDE     N     +        +
Sbjct  317  VGLIGDHCVSKVMAEFDFSGDHGISKEEFIRGISKWLDEANGVENNGNQTELFNSNLPGS  376

Query  708  RREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATS  529
            R E  +  A  Q+ +  +     +W   KA  F+LLGTAIA   A PL   +   +TA  
Sbjct  377  REEQQIWEAEQQDSKNSD-----EWNYSKATYFILLGTAIAVLLAKPLTKTLQELATAIK  431

Query  528  IPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLAL  349
            +P+F +S+  +P A N  +   +II  S KK +S SLT S++Y  V MNNVL L+ FL +
Sbjct  432  VPSFLVSYFLVPFALNFRQGYKSIISVSDKKEKSVSLTLSQIYCGVFMNNVLGLTSFLTI  491

Query  348  VYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVF  169
            VY R + WD ++E+LV+L++C  +G+  S  S FP WT  +A++LYP+S+  +YVL    
Sbjct  492  VYIREVEWDITAEILVVLVICSGIGLSSSFSSKFPFWTCLVAYALYPISLGFLYVLTISL  551

Query  168  GWS  160
            GW 
Sbjct  552  GWG  554



>ref|XP_011460597.1| PREDICTED: uncharacterized protein LOC101307679 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/249 (36%), Positives = 140/249 (56%), Gaps = 18/249 (7%)
 Frame = -3

Query  876  ENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVP----------VTLKHLE  727
            E D ++K MK+FD S +  I   EFV G+ KW++    +              ++ K  E
Sbjct  175  EIDYLEKAMKNFDKSGDSRISEKEFVDGISKWVNATPSANGQGQGQAQGQRRFLSSKSKE  234

Query  726  DFHEQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
               EQ ++    +    +N+  D+   N     +KA  FL++G  I    A PL++ + +
Sbjct  235  ALDEQQKQ----VPKKMKNKHMDKTWRN----QLKAACFLIIGIGIMILLATPLMETIQD  286

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FSTA SIP+F  S++ +P A N  +A+  +  A  K   + SLT SE+Y  V MNN++ L
Sbjct  287  FSTAASIPSFLSSYVLIPFAINIGQALQLVTSAQHKTENAISLTLSEIYNGVFMNNIMGL  346

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            ++FLALVY R L+WD  +  L +LI+C VMGV+ S  + FP WT  +A+ +YP+S+ ++Y
Sbjct  347  TIFLALVYIRNLSWDVGAASLAVLIICSVMGVYTSFSTKFPFWTCILAYIMYPISLLMIY  406

Query  186  VLDYVFGWS  160
            VL   FGW+
Sbjct  407  VLTSYFGWT  415



>gb|KHN36865.1| hypothetical protein glysoja_001596 [Glycine soja]
Length=640

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 140/244 (57%), Gaps = 19/244 (8%)
 Frame = -3

Query  882  LDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLD----EVQVSRNVPVTLKHLEDFHE  715
            ++  +AV KL++D D + + EI   EFV G  KW+D    +   S++    +    +  E
Sbjct  411  VETEEAVTKLVQDLDLNRDNEISETEFVEGFTKWMDSNSSQAANSKSSSHEIHQTWEDVE  470

Query  714  QTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTA  535
            +   E+   GA               W  + A+ +++LG  I A  A+PL+ +V  FS  
Sbjct  471  KVMEENQTKGAS-------------AW--LTAIAYVVLGVTILALLAEPLIASVQKFSEE  515

Query  534  TSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFL  355
              I +FFISFI +PLATN  EA SAI  AS KK  + S T  E+YGAV MNN+L   V  
Sbjct  516  AGISSFFISFILVPLATNFREATSAIKEASHKKSSNTSQTMYEIYGAVFMNNILGFVVIS  575

Query  354  ALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDY  175
             L+Y R +TW+FS++VLV+ IVC VMG+  S R TFPLWTSF A+ +Y +++ LV+VL  
Sbjct  576  ILIYMREITWEFSADVLVVAIVCAVMGLTASFRPTFPLWTSFPAYLMYLIALLLVFVLKD  635

Query  174  VFGW  163
            V  +
Sbjct  636  VLNY  639



>gb|KCW74041.1| hypothetical protein EUGRSUZ_E02665 [Eucalyptus grandis]
Length=472

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/256 (35%), Positives = 138/256 (54%), Gaps = 13/256 (5%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLED  724
            ++E  L  +D  D +MK FD S +  I   EFV G+ KWLDE     +  + V     E 
Sbjct  220  IEEAGLSTDDFTDAVMKKFDVSLDAAISESEFVQGISKWLDEDTDPTTNGLAVQSSSSES  279

Query  723  FHEQTRREHYLLGAGDQNEE--ADEGVENPK------WTSIKAVLFLLLGTAIAAAFADP  568
                + +     G  D+ E   + +    P       W   KA   ++LGT +      P
Sbjct  280  SKTTSNKSQ---GTPDEQESLLSQDKTSKPTSKLAIWWNYTKAGFLIILGTGVMILIGQP  336

Query  567  LVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVT  388
            L++++  F+TA  IP+FF+S++ +P A +  + + AI  A +K  +  S   +E+Y  V 
Sbjct  337  LMESLQEFATAADIPSFFVSYVLIPWAMSYRQILGAISSAKKKTKKDISGALTEVYNGVF  396

Query  387  MNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYP  208
            MNNV+ L+ FLA+VY + +TWD S+EVLV+L++C  MGV  S  + F  W   +A++LYP
Sbjct  397  MNNVMGLATFLAIVYIKDITWDVSAEVLVVLLICTFMGVITSSCTKFQFWMGILAYALYP  456

Query  207  LSIALVYVLDYVFGWS  160
            LS+  +Y+L  V GWS
Sbjct  457  LSLLFLYILTSVLGWS  472



>ref|XP_011096404.1| PREDICTED: uncharacterized protein LOC105175608 [Sesamum indicum]
Length=707

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 133/237 (56%), Gaps = 16/237 (7%)
 Frame = -3

Query  870  DAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTRREHYL  691
            D V +L KDFD +NN  ID  EF  GV KWL+            + +++F +   ++   
Sbjct  487  DIVKELFKDFDVNNNTTIDPKEFEDGVTKWLNRAMDVAKTTDKRRIIDEFDKIVWKQP--  544

Query  690  LGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPTFFI  511
                          E   W  I +V  +L+G  +      PL+ ++   S A  + +F I
Sbjct  545  --------------EYRMWDFIMSVFQVLVGILMLTFLGGPLMTSILQLSYAMRLSSFSI  590

Query  510  SFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYARGL  331
            SF+ +PLA N+  A++A++ A +K  RSASLTFSE+YG V MNN+  L+  LA+V+A+ L
Sbjct  591  SFVIVPLAMNARTAITALLPAKQKNERSASLTFSEIYGGVIMNNIAGLTTLLAIVFAKEL  650

Query  330  TWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGWS  160
            TWDFS+EVL IL+VC ++G+     +T+PLWT  +AF LYP S+ + Y +     W+
Sbjct  651  TWDFSAEVLTILVVCAIIGILAYSCNTYPLWTCILAFFLYPFSLGMYYFVQVFLSWN  707



>ref|XP_010058975.1| PREDICTED: uncharacterized protein LOC104446873 [Eucalyptus grandis]
Length=507

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/256 (35%), Positives = 138/256 (54%), Gaps = 13/256 (5%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQ--VSRNVPVTLKHLED  724
            ++E  L  +D  D +MK FD S +  I   EFV G+ KWLDE     +  + V     E 
Sbjct  255  IEEAGLSTDDFTDAVMKKFDVSLDAAISESEFVQGISKWLDEDTDPTTNGLAVQSSSSES  314

Query  723  FHEQTRREHYLLGAGDQNEE--ADEGVENPK------WTSIKAVLFLLLGTAIAAAFADP  568
                + +     G  D+ E   + +    P       W   KA   ++LGT +      P
Sbjct  315  SKTTSNKSQ---GTPDEQESLLSQDKTSKPTSKLAIWWNYTKAGFLIILGTGVMILIGQP  371

Query  567  LVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVT  388
            L++++  F+TA  IP+FF+S++ +P A +  + + AI  A +K  +  S   +E+Y  V 
Sbjct  372  LMESLQEFATAADIPSFFVSYVLIPWAMSYRQILGAISSAKKKTKKDISGALTEVYNGVF  431

Query  387  MNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYP  208
            MNNV+ L+ FLA+VY + +TWD S+EVLV+L++C  MGV  S  + F  W   +A++LYP
Sbjct  432  MNNVMGLATFLAIVYIKDITWDVSAEVLVVLLICTFMGVITSSCTKFQFWMGILAYALYP  491

Query  207  LSIALVYVLDYVFGWS  160
            LS+  +Y+L  V GWS
Sbjct  492  LSLLFLYILTSVLGWS  507



>gb|KCW67430.1| hypothetical protein EUGRSUZ_F01186 [Eucalyptus grandis]
Length=649

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 162/246 (66%), Gaps = 18/246 (7%)
 Frame = -3

Query  879  DENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTRRE  700
            D ++ V K+++ FD S + +I+ +EF+AG+      V +      +   L+DF+++T  E
Sbjct  416  DIDEVVLKVIEVFDRSGDGQINEEEFIAGL------VGIKNQASKSNTSLDDFYQETWEE  469

Query  699  HYLLGAGDQ--NEEADEGVENPKWTS-IKAVLFLLLGTAIAAAFADPLVDAVDNFSTATS  529
                   D+  +EE  +G E   W   ++++L LLLG  I+A  ADPL+ +V +FS A  
Sbjct  470  T------DKVVDEENGKGHEEKSWQIWVESLLSLLLGVFISAVLADPLISSVQSFSKAAG  523

Query  528  IPTFFISFIALPLATNSSEA---VSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVF  358
            +P+FFISFI +PLATN+  A   + AI  A  KK R+ SLTFS++YG V M+NVL  SV 
Sbjct  524  VPSFFISFILVPLATNARGARGAIKAIKGARNKKARTTSLTFSKIYGEVFMSNVLSFSVL  583

Query  357  LALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLD  178
            L L+YAR LTW+FS+EVLV+LIVC V+G+  S RSTFP+WTS +A+ LYPLS+ LVYVLD
Sbjct  584  LLLIYARNLTWEFSAEVLVVLIVCGVVGLTASFRSTFPVWTSILAYLLYPLSLLLVYVLD  643

Query  177  YVFGWS  160
             V  +S
Sbjct  644  DVLNYS  649



>ref|XP_004361492.1| hypothetical protein DFA_05775 [Dictyostelium fasciculatum]
 gb|EGG23641.1| hypothetical protein DFA_05775 [Dictyostelium fasciculatum]
Length=582

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 113/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  663  ADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPTFFISFIALPLAT  484
            A E V N K T I   + L +G+ + + F+DP+VD + +F T   I  FFISFI  P  +
Sbjct  415  ASEEVHNKKKTIIHGSILLAIGSVMVSVFSDPMVDVITDFGTKLDINLFFISFIVTPFCS  474

Query  483  NSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVL  304
            N+SE +S++IFAS+K+ +++SLT+S LYG+ TMNN LCL +F ALVY R LTW+FS+E +
Sbjct  475  NASELISSLIFASKKRKQNSSLTYSALYGSATMNNTLCLGIFFALVYFRDLTWEFSAETV  534

Query  303  VILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGW  163
             IL V + +G+ GS++ T  L+ + +  SLYP S+ +VY+L+    W
Sbjct  535  TILFVTVCVGLIGSLKKTMKLYLAPLVLSLYPFSLVIVYLLETFAHW  581



>ref|XP_007149414.1| hypothetical protein PHAVU_005G068300g [Phaseolus vulgaris]
 gb|ESW21408.1| hypothetical protein PHAVU_005G068300g [Phaseolus vulgaris]
Length=702

 Score =   160 bits (404),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 134/240 (56%), Gaps = 11/240 (5%)
 Frame = -3

Query  882  LDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTRR  703
            +D  +AV KL +D D + + EI   EF+ G+ KW++    S     +    +  H+    
Sbjct  473  VDAEEAVTKLAQDLDLNGDDEISKTEFIEGLTKWMN--SDSSRAANSKSSSQGIHKTWE-  529

Query  702  EHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIP  523
                    D  +  +E   N     + A+ +++LG  + A  A+PL+ +V  FS    I 
Sbjct  530  --------DVEKVMEENQTNGTSAWLTAIGYVVLGVTMLALLAEPLIASVQKFSEEAGIS  581

Query  522  TFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVY  343
            +FFISFI +PLATN  EA SAI  A  KK  + S T  E+YGAV MNN+L   V   L+Y
Sbjct  582  SFFISFILVPLATNFREATSAIKEAGHKKRSNTSQTIYEIYGAVFMNNILGFVVISILIY  641

Query  342  ARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGW  163
             R ++W FS++VLV+ IVC VMG+    R TFPLWTSF A+ +Y +++ LV+VL  V  +
Sbjct  642  VREISWQFSADVLVVAIVCAVMGLTARFRPTFPLWTSFAAYFMYLIALLLVFVLKDVLNY  701



>ref|XP_011096402.1| PREDICTED: uncharacterized protein LOC105175605 isoform X2 [Sesamum 
indicum]
Length=562

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/238 (36%), Positives = 139/238 (58%), Gaps = 5/238 (2%)
 Frame = -3

Query  864  VDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTR---REHY  694
            V+ +++ FDTS +  I  DEF+ G+   + ++  S   P  +K     + Q     ++  
Sbjct  327  VENILESFDTSGDGRISQDEFIKGMTTLVSDI--SDQTPDRIKIGGGSNSQNNSQLQQGL  384

Query  693  LLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPTFF  514
            L  +   +    + V N      +A+ F+++GT +  A  +PL+ +V  FS A ++P+F 
Sbjct  385  LTNSTGTSTSKLQRVSNSWLNYSRALFFVIVGTVMLCALGEPLIKSVVAFSQAANLPSFC  444

Query  513  ISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYARG  334
            +S++A+P A N   A+ +I  A +K  +S SLT S LYG V MNN++ L VFLA VYAR 
Sbjct  445  VSYLAIPFALNYGAAIQSIASARQKTQKSISLTLSALYGGVYMNNIMGLIVFLAPVYARN  504

Query  333  LTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGWS  160
            L  D  +E+LV+LI+CI+M +  S R+TFP W  ++   LYP+S+AL++++  V  WS
Sbjct  505  LQADSFAEILVVLIICILMTLLTSFRTTFPRWLGYLVLLLYPISLALIFLVTSVLNWS  562



>ref|XP_011096401.1| PREDICTED: uncharacterized protein LOC105175605 isoform X1 [Sesamum 
indicum]
Length=563

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/238 (36%), Positives = 139/238 (58%), Gaps = 5/238 (2%)
 Frame = -3

Query  864  VDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTR---REHY  694
            V+ +++ FDTS +  I  DEF+ G+   + ++  S   P  +K     + Q     ++  
Sbjct  328  VENILESFDTSGDGRISQDEFIKGMTTLVSDI--SDQTPDRIKIGGGSNSQNNSQLQQGL  385

Query  693  LLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPTFF  514
            L  +   +    + V N      +A+ F+++GT +  A  +PL+ +V  FS A ++P+F 
Sbjct  386  LTNSTGTSTSKLQRVSNSWLNYSRALFFVIVGTVMLCALGEPLIKSVVAFSQAANLPSFC  445

Query  513  ISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYARG  334
            +S++A+P A N   A+ +I  A +K  +S SLT S LYG V MNN++ L VFLA VYAR 
Sbjct  446  VSYLAIPFALNYGAAIQSIASARQKTQKSISLTLSALYGGVYMNNIMGLIVFLAPVYARN  505

Query  333  LTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGWS  160
            L  D  +E+LV+LI+CI+M +  S R+TFP W  ++   LYP+S+AL++++  V  WS
Sbjct  506  LQADSFAEILVVLIICILMTLLTSFRTTFPRWLGYLVLLLYPISLALIFLVTSVLNWS  563



>ref|XP_009629500.1| PREDICTED: uncharacterized protein LOC104119642 [Nicotiana tomentosiformis]
Length=704

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 147/241 (61%), Gaps = 9/241 (4%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            + E++LD   ++++++KDFD + + +ID +EF+ GV  WL      RN   T + L+D  
Sbjct  468  IREVHLDHQGSIEEIIKDFDQNKDNKIDENEFLDGVKYWL------RNAKRTTEELQDKM  521

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFST  538
                 + +L  A  +  +  +     K    K+VL ++LGTAI    ADPL+D +   + 
Sbjct  522  IWGEVDKFLDEAKREKHKRFDYSLVLKGAFCKSVLQVILGTAILTLCADPLMDNIIRLAN  581

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLT---FSELYGAVTMNNVLCL  367
            A   P+FF+SF+ +PLA N+  A++AI   S    +S++ +   FSE+Y  V +NN++ +
Sbjct  582  AIGTPSFFLSFVIVPLAINARTAITAITLLSSTSQQSSTTSSLTFSEIYVRVILNNIMGM  641

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            S  L ++YA+ LTW++S EVL  ++VC V G+F  +R+T+PLWT  IAF LYP+S+ L+Y
Sbjct  642  STVLFVLYAKDLTWEYSVEVLTSMVVCAVTGLFAFVRTTYPLWTCIIAFLLYPISLVLLY  701

Query  186  V  184
            +
Sbjct  702  L  702



>ref|XP_009794964.1| PREDICTED: uncharacterized protein LOC104241728 [Nicotiana sylvestris]
Length=510

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 147/241 (61%), Gaps = 9/241 (4%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            + E +LD   ++++++KDFD + + +ID +EF+ GV  WL      RN   + + L+D  
Sbjct  274  IREAHLDHQGSIEEIIKDFDQNKDNKIDENEFLDGVKYWL------RNAKRSTEELQDKM  327

Query  717  EQTRREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFST  538
                 + +L  A  +  +  +     K    K+VL ++LGTAI    ADPL+D +   + 
Sbjct  328  IWGEVDKFLDEAKREKHKRFDYSLVLKGAFCKSVLQVILGTAILTLCADPLMDNIIRLAN  387

Query  537  ATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLT---FSELYGAVTMNNVLCL  367
            A  +P+FF+SFI +PLA N+  A++AI   S    +S++ +   FSE+Y  V +NN++ +
Sbjct  388  AIGMPSFFLSFIIVPLAINARTAITAISLLSSTSQQSSTTSSLTFSEIYVRVILNNIMGM  447

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVY  187
            S  L ++YA+ LTW++S EVL  ++VC V G+F  +R+T+PLWT  IAF LYP+S+ L+Y
Sbjct  448  STVLFVLYAKDLTWEYSVEVLTSMVVCAVTGLFAFVRTTYPLWTCIIAFLLYPISLVLLY  507

Query  186  V  184
            +
Sbjct  508  L  508



>ref|XP_008371442.1| PREDICTED: uncharacterized protein LOC103434855 [Malus domestica]
Length=564

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/263 (40%), Positives = 154/263 (59%), Gaps = 31/263 (12%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            ++E  LD++D V ++MK FD S + +I   EFV G+ KW+D V  S N           H
Sbjct  316  IEEFGLDDDDYVAEVMKQFDISGDAQIAETEFVNGISKWIDPVMPSAN--------SKGH  367

Query  717  EQT---RREHYLLGAGDQNEEADEGVENP-------------KWTSI-KAVLFLLLGTAI  589
            E     RR +       +NE+  E  + P              W ++ KAV  ++LGTA+
Sbjct  368  EHKSLFRRNN------SKNEKTMEDQQTPLISKKKKTKGADKSWMNLLKAVFLIILGTAM  421

Query  588  AAAFADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFS  409
                + PL+ ++  FSTA SIP+F +S++ +PL+TN   A++++  A  +   + SLT S
Sbjct  422  TVFLSMPLMVSLQEFSTAASIPSFVVSYVVIPLSTNYRLALTSVTSARDRTENAISLTLS  481

Query  408  ELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSF  229
            E+Y AV MNN+L L +FLALVY R L+WD S+EVLV+L++   +G+  S    FP WTS 
Sbjct  482  EIYNAVFMNNILGLVIFLALVYIRNLSWDVSAEVLVVLLISTAVGLSASFSRKFPFWTSI  541

Query  228  IAFSLYPLSIALVYVLDYVFGWS  160
            +A++LYPLS+ L+YVL  V GWS
Sbjct  542  LAYTLYPLSLLLLYVLVAVIGWS  564



>ref|XP_002305761.1| hypothetical protein POPTR_0004s05210g [Populus trichocarpa]
 gb|EEE86272.1| hypothetical protein POPTR_0004s05210g [Populus trichocarpa]
Length=560

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/254 (36%), Positives = 137/254 (54%), Gaps = 21/254 (8%)
 Frame = -3

Query  888  INLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQT  709
            + L  +  V K+M +FD S +  I  +EF+ G+ KWLDE             +E+   QT
Sbjct  317  VGLIGDHCVSKVMAEFDFSGDHGISKEEFIGGISKWLDEA----------NGVENNGNQT  366

Query  708  RR-EHYLLGAGDQNE----EADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNF  544
                  L G G++ +    E  +   + +W   KA  F+LLGTAIA   A PL   +   
Sbjct  367  ELFNSNLPGTGEKQQIWEAEQQDSKNSDEWNYSKATYFILLGTAIAVLLAKPLTKTLQEL  426

Query  543  STATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSE------LYGAVTMN  382
            +TA  +P+F +S+  +P A N  +   +I   S KK +S SLT S+      +Y  V MN
Sbjct  427  ATAIKVPSFLVSYFLVPFALNFRQGYKSITSVSDKKEKSVSLTLSQGKVFVQIYCGVFMN  486

Query  381  NVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLS  202
            NVL L+ FL +VY R + WD ++E+LV+L++C  +G+  S  S FP WT  +A++LYP+S
Sbjct  487  NVLGLTSFLTIVYIRDVEWDITAEILVVLVICSGIGLSSSFSSKFPFWTCLVAYALYPIS  546

Query  201  IALVYVLDYVFGWS  160
            +  +YVL    GW 
Sbjct  547  LGFLYVLTISLGWG  560



>ref|XP_010058973.1| PREDICTED: uncharacterized protein LOC104446871 [Eucalyptus grandis]
Length=542

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 141/251 (56%), Gaps = 14/251 (6%)
 Frame = -3

Query  885  NLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTR  706
            ++  +D    +M   D S++  +   EFV G+ KWL++  ++ N      H +D  +   
Sbjct  297  DVSTDDYAVAMMTKLDDSHDASLSEMEFVQGITKWLNQGTLASN-----SHAQDLAKSRS  351

Query  705  REHYLLGAGDQNEE---ADEGVENPK------WTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            + +   GA ++ E      +    P+      W   KA   ++LGT +      PL+ + 
Sbjct  352  QSNNSTGAIEEQERLLSQQDTTSKPRSALAISWNYAKASFLIVLGTTMMVILGSPLMQSF  411

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
             + ++  ++P+F +S++ LPLA +  +A+ AI  A +K L+  S   SE+Y  V +NN++
Sbjct  412  QDVASDLNMPSFLVSYVMLPLAMSYKQALGAITSARKKTLKDISGPMSEVYRGVFLNNLM  471

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
             L  FL L+  + ++W+ S+EVLV+L++C  MGV  S+R+ FPLWT+ +A+SLYP SI L
Sbjct  472  GLVTFLLLLLIKDISWNVSAEVLVVLLICSFMGVLTSLRTQFPLWTAVLAYSLYPFSILL  531

Query  192  VYVLDYVFGWS  160
            +YVL  V GWS
Sbjct  532  LYVLTSVLGWS  542



>gb|KCW74040.1| hypothetical protein EUGRSUZ_E02663 [Eucalyptus grandis]
Length=567

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 141/251 (56%), Gaps = 14/251 (6%)
 Frame = -3

Query  885  NLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTR  706
            ++  +D    +M   D S++  +   EFV G+ KWL++  ++ N      H +D  +   
Sbjct  322  DVSTDDYAVAMMTKLDDSHDASLSEMEFVQGITKWLNQGTLASN-----SHAQDLAKSRS  376

Query  705  REHYLLGAGDQNEE---ADEGVENPK------WTSIKAVLFLLLGTAIAAAFADPLVDAV  553
            + +   GA ++ E      +    P+      W   KA   ++LGT +      PL+ + 
Sbjct  377  QSNNSTGAIEEQERLLSQQDTTSKPRSALAISWNYAKASFLIVLGTTMMVILGSPLMQSF  436

Query  552  DNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVL  373
             + ++  ++P+F +S++ LPLA +  +A+ AI  A +K L+  S   SE+Y  V +NN++
Sbjct  437  QDVASDLNMPSFLVSYVMLPLAMSYKQALGAITSARKKTLKDISGPMSEVYRGVFLNNLM  496

Query  372  CLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIAL  193
             L  FL L+  + ++W+ S+EVLV+L++C  MGV  S+R+ FPLWT+ +A+SLYP SI L
Sbjct  497  GLVTFLLLLLIKDISWNVSAEVLVVLLICSFMGVLTSLRTQFPLWTAVLAYSLYPFSILL  556

Query  192  VYVLDYVFGWS  160
            +YVL  V GWS
Sbjct  557  LYVLTSVLGWS  567



>gb|KHN28092.1| hypothetical protein glysoja_007824 [Glycine soja]
Length=640

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 128/226 (57%), Gaps = 15/226 (7%)
 Frame = -3

Query  882  LDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTRR  703
            ++  +AV KL++D D + + EI   EFV G  KW++      N           HE  R 
Sbjct  411  VETEEAVTKLVQDLDLNRDDEISETEFVEGFTKWMNS-----NSSQAANSKSSSHEIRRT  465

Query  702  EHYLLGAGDQNEEADEGVENPKWTS--IKAVLFLLLGTAIAAAFADPLVDAVDNFSTATS  529
               +    ++N+         K TS  + A+ +++LG  I A  A+PL+ +V  FS    
Sbjct  466  WEDVEKVIEENQ--------TKGTSAWLTAIGYVVLGVTILALLAEPLIASVQKFSEEAG  517

Query  528  IPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLAL  349
            I +FFISFI +PLATN  EA SAI  AS KK  + S T  E+YGAV MNN+L   V   L
Sbjct  518  ISSFFISFILVPLATNFREATSAIKEASHKKTSNTSQTMYEIYGAVFMNNILGFVVISIL  577

Query  348  VYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLY  211
            +Y R +TW+FS++VLV+ IVC V G+  S R TFPLWTSF A+ +Y
Sbjct  578  IYMREITWEFSADVLVVAIVCAVTGLTASFRPTFPLWTSFPAYLMY  623



>ref|XP_003540477.1| PREDICTED: uncharacterized protein LOC100800452 [Glycine max]
Length=711

 Score =   155 bits (392),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 93/226 (41%), Positives = 128/226 (57%), Gaps = 15/226 (7%)
 Frame = -3

Query  882  LDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQTRR  703
            ++  +AV KL++D D + + EI   EFV G  KW++      N           HE  R 
Sbjct  482  VETEEAVTKLVQDLDLNRDDEISETEFVEGFTKWMNS-----NSSQAANSKSSSHEIRRT  536

Query  702  EHYLLGAGDQNEEADEGVENPKWTS--IKAVLFLLLGTAIAAAFADPLVDAVDNFSTATS  529
               +    ++N+         K TS  + A+ +++LG  I A  A+PL+ +V  FS    
Sbjct  537  WEDVEKVIEENQ--------TKVTSAWLTAIGYVVLGVTILALLAEPLIASVQKFSEEAG  588

Query  528  IPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLAL  349
            I +FFISFI +PLATN  EA SAI  AS KK  + S T  E+YGAV MNN+L   V   L
Sbjct  589  ISSFFISFILVPLATNFREATSAIKEASHKKTSNTSQTMYEIYGAVFMNNILGFVVISIL  648

Query  348  VYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLY  211
            +Y R +TW+FS++VLV+ IVC V G+  S R TFPLWTSF A+ +Y
Sbjct  649  IYMREITWEFSADVLVVAIVCAVTGLTASFRPTFPLWTSFPAYLMY  694



>gb|EYU44995.1| hypothetical protein MIMGU_mgv1a002795mg [Erythranthe guttata]
Length=637

 Score =   154 bits (390),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 92/243 (38%), Positives = 140/243 (58%), Gaps = 8/243 (3%)
 Frame = -3

Query  888  INLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQT  709
            I  D   A  KLMK  D + +  I+ +EFV G+ K L+     R         + + +  
Sbjct  402  IPYDAELAASKLMKVLDVNEDNVINEEEFVDGLFKLLNTTLDIRGRNSKESEDDTYQKTW  461

Query  708  RREHYLLGAGDQNEEADEGVENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATS  529
             +   LL         ++ ++  K    KA+  LLLG  +    A+PL+ +V NFS +  
Sbjct  462  EQTDKLL--------EEKFIDKSKLAWAKAIGLLLLGLVMLGLLAEPLIQSVRNFSKSAK  513

Query  528  IPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLAL  349
            +P+F+++F+ +PL TN+  AVSA+  A RKKL   SLTFSE+Y  V MNNVL L V L+L
Sbjct  514  VPSFYVAFVLVPLTTNARIAVSAVREARRKKLHLTSLTFSEIYSTVLMNNVLGLIVLLSL  573

Query  348  VYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVF  169
            VY RGL W++S+E+L + IV  ++G+F S+   +P+WTS  A+ +YPLS+ LVY+  + +
Sbjct  574  VYFRGLAWNYSAEILAVTIVSGIVGIFSSLSRIYPVWTSISAYLMYPLSLVLVYIFGHFY  633

Query  168  GWS  160
              S
Sbjct  634  SSS  636



>gb|EYU43358.1| hypothetical protein MIMGU_mgv1a003865mg [Erythranthe guttata]
Length=559

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/252 (37%), Positives = 143/252 (57%), Gaps = 20/252 (8%)
 Frame = -3

Query  888  INLDENDA------VDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEV--QVSRNVPVTLKH  733
            + +D ND       V  +M  FDTS++  I+ DEF  G+ K + ++  Q S  +  T   
Sbjct  319  VKMDINDDKSTERDVGMIMASFDTSSDGVINQDEFTNGMTKLVSDLSNQTSSQITTT---  375

Query  732  LEDFHEQTRREHYLLGAGDQNEEADEGVENPKWTS-IKAVLFLLLGTAIAAAFADPLVDA  556
                +  T  +  +  +   ++ A        W++ ++A  F++ G  I  AF++PL+ +
Sbjct  376  ----NGTTNSQGLISTSTSTSQTAPTN----SWSNYLRAGFFVIFGILILCAFSEPLIRS  427

Query  555  VDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNV  376
            V +FS A +  TF +S++A+P A N   A+ +I  A +K   S SLT S LY  V MNN+
Sbjct  428  VVDFSIAANFSTFSVSYLAIPFAMNYGVAIQSIASARQKTQISISLTLSSLYAGVYMNNI  487

Query  375  LCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIAFSLYPLSIA  196
            + L VFLA VY R L+ +  +EVL++LI+C VM VF S+ +TFP W  +I  SLYP+S+A
Sbjct  488  IGLIVFLAPVYVRNLSTNVCAEVLLVLIICTVMSVFTSIYTTFPRWIGYILVSLYPISLA  547

Query  195  LVYVLDYVFGWS  160
             VY+L  V GWS
Sbjct  548  TVYILTTVLGWS  559



>ref|XP_002500016.1| Ca2+:Cation antiporter family [Micromonas sp. RCC299]
 gb|ACO61274.1| Ca2+:Cation antiporter family [Micromonas sp. RCC299]
Length=554

 Score =   152 bits (383),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 150/263 (57%), Gaps = 35/263 (13%)
 Frame = -3

Query  852  MKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLE---DFHEQTRRE------  700
            +K+FD   +  I   EF AG+  W+  ++ ++N+ V  +           +R E      
Sbjct  295  LKEFDKDGDGLISRAEFCAGMTHWV--LEQAKNISVRSRRSSFDGSLRGGSRHELSAARG  352

Query  699  ------HYLLGAGDQNEEADEG-------------VENPKWTS---IKAVLFLLLGTAIA  586
                    LLG+  + ++A EG              E P   S    KA+LFL +G A+ 
Sbjct  353  PAHAGLEPLLGSTPE-QDAGEGQGEEDESDVEDEDDEEPMTKSQIIKKAMLFLAIGMAMV  411

Query  585  AAFADPLVDAVDNFSTATSIPT-FFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFS  409
              FADP+V AV + S A  +P+ FF SF+  P A+N+SE VS++ FAS+K+ ++ SLT+S
Sbjct  412  TLFADPMVGAVSSLSKALGLPSPFFASFVLTPFASNASELVSSLYFASKKRKKNISLTYS  471

Query  408  ELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSF  229
            ++YGAVTMNN +CL +F+ ++ A+GL W FSSE L IL+V +++G  G+ R TF    + 
Sbjct  472  QVYGAVTMNNTMCLGLFMVVMRAQGLEWTFSSETLTILLVTLLVGYLGASRETFKSRLAV  531

Query  228  IAFSLYPLSIALVYVLDYVFGWS  160
               +LYPLSIALV  LD+V GW+
Sbjct  532  PVLALYPLSIALVCFLDFVVGWN  554



>ref|XP_005650712.1| hypothetical protein COCSUDRAFT_61158 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26168.1| hypothetical protein COCSUDRAFT_61158 [Coccomyxa subellipsoidea 
C-169]
Length=555

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 98/265 (37%), Positives = 142/265 (54%), Gaps = 36/265 (14%)
 Frame = -3

Query  864  VDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLK-------HLE-------  727
            VD  M++FD   +  I  +EF   + +W+ E Q      V L+       HLE       
Sbjct  286  VDFWMREFDADRSGCITYEEFRKQLSRWIAEKQKQHEEDVRLRRSGKKLDHLESRRSEVS  345

Query  726  -DFHEQTRREHY----------------LLGAGDQNEEADEGVENPKWTSI--KAVLFLL  604
             D      R H+                     D  +  D   E P   +I  KA + LL
Sbjct  346  IDLDPLLSRHHFTEDEEAAEAADEDADEDGSDDDNGDAGDGAKEPPTPRAIISKAAVKLL  405

Query  603  LGTAIAAAFADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSA  424
            +GTA  A F+DP+V+AV  FS A+ IP F+++F   P A+N+SE VS+IIFASRK+ ++ 
Sbjct  406  IGTAACALFSDPMVEAVSGFSKASGIPAFYVAFCVTPFASNASELVSSIIFASRKQKKNI  465

Query  423  SLTFSE---LYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRS  253
            SLTFS+   +YGAVTMNN +CL +FL +++ + L W +SSEVLV +    ++G+ G   +
Sbjct  466  SLTFSQARPVYGAVTMNNTMCLGLFLLVMHIQRLPWTYSSEVLVTVGATALVGLLGYTHT  525

Query  252  TFPLWTSFIAFSLYPLSIALVYVLD  178
            TF  + +F   +LYPLSI  V+ LD
Sbjct  526  TFRTFWAFPVLALYPLSIIAVWGLD  550



>emb|CBI20222.3| unnamed protein product [Vitis vinifera]
Length=661

 Score =   151 bits (382),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 146/228 (64%), Gaps = 16/228 (7%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            ++ LD ++AV ++M+  D + ++ ID +EF+ G+ KW           V +   +     
Sbjct  424  DMPLDVDEAVARIMEKLDVNGDRLIDEEEFIQGLAKW-----------VNISSHQALQSP  472

Query  711  TRREHYLLGAGDQNEEADEG-----VENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
               +   L A  + +E  E      V+   W   KA++ LL G  I +  A+PL+ +V +
Sbjct  473  KPNDEIFLKAWKETDELVEQTSAGPVDKSPWAWFKAIMLLLAGILILSVLAEPLIHSVQS  532

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FSTA +I +FFI+FI +PLATN+  A SAI  ASR+K R+ SLTFSE+YG V MNNVL +
Sbjct  533  FSTAANISSFFIAFILVPLATNARAATSAISAASRRKERTTSLTFSEIYGGVFMNNVLGI  592

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIA  223
            SV L+++Y R LTWDFS+EVLV++IVC+VMG+F S+RSTFP+WTS +A
Sbjct  593  SVLLSIIYVRELTWDFSAEVLVVMIVCVVMGMFASLRSTFPVWTSIVA  640



>ref|XP_010644148.1| PREDICTED: uncharacterized protein LOC100241883 [Vitis vinifera]
Length=718

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 146/228 (64%), Gaps = 16/228 (7%)
 Frame = -3

Query  891  EINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFHEQ  712
            ++ LD ++AV ++M+  D + ++ ID +EF+ G+ KW           V +   +     
Sbjct  481  DMPLDVDEAVARIMEKLDVNGDRLIDEEEFIQGLAKW-----------VNISSHQALQSP  529

Query  711  TRREHYLLGAGDQNEEADEG-----VENPKWTSIKAVLFLLLGTAIAAAFADPLVDAVDN  547
               +   L A  + +E  E      V+   W   KA++ LL G  I +  A+PL+ +V +
Sbjct  530  KPNDEIFLKAWKETDELVEQTSAGPVDKSPWAWFKAIMLLLAGILILSVLAEPLIHSVQS  589

Query  546  FSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFSELYGAVTMNNVLCL  367
            FSTA +I +FFI+FI +PLATN+  A SAI  ASR+K R+ SLTFSE+YG V MNNVL +
Sbjct  590  FSTAANISSFFIAFILVPLATNARAATSAISAASRRKERTTSLTFSEIYGGVFMNNVLGI  649

Query  366  SVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSFIA  223
            SV L+++Y R LTWDFS+EVLV++IVC+VMG+F S+RSTFP+WTS +A
Sbjct  650  SVLLSIIYVRELTWDFSAEVLVVMIVCVVMGMFASLRSTFPVWTSIVA  697



>ref|XP_009353170.1| PREDICTED: uncharacterized protein LOC103944425 [Pyrus x bretschneideri]
Length=628

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 150/263 (57%), Gaps = 31/263 (12%)
 Frame = -3

Query  897  LDEINLDENDAVDKLMKDFDTSNNQEIDIDEFVAGVDKWLDEVQVSRNVPVTLKHLEDFH  718
            ++E  LD++D V ++MK FD S + +I   +FV G+ KW++ V  S N           H
Sbjct  380  IEEFGLDDDDYVAEVMKQFDISGDAQIAETDFVNGISKWINPVMPSAN--------SKGH  431

Query  717  EQT---RREHYLLGAGDQNEEADEGVENP-------------KWTSI-KAVLFLLLGTAI  589
            E     RR +       +NE+  E  + P              W ++ KAV  + LGTA+
Sbjct  432  EHKSLFRRNN------SKNEKTKEDQQTPLISKKKKTKGADKSWMNLLKAVFLITLGTAM  485

Query  588  AAAFADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSAIIFASRKKLRSASLTFS  409
                + PL+ ++  FSTA SIP+F +S++ +PL+TN   A+ ++  A  +   + SLT S
Sbjct  486  TVFLSMPLMVSLQEFSTAASIPSFAVSYVVIPLSTNYRLALMSVTSARDRTENAISLTLS  545

Query  408  ELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIVMGVFGSMRSTFPLWTSF  229
            E+Y A  MNN+  L VFLALVY R L+WD S+EVLV+L++   +G+  S    FP WTS 
Sbjct  546  EIYNAAFMNNISGLVVFLALVYIRNLSWDVSAEVLVVLLISTAVGLSASFSRKFPFWTSI  605

Query  228  IAFSLYPLSIALVYVLDYVFGWS  160
            +A++LYPLS+ L+YVL  V GWS
Sbjct  606  LAYTLYPLSLLLLYVLVAVIGWS  628



>dbj|GAM24148.1| hypothetical protein SAMD00019534_073230, partial [Acytostelium 
subglobosum LB1]
Length=522

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 106/159 (67%), Gaps = 0/159 (0%)
 Frame = -3

Query  639  KWTSIKAVLFLLLGTAIAAAFADPLVDAVDNFSTATSIPTFFISFIALPLATNSSEAVSA  460
            K  +++A  +L +G+ + + F+DP+V  + +F    +I  FFISFI  P  +N+SE +S+
Sbjct  363  KKIALRATFWLAVGSVMVSVFSDPMVGVITDFGNKLNIKLFFISFIVTPFCSNASELISS  422

Query  459  IIFASRKKLRSASLTFSELYGAVTMNNVLCLSVFLALVYARGLTWDFSSEVLVILIVCIV  280
            +IF+S+KK  + SLT+S LYG+ TMNN +CL +F ALVY R LTW+FS+E + IL V +V
Sbjct  423  LIFSSKKKKTNTSLTYSALYGSATMNNTMCLGIFFALVYFRNLTWEFSAETVTILFVTMV  482

Query  279  MGVFGSMRSTFPLWTSFIAFSLYPLSIALVYVLDYVFGW  163
            +G  G++  T     + +  SLYPLSI LVY+L+    W
Sbjct  483  VGTIGALNKTMRFMLAPLVLSLYPLSILLVYILETFAHW  521



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1995669393600