BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038K07

Length=941
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795130.1|  PREDICTED: coatomer subunit gamma                  438   3e-143   Nicotiana sylvestris
ref|XP_009605957.1|  PREDICTED: coatomer subunit gamma                  437   5e-143   Nicotiana tomentosiformis
ref|XP_007042213.1|  Coatomer gamma-2 subunit / gamma-2 coat prot...    432   3e-141   
gb|KJB79199.1|  hypothetical protein B456_013G037600                    432   5e-141   Gossypium raimondii
ref|XP_009800885.1|  PREDICTED: coatomer subunit gamma-like             432   6e-141   Nicotiana sylvestris
gb|KHG07840.1|  hypothetical protein F383_13405                         431   9e-141   Gossypium arboreum [tree cotton]
gb|KJB47485.1|  hypothetical protein B456_008G028500                    431   1e-140   Gossypium raimondii
ref|XP_009609407.1|  PREDICTED: coatomer subunit gamma                  431   1e-140   Nicotiana tomentosiformis
ref|XP_006365093.1|  PREDICTED: coatomer subunit gamma-like             426   8e-139   Solanum tuberosum [potatoes]
ref|XP_004230861.1|  PREDICTED: coatomer subunit gamma                  425   2e-138   Solanum lycopersicum
ref|XP_008447037.1|  PREDICTED: coatomer subunit gamma                  421   9e-137   Cucumis melo [Oriental melon]
ref|XP_010263701.1|  PREDICTED: coatomer subunit gamma-2                421   1e-136   Nelumbo nucifera [Indian lotus]
ref|XP_003631645.1|  PREDICTED: coatomer subunit gamma-2                420   3e-136   Vitis vinifera
gb|KDO49097.1|  hypothetical protein CISIN_1g0029002mg                  407   6e-136   Citrus sinensis [apfelsine]
gb|KHG11475.1|  hypothetical protein F383_06298                         419   8e-136   Gossypium arboreum [tree cotton]
gb|KDO49098.1|  hypothetical protein CISIN_1g0029002mg                  408   1e-135   Citrus sinensis [apfelsine]
gb|KDP46244.1|  hypothetical protein JCGZ_10084                         418   2e-135   Jatropha curcas
gb|KJB32493.1|  hypothetical protein B456_005G242900                    417   2e-135   Gossypium raimondii
gb|KJB32494.1|  hypothetical protein B456_005G242900                    417   2e-135   Gossypium raimondii
ref|XP_010254880.1|  PREDICTED: coatomer subunit gamma-2                417   3e-135   Nelumbo nucifera [Indian lotus]
ref|XP_011088383.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     416   5e-135   
ref|XP_002509477.1|  coatomer gamma subunit, putative                   416   6e-135   Ricinus communis
ref|XP_011088382.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     416   1e-134   Sesamum indicum [beniseed]
ref|XP_004150412.1|  PREDICTED: coatomer subunit gamma-like             414   4e-134   Cucumis sativus [cucumbers]
ref|XP_004500815.1|  PREDICTED: coatomer subunit gamma-like             413   1e-133   Cicer arietinum [garbanzo]
ref|XP_011092782.1|  PREDICTED: coatomer subunit gamma-2-like           412   3e-133   Sesamum indicum [beniseed]
gb|EYU37789.1|  hypothetical protein MIMGU_mgv1a001103mg                412   3e-133   Erythranthe guttata [common monkey flower]
ref|XP_006487155.1|  PREDICTED: coatomer subunit gamma-2-like iso...    411   7e-133   Citrus sinensis [apfelsine]
ref|XP_003541056.1|  PREDICTED: coatomer subunit gamma-2-like           411   8e-133   Glycine max [soybeans]
ref|XP_006423248.1|  hypothetical protein CICLE_v10027789mg             411   8e-133   Citrus clementina [clementine]
ref|XP_011464120.1|  PREDICTED: coatomer subunit gamma                  410   2e-132   Fragaria vesca subsp. vesca
ref|XP_007131844.1|  hypothetical protein PHAVU_011G046000g             410   3e-132   Phaseolus vulgaris [French bean]
ref|XP_003603909.1|  Coatomer subunit gamma                             409   3e-132   Medicago truncatula
ref|XP_010096181.1|  Coatomer subunit gamma-2                           408   5e-132   
gb|KHN25367.1|  Coatomer subunit gamma                                  409   7e-132   Glycine soja [wild soybean]
gb|KHN20073.1|  Coatomer subunit gamma                                  408   8e-132   Glycine soja [wild soybean]
ref|XP_004507423.1|  PREDICTED: coatomer subunit gamma-like             407   2e-131   
gb|KHN39778.1|  Coatomer subunit gamma-2                                407   4e-131   Glycine soja [wild soybean]
ref|XP_003537872.1|  PREDICTED: coatomer subunit gamma-2-like           406   4e-131   Glycine max [soybeans]
ref|XP_003527225.1|  PREDICTED: coatomer subunit gamma-like             406   4e-131   Glycine max [soybeans]
ref|XP_010065395.1|  PREDICTED: coatomer subunit gamma                  405   1e-130   Eucalyptus grandis [rose gum]
ref|XP_008783467.1|  PREDICTED: coatomer subunit gamma-2                404   4e-130   Phoenix dactylifera
gb|EYU42621.1|  hypothetical protein MIMGU_mgv1a001108mg                404   6e-130   Erythranthe guttata [common monkey flower]
ref|XP_010028581.1|  PREDICTED: coatomer subunit gamma                  403   8e-130   Eucalyptus grandis [rose gum]
ref|XP_011048664.1|  PREDICTED: coatomer subunit gamma-like isofo...    403   8e-130   Populus euphratica
ref|XP_011048655.1|  PREDICTED: coatomer subunit gamma-like isofo...    403   1e-129   Populus euphratica
ref|XP_003606893.1|  Coatomer subunit gamma                             402   1e-129   Medicago truncatula
ref|XP_008236878.1|  PREDICTED: coatomer subunit gamma                  402   2e-129   Prunus mume [ume]
ref|XP_007200317.1|  hypothetical protein PRUPE_ppa001186mg             402   2e-129   Prunus persica
emb|CDO97061.1|  unnamed protein product                                402   3e-129   Coffea canephora [robusta coffee]
gb|KHN33760.1|  Coatomer subunit gamma                                  402   3e-129   Glycine soja [wild soybean]
ref|XP_003522954.1|  PREDICTED: coatomer subunit gamma-like             401   4e-129   Glycine max [soybeans]
gb|EPS63349.1|  coatomer subunit gamma                                  401   4e-129   Genlisea aurea
ref|XP_011037539.1|  PREDICTED: coatomer subunit gamma                  400   7e-129   Populus euphratica
ref|XP_007136172.1|  hypothetical protein PHAVU_009G024100g             399   2e-128   Phaseolus vulgaris [French bean]
ref|XP_002305424.1|  hypothetical protein POPTR_0004s16090g             399   4e-128   Populus trichocarpa [western balsam poplar]
ref|XP_002313799.1|  hypothetical protein POPTR_0009s11800g             399   4e-128   Populus trichocarpa [western balsam poplar]
ref|XP_010942029.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     398   7e-128   Elaeis guineensis
ref|XP_010942028.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     398   8e-128   Elaeis guineensis
ref|XP_009412267.1|  PREDICTED: coatomer subunit gamma-2                397   1e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010690898.1|  PREDICTED: coatomer subunit gamma                  397   2e-127   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008787310.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    394   2e-126   Phoenix dactylifera
ref|XP_006658376.1|  PREDICTED: coatomer subunit gamma-2-like           393   5e-126   Oryza brachyantha
ref|XP_004148851.1|  PREDICTED: coatomer subunit gamma-like             393   8e-126   Cucumis sativus [cucumbers]
ref|XP_010942771.1|  PREDICTED: coatomer subunit gamma-2-like           392   1e-125   Elaeis guineensis
ref|XP_009345731.1|  PREDICTED: coatomer subunit gamma-like             392   2e-125   Pyrus x bretschneideri [bai li]
ref|XP_009374177.1|  PREDICTED: coatomer subunit gamma                  391   3e-125   Pyrus x bretschneideri [bai li]
ref|XP_002459514.1|  hypothetical protein SORBIDRAFT_02g005920          390   6e-125   Sorghum bicolor [broomcorn]
ref|NP_001132662.1|  uncharacterized protein LOC100194138               390   1e-124   Zea mays [maize]
gb|AAN60990.1|  Putative Nonclathrin coat protein gamma - like pr...    387   2e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008650919.1|  PREDICTED: uncharacterized protein LOC100193...    389   3e-124   Zea mays [maize]
sp|Q8H852.2|COPG1_ORYSJ  RecName: Full=Coatomer subunit gamma-1; ...    389   3e-124   Oryza sativa Japonica Group [Japonica rice]
gb|ACL54542.1|  unknown                                                 389   3e-124   Zea mays [maize]
gb|EEC74799.1|  hypothetical protein OsI_10600                          389   4e-124   Oryza sativa Indica Group [Indian rice]
ref|XP_008375923.1|  PREDICTED: coatomer subunit gamma                  388   4e-124   Malus domestica [apple tree]
gb|EEE58633.1|  hypothetical protein OsJ_09998                          389   5e-124   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049443.1|  Os03g0227000                                       388   5e-124   
ref|XP_008457930.1|  PREDICTED: coatomer subunit gamma-like             386   2e-123   Cucumis melo [Oriental melon]
dbj|BAJ96771.1|  predicted protein                                      385   5e-123   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ99125.1|  predicted protein                                      385   9e-123   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004955766.1|  PREDICTED: coatomer subunit gamma-2-like           384   1e-122   Setaria italica
gb|EMS53044.1|  Coatomer subunit gamma-1                                384   1e-122   Triticum urartu
gb|EMS56973.1|  Coatomer subunit gamma-2                                384   3e-122   Triticum urartu
gb|EEC81692.1|  hypothetical protein OsI_25286                          383   4e-122   Oryza sativa Indica Group [Indian rice]
ref|NP_001059131.1|  Os07g0201100                                       383   4e-122   
ref|XP_009112399.1|  PREDICTED: coatomer subunit gamma                  381   2e-121   Brassica rapa
emb|CDX75435.1|  BnaA01g02670D                                          381   2e-121   
dbj|BAE98672.1|  Nonclathrin coat protein gamma - like protein          375   3e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412224.1|  hypothetical protein EUTSA_v10024368mg             381   3e-121   Eutrema salsugineum [saltwater cress]
emb|CDY46248.1|  BnaC03g66090D                                          380   4e-121   Brassica napus [oilseed rape]
dbj|BAK02925.1|  predicted protein                                      380   4e-121   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010526924.1|  PREDICTED: coatomer subunit gamma                  380   5e-121   Tarenaya hassleriana [spider flower]
ref|XP_006283082.1|  hypothetical protein CARUB_v10004095mg             380   7e-121   
ref|XP_009108729.1|  PREDICTED: coatomer subunit gamma-like             380   8e-121   Brassica rapa
ref|XP_002465599.1|  hypothetical protein SORBIDRAFT_01g041860          380   1e-120   Sorghum bicolor [broomcorn]
ref|XP_003557417.1|  PREDICTED: coatomer subunit gamma-2                379   2e-120   Brachypodium distachyon [annual false brome]
ref|XP_006649665.1|  PREDICTED: coatomer subunit gamma-1-like           379   2e-120   Oryza brachyantha
gb|KFK29733.1|  hypothetical protein AALP_AA7G171600                    379   2e-120   Arabis alpina [alpine rockcress]
gb|KFK29732.1|  hypothetical protein AALP_AA7G171600                    378   2e-120   Arabis alpina [alpine rockcress]
ref|XP_009392974.1|  PREDICTED: coatomer subunit gamma-2-like           379   2e-120   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT19755.1|  Coatomer subunit gamma-1                                378   2e-120   
emb|CDX69060.1|  BnaC01g03930D                                          378   3e-120   
ref|NP_195171.2|  coatomer subunit gamma                                376   1e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869144.1|  hypothetical protein ARALYDRAFT_491217             376   2e-119   
ref|XP_006856032.1|  hypothetical protein AMTR_s00059p00069290          375   3e-119   Amborella trichopoda
gb|ACL53471.1|  unknown                                                 368   6e-119   Zea mays [maize]
gb|KFK30073.1|  hypothetical protein AALP_AA7G213200                    374   2e-118   Arabis alpina [alpine rockcress]
ref|NP_001146210.1|  uncharacterized protein LOC100279780               369   1e-116   Zea mays [maize]
ref|XP_004985097.1|  PREDICTED: coatomer subunit gamma-1-like           369   2e-116   Setaria italica
ref|XP_010516946.1|  PREDICTED: coatomer subunit gamma-like             356   3e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006409466.1|  hypothetical protein EUTSA_v10022539mg             367   5e-116   Eutrema salsugineum [saltwater cress]
ref|XP_009121225.1|  PREDICTED: coatomer subunit gamma                  365   2e-115   Brassica rapa
emb|CDX71272.1|  BnaC07g05510D                                          365   5e-115   
ref|XP_010489193.1|  PREDICTED: coatomer subunit gamma-like             358   5e-115   
tpg|DAA44254.1|  TPA: hypothetical protein ZEAMMB73_398050              367   6e-115   
ref|XP_010447078.1|  PREDICTED: coatomer subunit gamma-like             364   6e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010432412.1|  PREDICTED: coatomer subunit gamma-like             364   7e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010437613.1|  PREDICTED: coatomer subunit gamma                  364   8e-115   Camelina sativa [gold-of-pleasure]
ref|XP_006296595.1|  hypothetical protein CARUB_v10012945mg             363   2e-114   Capsella rubella
ref|XP_003558423.1|  PREDICTED: coatomer subunit gamma-1                363   2e-114   Brachypodium distachyon [annual false brome]
gb|EMT05643.1|  Coatomer subunit gamma-2                                368   3e-114   
ref|XP_010467348.1|  PREDICTED: coatomer subunit gamma-like             362   4e-114   Camelina sativa [gold-of-pleasure]
ref|XP_002884158.1|  hypothetical protein ARALYDRAFT_900277             361   1e-113   Arabidopsis lyrata subsp. lyrata
ref|XP_009411250.1|  PREDICTED: coatomer subunit gamma-2-like           361   1e-113   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA18824.1|  Nonclathrin coat protein gamma-like protein            359   2e-113   Arabidopsis thaliana [mouse-ear cress]
gb|KFK41271.1|  hypothetical protein AALP_AA2G108400                    353   2e-111   Arabis alpina [alpine rockcress]
ref|XP_010548052.1|  PREDICTED: coatomer subunit gamma-like             352   3e-110   Tarenaya hassleriana [spider flower]
ref|XP_010530844.1|  PREDICTED: coatomer subunit gamma-like             346   4e-108   Tarenaya hassleriana [spider flower]
ref|XP_006423249.1|  hypothetical protein CICLE_v10027789mg             343   3e-107   
ref|XP_001780339.1|  predicted protein                                  327   9e-101   
ref|XP_001760258.1|  predicted protein                                  325   3e-100   
ref|XP_007036527.1|  Coatomer gamma-2 subunit / gamma-2 coat prot...    310   1e-99    
ref|XP_001754805.1|  predicted protein                                  322   3e-99    
dbj|BAD94079.1|  Nonclathrin coat protein gamma - like protein          301   6e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007042214.1|  Coatomer gamma-2 subunit / gamma-2 coat prot...    318   2e-97    
gb|AAS21023.1|  coatomer protein gamma subunit                          290   3e-93    Hyacinthus orientalis [common hyacinth]
ref|XP_004301551.1|  PREDICTED: coatomer subunit gamma-like             303   9e-92    Fragaria vesca subsp. vesca
ref|XP_001762251.1|  predicted protein                                  273   5e-81    
ref|XP_002946805.1|  hypothetical protein VOLCADRAFT_72994              272   3e-80    Volvox carteri f. nagariensis
ref|XP_002990584.1|  hypothetical protein SELMODRAFT_185391             272   3e-80    Selaginella moellendorffii
ref|XP_002983626.1|  hypothetical protein SELMODRAFT_268757             272   3e-80    Selaginella moellendorffii
ref|XP_001691193.1|  gamma-cop                                          265   2e-77    Chlamydomonas reinhardtii
ref|XP_005651915.1|  Coatomer, gamma subunit                            254   6e-74    Coccomyxa subellipsoidea C-169
ref|XP_005847180.1|  hypothetical protein CHLNCDRAFT_31542              243   2e-69    Chlorella variabilis
ref|XP_003056073.1|  coatomer protein gamma-subunit                     230   5e-65    Micromonas pusilla CCMP1545
ref|XP_007509254.1|  coatomer protein gamma-subunit                     226   1e-63    Bathycoccus prasinos
ref|XP_002507482.1|  coatomer protein gamma-subunit                     220   2e-61    Micromonas commoda
gb|ACF81600.1|  unknown                                                 195   1e-58    Zea mays [maize]
gb|AFB33382.1|  hypothetical protein 2_4723_01                          195   2e-58    Pinus cembra [Arve]
ref|NP_001132286.1|  uncharacterized protein LOC100193726               195   2e-58    
ref|XP_009867475.1|  PREDICTED: coatomer subunit gamma-2-like           185   9e-52    Apaloderma vittatum
ref|XP_010154598.1|  PREDICTED: coatomer subunit gamma-2-like           185   1e-51    Eurypyga helias
ref|XP_010179997.1|  PREDICTED: coatomer subunit gamma-2-like           182   2e-51    Mesitornis unicolor
ref|XP_004341555.1|  coatomer subunit gamma, putative                   192   2e-51    Acanthamoeba castellanii str. Neff
ref|XP_009708582.1|  PREDICTED: coatomer subunit gamma-2                185   2e-51    Cariama cristata
ref|XP_009058878.1|  hypothetical protein LOTGIDRAFT_191967             191   3e-51    Lottia gigantea
ref|XP_008496567.1|  PREDICTED: coatomer subunit gamma-2                183   9e-51    Calypte anna
ref|XP_002600091.1|  hypothetical protein BRAFLDRAFT_265302             187   1e-50    Branchiostoma floridae
ref|XP_001632631.1|  predicted protein                                  189   1e-50    Nematostella vectensis
ref|XP_009095725.1|  PREDICTED: coatomer subunit gamma-2                189   1e-50    
gb|KFP52544.1|  Coatomer subunit gamma-2                                188   1e-50    Cathartes aura
ref|XP_005533148.1|  PREDICTED: coatomer subunit gamma-2                189   2e-50    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005100396.1|  PREDICTED: coatomer subunit gamma-2-like           189   2e-50    
ref|XP_005039038.1|  PREDICTED: coatomer subunit gamma-2                189   2e-50    Ficedula albicollis
ref|XP_005793201.1|  coatomer protein gamma 2 subunit                   189   2e-50    Emiliania huxleyi CCMP1516
gb|AAF05718.1|AF191562_1  coatomer protein gamma2-COP                   183   2e-50    Danio rerio [leopard danio]
ref|XP_005793200.1|  COPG1, gamma subunit of the coatomer               189   3e-50    Emiliania huxleyi CCMP1516
ref|XP_008047553.1|  PREDICTED: coatomer subunit gamma-2                184   5e-50    Carlito syrichta
ref|XP_010196175.1|  PREDICTED: coatomer subunit gamma-2-like           181   5e-50    Colius striatus
ref|XP_009962331.1|  PREDICTED: coatomer subunit gamma-2                187   5e-50    Tyto alba [Schleiereule]
ref|XP_010706784.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     187   5e-50    Meleagris gallopavo [common turkey]
gb|KFV47491.1|  Coatomer subunit gamma-2                                187   6e-50    Tyto alba [Schleiereule]
ref|XP_414981.2|  PREDICTED: coatomer subunit gamma-2 isoform X2        187   6e-50    Gallus gallus [bantam]
ref|XP_005679647.1|  PREDICTED: coatomer subunit gamma-2                187   7e-50    
ref|XP_010281384.1|  PREDICTED: coatomer subunit gamma-2                187   8e-50    Phaethon lepturus
gb|KFQ66228.1|  Coatomer subunit gamma-2                                187   8e-50    Phaethon lepturus
ref|XP_005427027.1|  PREDICTED: coatomer subunit gamma-2                188   8e-50    
ref|XP_008627077.1|  PREDICTED: coatomer subunit gamma-2                187   8e-50    Corvus brachyrhynchos
ref|XP_004008118.1|  PREDICTED: coatomer subunit gamma-2                186   9e-50    
ref|XP_003201845.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     187   9e-50    Meleagris gallopavo [common turkey]
ref|XP_009812764.1|  PREDICTED: coatomer subunit gamma-2                187   9e-50    Gavia stellata
gb|KFV55437.1|  Coatomer subunit gamma-2                                187   1e-49    Gavia stellata
ref|XP_005504385.1|  PREDICTED: coatomer subunit gamma-2                187   1e-49    Columba livia [carrier pigeon]
ref|XP_002187860.1|  PREDICTED: coatomer subunit gamma-2 isoform 1      187   1e-49    Taeniopygia guttata
ref|XP_010408344.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    187   1e-49    
gb|KFV93281.1|  Coatomer subunit gamma-2                                186   2e-49    Fulmarus glacialis
ref|XP_010579362.1|  PREDICTED: coatomer subunit gamma-2 isoform X4     185   2e-49    Haliaeetus leucocephalus
ref|XP_009578347.1|  PREDICTED: coatomer subunit gamma-2                186   2e-49    Fulmarus glacialis
ref|XP_010579360.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     185   2e-49    Haliaeetus leucocephalus
ref|XP_007122862.1|  PREDICTED: coatomer subunit gamma-2-like           182   2e-49    
ref|XP_010802777.1|  PREDICTED: coatomer subunit gamma-2 isoform X3     185   3e-49    
ref|XP_010829969.1|  PREDICTED: coatomer subunit gamma-2 isoform X3     185   3e-49    Bison bison bison
gb|KFW72045.1|  Coatomer subunit gamma-2                                186   3e-49    Pygoscelis adeliae
ref|XP_005435505.1|  PREDICTED: coatomer subunit gamma-2                186   3e-49    Falco cherrug
ref|XP_010802775.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     185   3e-49    Bos taurus [bovine]
gb|KFQ03848.1|  Coatomer subunit gamma-2                                185   3e-49    Haliaeetus albicilla
ref|XP_010579358.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     186   3e-49    Haliaeetus leucocephalus
ref|XP_005235387.1|  PREDICTED: coatomer subunit gamma-2                186   3e-49    Falco peregrinus [peregrine]
ref|XP_009917069.1|  PREDICTED: coatomer subunit gamma-2                185   3e-49    Haliaeetus albicilla
ref|XP_009646680.1|  PREDICTED: coatomer subunit gamma-2                185   4e-49    Egretta garzetta
gb|KFP10731.1|  Coatomer subunit gamma-2                                185   4e-49    Egretta garzetta
gb|EKC27123.1|  Coatomer subunit gamma-2                                185   4e-49    Crassostrea gigas
gb|KFZ69269.1|  Coatomer subunit gamma-2                                184   4e-49    Podiceps cristatus
ref|XP_011439759.1|  PREDICTED: coatomer subunit gamma-2-like           185   4e-49    Crassostrea gigas
ref|NP_001075917.1|  coatomer subunit gamma-2                           185   5e-49    Bos taurus [bovine]
ref|XP_784737.3|  PREDICTED: coatomer subunit gamma-2-like              185   5e-49    Strongylocentrotus purpuratus [purple urchin]
ref|XP_009460872.1|  PREDICTED: coatomer subunit gamma-2                185   6e-49    Nipponia nippon
ref|XP_009478462.1|  PREDICTED: coatomer subunit gamma-2                184   6e-49    Pelecanus crispus
gb|KFQ50320.1|  Coatomer subunit gamma-2                                184   7e-49    Pelecanus crispus
gb|KFP87683.1|  Coatomer subunit gamma-2                                184   7e-49    Acanthisitta chloris
ref|XP_001511377.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     184   8e-49    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_010297179.1|  PREDICTED: coatomer subunit gamma-2                184   9e-49    Balearica regulorum gibbericeps
ref|XP_007669172.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     184   9e-49    Ornithorhynchus anatinus [duck-billed platypus]
gb|KFO04278.1|  Coatomer subunit gamma-2                                184   9e-49    Balearica regulorum gibbericeps
gb|KFM09800.1|  Coatomer subunit gamma-2                                184   9e-49    Aptenodytes forsteri
ref|XP_009935875.1|  PREDICTED: coatomer subunit gamma-2                184   9e-49    Opisthocomus hoazin [hoatzin]
ref|XP_005009582.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    185   9e-49    
ref|XP_010076907.1|  PREDICTED: coatomer subunit gamma-2                183   1e-48    Pterocles gutturalis
gb|KFR13110.1|  Coatomer subunit gamma-2                                184   1e-48    Opisthocomus hoazin [hoatzin]
ref|XP_009329295.1|  PREDICTED: coatomer subunit gamma-2                184   1e-48    Pygoscelis adeliae
ref|XP_009881282.1|  PREDICTED: coatomer subunit gamma-2                184   1e-48    Charadrius vociferus
ref|XP_009080090.1|  PREDICTED: coatomer subunit gamma-2                184   1e-48    Acanthisitta chloris
ref|NP_571069.1|  coatomer subunit gamma-2                              184   1e-48    Danio rerio [leopard danio]
ref|XP_007259089.1|  PREDICTED: coatomer subunit gamma-2                182   1e-48    
ref|XP_004608312.1|  PREDICTED: coatomer subunit gamma-2                184   1e-48    Sorex araneus [Eurasian shrew]
gb|AAH96860.1|  Copg2 protein                                           184   1e-48    Danio rerio [leopard danio]
ref|XP_008256344.1|  PREDICTED: coatomer subunit gamma-2-like           183   1e-48    Oryctolagus cuniculus [domestic rabbit]
ref|XP_009280965.1|  PREDICTED: coatomer subunit gamma-2                184   1e-48    
dbj|BAG51296.1|  unnamed protein product                                182   1e-48    Homo sapiens [man]
ref|XP_002413239.1|  coatomer gamma subunit, putative                   184   1e-48    Ixodes scapularis [blacklegged tick]
ref|XP_010127718.1|  PREDICTED: coatomer subunit gamma-2                184   2e-48    Chlamydotis macqueenii
gb|KFP34936.1|  Coatomer subunit gamma-2                                183   2e-48    Chlamydotis macqueenii
ref|XP_008964273.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     183   2e-48    
dbj|BAB14315.1|  unnamed protein product                                183   2e-48    Homo sapiens [man]
pdb|1R4X|A  Chain A, Crystal Structure Analys Of The Gamma-Copi A...    174   2e-48    Homo sapiens [man]
ref|XP_008256411.1|  PREDICTED: coatomer subunit gamma-2                183   2e-48    
ref|XP_002111874.1|  hypothetical protein TRIADDRAFT_55337              183   2e-48    Trichoplax adhaerens
gb|EHH52515.1|  hypothetical protein EGM_12967                          183   3e-48    Macaca fascicularis [crab eating macaque]
ref|NP_059506.1|  coatomer subunit gamma-2                              183   3e-48    Mus musculus [mouse]
ref|XP_007177339.1|  PREDICTED: coatomer subunit gamma-2                182   3e-48    Balaenoptera acutorostrata scammoni
gb|KFV83597.1|  Coatomer subunit gamma-2                                183   3e-48    Struthio camelus australis
ref|XP_007981130.1|  PREDICTED: coatomer subunit gamma-2 isoform X3     182   3e-48    Chlorocebus sabaeus
ref|XP_010377104.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     183   3e-48    Rhinopithecus roxellana
gb|EHH17684.1|  hypothetical protein EGK_14141                          182   3e-48    Macaca mulatta [rhesus macaque]
gb|AAH17443.2|  COPG2 protein                                           183   3e-48    Homo sapiens [man]
gb|EDL13724.1|  coatomer protein complex, subunit gamma 2               182   3e-48    Mus musculus [mouse]
ref|XP_009500374.1|  PREDICTED: coatomer subunit gamma-2                182   3e-48    Phalacrocorax carbo [common cormorant]
gb|KFW89615.1|  Coatomer subunit gamma-2                                182   3e-48    Phalacrocorax carbo [common cormorant]
ref|XP_007469781.1|  PREDICTED: coatomer subunit gamma-2                182   3e-48    Lipotes vexillifer [baiji]
ref|XP_005550843.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     182   3e-48    Macaca fascicularis [crab eating macaque]
gb|KFO78000.1|  Coatomer subunit gamma-2                                182   3e-48    Cuculus canorus
ref|XP_010377103.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     183   3e-48    Rhinopithecus roxellana
ref|NP_036265.3|  coatomer subunit gamma-2 isoform 1                    182   3e-48    Homo sapiens [man]
ref|XP_009561693.1|  PREDICTED: coatomer subunit gamma-2                183   3e-48    Cuculus canorus
ref|XP_005550842.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     183   3e-48    Macaca fascicularis [crab eating macaque]
ref|XP_003813516.2|  PREDICTED: coatomer subunit gamma-2 isoform X1     182   3e-48    Pan paniscus [bonobo]
ref|XP_007981129.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     182   3e-48    Chlorocebus sabaeus
gb|KFU91627.1|  Coatomer subunit gamma-2                                182   3e-48    Chaetura pelagica
ref|XP_009998601.1|  PREDICTED: coatomer subunit gamma-2                182   3e-48    Chaetura pelagica
ref|XP_009677631.1|  PREDICTED: coatomer subunit gamma-2                182   3e-48    Struthio camelus australis
ref|XP_004272238.1|  PREDICTED: coatomer subunit gamma-2                182   4e-48    Orcinus orca [Orca]
ref|XP_009001311.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    182   4e-48    Callithrix jacchus [common marmoset]
ref|XP_003921038.1|  PREDICTED: coatomer subunit gamma-2                182   5e-48    Saimiri boliviensis boliviensis
ref|XP_009202144.1|  PREDICTED: coatomer subunit gamma-2                182   5e-48    
ref|XP_007981128.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     182   5e-48    Chlorocebus sabaeus
sp|Q9PUE4.2|COPG2_DANRE  RecName: Full=Coatomer subunit gamma-2; ...    182   6e-48    Danio rerio [leopard danio]
ref|XP_006979482.1|  PREDICTED: coatomer subunit gamma-2                182   6e-48    Peromyscus maniculatus bairdii
ref|XP_010885618.1|  PREDICTED: coatomer subunit gamma-2                182   7e-48    Esox lucius
ref|XP_006265191.1|  PREDICTED: coatomer subunit gamma-2                182   8e-48    Alligator mississippiensis
ref|XP_003983109.2|  PREDICTED: coatomer subunit gamma-2                182   8e-48    
ref|NP_001008019.1|  coatomer subunit gamma-2                           182   8e-48    Xenopus tropicalis [western clawed frog]
emb|CAG07279.1|  unnamed protein product                                182   9e-48    Tetraodon nigroviridis
ref|NP_001133706.1|  Coatomer subunit gamma-2                           181   9e-48    Salmo salar
ref|NP_001233167.1|  coatomer subunit gamma-2                           181   9e-48    Sus scrofa [pigs]
gb|AAH08136.1|  Copg2 protein                                           176   9e-48    Mus musculus [mouse]
emb|CDY05110.1|  BnaC03g29080D                                          171   1e-47    
pdb|1PZD|A  Chain A, Structural Identification Of A Conserved App...    174   1e-47    Bos taurus [bovine]
ref|XP_010142182.1|  PREDICTED: coatomer subunit gamma-2-like           175   1e-47    Buceros rhinoceros silvestris
ref|NP_001100399.1|  coatomer subunit gamma-2                           181   1e-47    Rattus norvegicus [brown rat]
gb|KFV67190.1|  Coatomer subunit gamma-2                                181   1e-47    
ref|XP_004548319.1|  PREDICTED: coatomer subunit gamma-2-like           181   2e-47    
ref|XP_004083090.1|  PREDICTED: coatomer subunit gamma-2                181   2e-47    
gb|EIE79698.1|  hypothetical protein RO3G_04403                         181   2e-47    
ref|XP_009898597.1|  PREDICTED: coatomer subunit gamma-2                181   2e-47    
ref|XP_004677112.1|  PREDICTED: coatomer subunit gamma-2                180   2e-47    
ref|XP_006031895.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     181   2e-47    
ref|XP_006903481.1|  PREDICTED: coatomer subunit gamma-1-like           177   2e-47    
gb|ELW48049.1|  Coatomer subunit gamma-2                                179   2e-47    
ref|XP_005365844.1|  PREDICTED: coatomer subunit gamma-2                180   2e-47    
ref|XP_006031896.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     180   2e-47    
ref|XP_005086531.1|  PREDICTED: coatomer subunit gamma-2                180   3e-47    
ref|XP_006780784.1|  PREDICTED: coatomer subunit gamma-2-like           181   3e-47    
ref|NP_001171865.1|  coatomer subunit gamma-2                           180   3e-47    
ref|XP_005927231.1|  PREDICTED: coatomer subunit gamma-2-like           181   3e-47    
ref|XP_010631824.1|  PREDICTED: coatomer subunit gamma-2                180   3e-47    
gb|EGV98199.1|  Coatomer subunit gamma-2                                179   3e-47    
ref|XP_004661259.1|  PREDICTED: coatomer subunit gamma-2                180   3e-47    
ref|XP_001367114.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     180   4e-47    
ref|XP_010784382.1|  PREDICTED: coatomer subunit gamma-2                180   4e-47    
ref|XP_004592596.1|  PREDICTED: coatomer subunit gamma-2                179   4e-47    
ref|XP_008580934.1|  PREDICTED: coatomer subunit gamma-2                178   5e-47    
ref|XP_007504392.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     179   5e-47    
ref|XP_005714029.1|  Coatomer subunit gamma                             180   5e-47    
ref|XP_008844630.1|  PREDICTED: coatomer subunit gamma-2                177   5e-47    
gb|ESA11201.1|  hypothetical protein GLOINDRAFT_192263                  174   5e-47    
gb|ERE89507.1|  coatomer subunit gamma-2                                179   5e-47    
emb|CEG83116.1|  Putative Coatomer subunit gamma                        172   6e-47    
ref|XP_007611892.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     179   6e-47    
ref|XP_006158897.1|  PREDICTED: coatomer subunit gamma-2                179   6e-47    
dbj|BAC40387.1|  unnamed protein product                                179   8e-47    
ref|XP_006633341.1|  PREDICTED: coatomer subunit gamma-2-like           179   8e-47    
ref|XP_006120418.1|  PREDICTED: coatomer subunit gamma-2                180   8e-47    
gb|EHB08632.1|  Coatomer subunit gamma-2                                179   8e-47    
ref|XP_007617480.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     179   9e-47    
ref|XP_003228861.1|  PREDICTED: coatomer subunit gamma-2                179   9e-47    
ref|XP_007056007.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     179   9e-47    
ref|XP_007056008.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     179   9e-47    
ref|XP_004893442.1|  PREDICTED: coatomer subunit gamma-2                179   9e-47    
ref|XP_007441415.1|  PREDICTED: coatomer subunit gamma-2-like           179   1e-46    
ref|XP_006088405.1|  PREDICTED: coatomer subunit gamma-2                179   1e-46    
ref|XP_010735170.1|  PREDICTED: coatomer subunit gamma-2                179   1e-46    
ref|XP_003982592.1|  PREDICTED: coatomer subunit gamma-1                179   1e-46    
gb|EOB08720.1|  Coatomer subunit gamma-2                                178   1e-46    
ref|XP_007564468.1|  PREDICTED: coatomer subunit gamma-2                178   1e-46    
ref|XP_005807471.1|  PREDICTED: coatomer subunit gamma-2-like           178   1e-46    
ref|XP_003771666.1|  PREDICTED: coatomer subunit gamma-2                178   1e-46    
ref|XP_005071294.1|  PREDICTED: coatomer subunit gamma-1                174   2e-46    
ref|XP_008172281.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     178   2e-46    
gb|EMP39438.1|  Coatomer subunit gamma-2                                179   2e-46    
ref|XP_008563459.1|  PREDICTED: coatomer subunit gamma-1                178   2e-46    
ref|XP_008313867.1|  PREDICTED: coatomer subunit gamma-2                178   2e-46    
ref|XP_006180083.1|  PREDICTED: coatomer subunit gamma-2                177   2e-46    
ref|XP_006202356.1|  PREDICTED: coatomer subunit gamma-2                177   2e-46    
ref|XP_007092970.1|  PREDICTED: coatomer subunit gamma-1                177   2e-46    
ref|XP_008172280.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     178   3e-46    
ref|XP_003445006.1|  PREDICTED: coatomer subunit gamma-2-like           177   3e-46    
ref|XP_008299543.1|  PREDICTED: coatomer subunit gamma-2                177   3e-46    
ref|XP_003972850.1|  PREDICTED: coatomer subunit gamma-2-like           177   3e-46    
ref|XP_010973968.1|  PREDICTED: coatomer subunit gamma-2                177   4e-46    
ref|XP_010945830.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     177   4e-46    
ref|XP_008511127.1|  PREDICTED: coatomer subunit gamma-2                177   4e-46    
emb|CAA49616.1|  gamma-COP                                              174   4e-46    
emb|CDS11673.1|  hypothetical protein LRAMOSA03936                      177   4e-46    
ref|XP_004398041.1|  PREDICTED: coatomer subunit gamma-2                177   4e-46    
ref|XP_006180147.1|  PREDICTED: coatomer subunit gamma-1                176   4e-46    
ref|XP_001488579.1|  PREDICTED: coatomer subunit gamma-1                177   5e-46    
gb|ERE66781.1|  coatomer subunit gamma isoform 1                        175   6e-46    
gb|ERE66782.1|  coatomer subunit gamma isoform 1                        176   6e-46    
ref|XP_004707875.1|  PREDICTED: coatomer subunit gamma-2                175   7e-46    
dbj|BAG53983.1|  unnamed protein product                                174   8e-46    
ref|XP_006887194.1|  PREDICTED: coatomer subunit gamma-2                176   8e-46    
ref|XP_002913488.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     176   8e-46    
ref|XP_532421.4|  PREDICTED: coatomer subunit gamma-2 isoform X4        176   8e-46    
ref|NP_001026992.1|  coatomer subunit gamma-1                           176   8e-46    
ref|XP_010959568.1|  PREDICTED: coatomer subunit gamma-1                176   9e-46    
ref|XP_010998492.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    176   9e-46    
ref|XP_005628431.1|  PREDICTED: coatomer subunit gamma-2 isoform X3     176   1e-45    
gb|KFM76767.1|  Coatomer subunit gamma-2                                176   1e-45    
ref|XP_004692390.1|  PREDICTED: coatomer subunit gamma-1                176   1e-45    
ref|XP_003796252.1|  PREDICTED: coatomer subunit gamma-1                176   1e-45    
emb|CEG70291.1|  Putative Coatomer subunit gamma                        176   1e-45    
gb|AAH20498.2|  COPG protein                                            174   1e-45    
ref|XP_008826767.1|  PREDICTED: coatomer subunit gamma-1                176   1e-45    
ref|XP_004789617.1|  PREDICTED: coatomer subunit gamma-2 isoform X3     175   1e-45    
gb|EAW79268.1|  coatomer protein complex, subunit gamma, isoform ...    174   1e-45    
ref|XP_003503605.1|  PREDICTED: coatomer subunit gamma-1 isoform X1     176   1e-45    
ref|XP_004665164.1|  PREDICTED: coatomer subunit gamma-1                176   1e-45    
ref|XP_005628430.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     176   1e-45    
gb|EAW79270.1|  coatomer protein complex, subunit gamma, isoform ...    174   1e-45    
ref|XP_009452485.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     176   1e-45    
ref|XP_005654082.1|  PREDICTED: coatomer subunit gamma-1                173   1e-45    
ref|XP_005364890.1|  PREDICTED: coatomer subunit gamma-1 isoform X1     175   1e-45    
ref|XP_004581396.1|  PREDICTED: coatomer subunit gamma-1                175   2e-45    
ref|XP_005364891.1|  PREDICTED: coatomer subunit gamma-1 isoform X2     175   2e-45    
ref|XP_005628429.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     176   2e-45    
ref|XP_005331155.1|  PREDICTED: coatomer subunit gamma-2                175   2e-45    
ref|XP_008938449.1|  PREDICTED: coatomer subunit gamma-2-like           168   2e-45    
ref|XP_006995443.1|  PREDICTED: coatomer subunit gamma-1                175   2e-45    
ref|XP_005979492.1|  PREDICTED: coatomer subunit gamma-1                174   2e-45    
ref|XP_004395788.1|  PREDICTED: coatomer subunit gamma-1                174   2e-45    
gb|ELU14014.1|  hypothetical protein CAPTEDRAFT_162815                  175   2e-45    
ref|XP_004382736.1|  PREDICTED: coatomer subunit gamma-2                175   2e-45    
ref|XP_004741803.1|  PREDICTED: coatomer subunit gamma-2 isoform X3     175   2e-45    
sp|Q9I8E6.1|COPG2_TAKRU  RecName: Full=Coatomer subunit gamma-2; ...    175   2e-45    
ref|XP_008980474.1|  PREDICTED: coatomer subunit gamma-1                175   2e-45    
ref|XP_008696040.1|  PREDICTED: coatomer subunit gamma-1                175   2e-45    
sp|P53620.1|COPG1_BOVIN  RecName: Full=Coatomer subunit gamma-1; ...    175   2e-45    
ref|NP_001032904.1|  coatomer subunit gamma-1                           175   2e-45    
gb|EFB22596.1|  hypothetical protein PANDA_006034                       174   2e-45    
gb|EAW79269.1|  coatomer protein complex, subunit gamma, isoform ...    175   2e-45    
ref|XP_004741801.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     174   3e-45    
ref|XP_003409778.1|  PREDICTED: coatomer subunit gamma-1                174   3e-45    
ref|XP_004741802.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     174   3e-45    
ref|XP_005908175.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    174   3e-45    
ref|XP_009236687.1|  PREDICTED: coatomer subunit gamma-1 isoform X1     174   3e-45    
ref|XP_002713207.1|  PREDICTED: coatomer subunit gamma-1                174   3e-45    
ref|XP_001141317.1|  PREDICTED: coatomer subunit gamma-1                174   3e-45    
gb|AAH08553.1|  Copg protein                                            173   3e-45    
ref|NP_057212.1|  coatomer subunit gamma-1                              174   3e-45    
ref|XP_010335478.1|  PREDICTED: coatomer subunit gamma-1                174   3e-45    
ref|XP_006742460.1|  PREDICTED: coatomer subunit gamma-1 isoform X1     174   3e-45    
ref|XP_005696220.1|  PREDICTED: coatomer subunit gamma-1                173   3e-45    
ref|XP_002917686.1|  PREDICTED: coatomer subunit gamma-1                174   3e-45    
emb|CDH50687.1|  coatomer subunit gamma                                 175   3e-45    
dbj|BAF84382.1|  unnamed protein product                                174   3e-45    
ref|XP_007984416.1|  PREDICTED: coatomer subunit gamma-1                174   3e-45    
ref|XP_007524272.1|  PREDICTED: coatomer subunit gamma-2 isoform X2     174   3e-45    
ref|XP_004368444.1|  PREDICTED: coatomer subunit gamma-1                174   3e-45    
ref|XP_008064668.1|  PREDICTED: coatomer subunit gamma-1                174   3e-45    
emb|CEI92803.1|  Putative Coatomer subunit gamma                        175   3e-45    
ref|XP_007524271.1|  PREDICTED: coatomer subunit gamma-2 isoform X1     174   4e-45    
gb|EHH21030.1|  hypothetical protein EGK_04006                          174   4e-45    
ref|XP_004738746.1|  PREDICTED: coatomer subunit gamma-1-like           172   4e-45    
ref|XP_004613186.1|  PREDICTED: coatomer subunit gamma-1                174   4e-45    
ref|XP_007948827.1|  PREDICTED: coatomer subunit gamma-1                174   4e-45    
ref|XP_005340504.1|  PREDICTED: coatomer subunit gamma-1                174   5e-45    
ref|XP_004738683.1|  PREDICTED: coatomer subunit gamma-1                174   5e-45    
gb|EPY84595.1|  coatomer subunit gamma                                  175   5e-45    
ref|XP_006078914.1|  PREDICTED: coatomer subunit gamma-1                174   5e-45    
ref|XP_006772562.1|  PREDICTED: coatomer subunit gamma-1                174   6e-45    
gb|ELK23672.1|  Coatomer subunit gamma                                  174   7e-45    
ref|XP_007179235.1|  PREDICTED: coatomer subunit gamma-1                174   7e-45    
gb|EXX52844.1|  Sec21p                                                  174   7e-45    
ref|XP_533723.2|  PREDICTED: coatomer subunit gamma-1                   173   7e-45    
ref|XP_004476000.1|  PREDICTED: coatomer subunit gamma-1                173   8e-45    
gb|EHH66557.1|  hypothetical protein EGM_03573                          173   9e-45    
dbj|BAG50968.1|  unnamed protein product                                173   9e-45    
ref|XP_006861204.1|  PREDICTED: coatomer subunit gamma-2                173   1e-44    
ref|XP_004284385.1|  PREDICTED: coatomer subunit gamma-1                173   1e-44    
ref|XP_004442980.1|  PREDICTED: coatomer subunit gamma-1                173   1e-44    
ref|XP_004313094.1|  PREDICTED: coatomer subunit gamma-1                173   1e-44    
gb|EDK99234.1|  coatomer protein complex, subunit gamma, isoform ...    173   1e-44    
ref|NP_059505.1|  coatomer subunit gamma-1 isoform 1                    173   1e-44    
ref|XP_004645653.1|  PREDICTED: coatomer subunit gamma-1                173   1e-44    
ref|XP_006169879.1|  PREDICTED: coatomer subunit gamma-1                173   1e-44    
ref|XP_005387056.1|  PREDICTED: coatomer subunit gamma-1                173   1e-44    
ref|XP_008157497.1|  PREDICTED: coatomer subunit gamma-1                172   1e-44    
gb|EFA81100.1|  adaptin N-terminal domain-containing protein            172   2e-44    
gb|EIE80878.1|  hypothetical protein RO3G_05583                         173   2e-44    
gb|EPQ10929.1|  Coatomer subunit gamma                                  172   2e-44    
ref|XP_006091377.1|  PREDICTED: coatomer subunit gamma-1                172   2e-44    
ref|XP_010615871.1|  PREDICTED: coatomer subunit gamma-1 isoform X1     172   2e-44    
dbj|GAN08986.1|  coatomer subunit gamma                                 172   2e-44    
ref|XP_005871512.1|  PREDICTED: coatomer subunit gamma-1                172   2e-44    
ref|XP_006870543.1|  PREDICTED: coatomer subunit gamma-1                172   2e-44    
ref|XP_007130899.1|  PREDICTED: coatomer subunit gamma-1                172   2e-44    
gb|AAH24896.1|  Coatomer protein complex, subunit gamma                 172   3e-44    
gb|ETE65302.1|  Coatomer subunit gamma                                  171   3e-44    
ref|XP_006910574.1|  PREDICTED: coatomer subunit gamma-2                171   3e-44    
dbj|BAE31753.1|  unnamed protein product                                171   3e-44    
ref|XP_004702564.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    171   4e-44    
gb|AAW70037.1|  coatomer protein complex subunit gamma 2                169   4e-44    
ref|XP_007531685.1|  PREDICTED: coatomer subunit gamma-1                171   5e-44    
ref|XP_007465342.1|  PREDICTED: coatomer subunit gamma-1                171   5e-44    
ref|XP_011355541.1|  PREDICTED: coatomer subunit gamma-2                171   5e-44    
ref|NP_001086117.1|  coatomer subunit gamma-2                           171   6e-44    
gb|ELK13848.1|  Coatomer subunit gamma-2                                171   6e-44    
dbj|BAC36811.1|  unnamed protein product                                171   6e-44    
ref|XP_004886276.1|  PREDICTED: coatomer subunit gamma-1-like iso...    171   7e-44    
ref|XP_004886277.1|  PREDICTED: coatomer subunit gamma-1-like iso...    171   7e-44    
ref|XP_006130944.1|  PREDICTED: coatomer subunit gamma-1                171   7e-44    
ref|XP_636291.1|  adaptin N-terminal domain-containing protein          171   7e-44    
gb|EPB82812.1|  hypothetical protein HMPREF1544_10426                   171   1e-43    
ref|XP_008926178.1|  PREDICTED: coatomer subunit gamma-2                169   1e-43    
ref|XP_009022681.1|  hypothetical protein HELRODRAFT_155881             169   2e-43    
ref|XP_004018753.1|  PREDICTED: coatomer subunit gamma-1                168   2e-43    
gb|KFZ69540.1|  Coatomer subunit gamma-1                                169   2e-43    
ref|XP_010163866.1|  PREDICTED: coatomer subunit gamma-1                167   2e-43    
gb|KFZ55961.1|  Coatomer subunit gamma-1                                167   2e-43    
ref|XP_009515671.1|  hypothetical protein PHYSODRAFT_537097             169   2e-43    
ref|NP_001025768.1|  coatomer subunit gamma                             169   3e-43    
dbj|GAM19255.1|  hypothetical protein SAMD00019534_024300               169   3e-43    
gb|KGL75899.1|  Coatomer subunit gamma-1                                169   3e-43    
ref|XP_003430857.1|  PREDICTED: coatomer subunit gamma-1                168   3e-43    
ref|NP_989174.1|  coatomer protein complex, subunit gamma 1             169   3e-43    
ref|XP_003279964.1|  PREDICTED: coatomer subunit gamma-1 isoform 2      169   4e-43    
gb|KDR23235.1|  Coatomer subunit gamma-2                                169   4e-43    
ref|XP_006680775.1|  hypothetical protein BATDEDRAFT_35627              169   4e-43    
gb|KFV78453.1|  Coatomer subunit gamma-1                                168   4e-43    
emb|CEP19374.1|  hypothetical protein                                   169   4e-43    
ref|XP_009936965.1|  PREDICTED: coatomer subunit gamma-1                169   5e-43    
ref|XP_009667664.1|  PREDICTED: coatomer subunit gamma-1                168   5e-43    
ref|XP_010210940.1|  PREDICTED: coatomer subunit gamma-1                169   5e-43    
ref|XP_010157999.1|  PREDICTED: coatomer subunit gamma-1                168   6e-43    
gb|KGL97575.1|  Coatomer subunit gamma-1                                168   6e-43    
ref|XP_010181175.1|  PREDICTED: coatomer subunit gamma-1                168   6e-43    
gb|KFV96550.1|  Coatomer subunit gamma-1                                168   6e-43    
gb|KFQ34147.1|  Coatomer subunit gamma-1                                168   6e-43    
ref|XP_009888710.1|  PREDICTED: coatomer subunit gamma-1                168   7e-43    
ref|XP_010275177.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...    154   7e-43    
gb|KFW91900.1|  Coatomer subunit gamma-1                                168   7e-43    
ref|XP_009504584.1|  PREDICTED: coatomer subunit gamma-1                167   7e-43    
gb|KFQ92512.1|  Coatomer subunit gamma-1                                167   7e-43    
gb|KFQ64533.1|  Coatomer subunit gamma-1                                167   7e-43    
ref|XP_002600080.1|  hypothetical protein BRAFLDRAFT_122413             166   7e-43    
ref|XP_010072767.1|  PREDICTED: coatomer subunit gamma-1                167   7e-43    
ref|XP_009957138.1|  PREDICTED: coatomer subunit gamma-1                167   8e-43    
gb|KFQ19840.1|  Coatomer subunit gamma-1                                167   8e-43    
gb|KFV07736.1|  Coatomer subunit gamma-1                                167   8e-43    
ref|XP_009230436.1|  coatomer subunit gamma                             168   8e-43    



>ref|XP_009795130.1| PREDICTED: coatomer subunit gamma [Nicotiana sylvestris]
Length=887

 Score =   438 bits (1126),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 217/237 (92%), Positives = 230/237 (97%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LENV+VIVD SEAEEFSE ASKPLKSLP
Sbjct  651  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLENVSVIVDPSEAEEFSEIASKPLKSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFEKPEGVPA+GKFSNTLRFIVKEVDP+TGEAE+DGVEDEYQLEDLEVV A
Sbjct  711  YDTPGQTFVAFEKPEGVPAVGKFSNTLRFIVKEVDPTTGEAEDDGVEDEYQLEDLEVVTA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLK+GVSNFRNAWE++GPDCERVDEYGLGPR+SL EAVNAVINLLGMQPCEGTEVVP+
Sbjct  771  DYMLKLGVSNFRNAWESLGPDCERVDEYGLGPRESLTEAVNAVINLLGMQPCEGTEVVPS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIGS KVLVRLSFG+DG KEVAMKLAVRSED+S+SDAIHE+VASG
Sbjct  831  NSRSHTCLLSGVYIGSVKVLVRLSFGLDGAKEVAMKLAVRSEDISVSDAIHEVVASG  887



>ref|XP_009605957.1| PREDICTED: coatomer subunit gamma [Nicotiana tomentosiformis]
Length=886

 Score =   437 bits (1124),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 217/237 (92%), Positives = 232/237 (98%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD+H+VFQYNCTNTIPEQ LENVTVIVDASEAEEFSE ASKPLKSLP
Sbjct  650  AETEYAVNVVKHIFDNHIVFQYNCTNTIPEQLLENVTVIVDASEAEEFSEVASKPLKSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFEKPEGVPA+GKFSNTLRFIVKEVDPSTGEAE+DGVEDEYQLEDLEVV+A
Sbjct  710  YDTPGQTFVAFEKPEGVPAVGKFSNTLRFIVKEVDPSTGEAEDDGVEDEYQLEDLEVVSA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE++GPDCE+VDEYGLGPR+SLAEAVN VI+LLGMQPCEGTEVVP+
Sbjct  770  DYVLKVGVSNFRNAWESLGPDCEKVDEYGLGPRESLAEAVNTVIDLLGMQPCEGTEVVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG  KVLVRLSFG+DGPKEVAMKLAVRSED+S+SDAIHEIVASG
Sbjct  830  NSRSHTCLLSGVYIGGVKVLVRLSFGVDGPKEVAMKLAVRSEDISVSDAIHEIVASG  886



>ref|XP_007042213.1| Coatomer gamma-2 subunit / gamma-2 coat protein / gamma-2 COP, 
putative isoform 1 [Theobroma cacao]
 gb|EOX98044.1| Coatomer gamma-2 subunit / gamma-2 coat protein / gamma-2 COP, 
putative isoform 1 [Theobroma cacao]
Length=887

 Score =   432 bits (1112),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 216/237 (91%), Positives = 228/237 (96%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQ+NCTNTIPEQ LENVTVIVDASEAEEF+E A+KPL+SLP
Sbjct  651  AETEYAVNVVKHIFDGHVVFQFNCTNTIPEQLLENVTVIVDASEAEEFAEVATKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A+GKFSN LRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA
Sbjct  711  YDSPGQTFVAFEKPEGVSAVGKFSNMLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+MG DCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP+
Sbjct  771  DYMLKVGVSNFRNAWESMGADCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRL FGIDGPK+VAMKLAVRSED ++SDAIHEIVASG
Sbjct  831  NSRSHTCLLSGVYIGNVKVLVRLQFGIDGPKDVAMKLAVRSEDEAVSDAIHEIVASG  887



>gb|KJB79199.1| hypothetical protein B456_013G037600 [Gossypium raimondii]
Length=887

 Score =   432 bits (1111),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 217/237 (92%), Positives = 228/237 (96%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENVTVIVDASEAEEF+E ASKPL+SLP
Sbjct  651  AETEYAVNVVKHIFDGHVVFQYNCTNTIPEQLLENVTVIVDASEAEEFAEVASKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVPAIGKFSN LRFIVKEVDPSTGEAE+DGVEDEYQLE+LEVVAA
Sbjct  711  YDSPGQTFVAFEKPEGVPAIGKFSNMLRFIVKEVDPSTGEAEDDGVEDEYQLEELEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWETM  DCERVDEYGLGPR+SLAEAVNAVINLLGMQPCEGTEVVPN
Sbjct  771  DYMLKVGVSNFRNAWETMDADCERVDEYGLGPRESLAEAVNAVINLLGMQPCEGTEVVPN  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRL FG+DGPK+VAMKLAVRSED ++SDAIHEIVASG
Sbjct  831  NSRSHTCLLSGVYIGNVKVLVRLQFGLDGPKDVAMKLAVRSEDEAVSDAIHEIVASG  887



>ref|XP_009800885.1| PREDICTED: coatomer subunit gamma-like [Nicotiana sylvestris]
Length=886

 Score =   432 bits (1111),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 214/237 (90%), Positives = 231/237 (97%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD+H+VFQYNCTNTIPEQ LENVTVIVDASEAEEFSE ASKPLKSLP
Sbjct  650  AETEYAVNVVKHIFDNHIVFQYNCTNTIPEQLLENVTVIVDASEAEEFSEVASKPLKSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFEKPEG PA+GKFSNTLRFIVKEVDP+TGEAE+DGVEDEYQLEDLEVV+A
Sbjct  710  YDTPGQTFVAFEKPEGEPAVGKFSNTLRFIVKEVDPTTGEAEDDGVEDEYQLEDLEVVSA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE++GPDCE+VDEYGLGPR+SLAEAVN VI+LLGMQPCEGTEVVP+
Sbjct  770  DYVLKVGVSNFRNAWESLGPDCEKVDEYGLGPRESLAEAVNTVIDLLGMQPCEGTEVVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG  KVLVRLSFG+DGPK+VAMKLAVRSED+S+SDAIHEIVASG
Sbjct  830  NSRSHTCLLSGVYIGGVKVLVRLSFGVDGPKDVAMKLAVRSEDISVSDAIHEIVASG  886



>gb|KHG07840.1| hypothetical protein F383_13405 [Gossypium arboreum]
Length=887

 Score =   431 bits (1109),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 216/237 (91%), Positives = 228/237 (96%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENVTVIVDASEAEEF+E ASKPL+SLP
Sbjct  651  AETEYAVNVVKHIFDGHVVFQYNCTNTIPEQLLENVTVIVDASEAEEFAEVASKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVPA+GKFSN LRFIVKEVDPSTGEAE+DGVEDEYQLE+LEVVAA
Sbjct  711  YDSPGQTFVAFEKPEGVPAVGKFSNMLRFIVKEVDPSTGEAEDDGVEDEYQLEELEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWETM  DCERVDEYGLGPR+SLAEAVNAVINLLGMQPCEGTEVVPN
Sbjct  771  DYMLKVGVSNFRNAWETMDADCERVDEYGLGPRESLAEAVNAVINLLGMQPCEGTEVVPN  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRL FG+DGPK+VAMKLAVRSED ++SDAIHEIVASG
Sbjct  831  NSRSHTCLLSGVYIGNVKVLVRLQFGLDGPKDVAMKLAVRSEDEAVSDAIHEIVASG  887



>gb|KJB47485.1| hypothetical protein B456_008G028500 [Gossypium raimondii]
 gb|KJB47486.1| hypothetical protein B456_008G028500 [Gossypium raimondii]
Length=883

 Score =   431 bits (1109),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 215/237 (91%), Positives = 229/237 (97%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENVTVIVDASEAEEF+E ASKPL+SLP
Sbjct  647  AETEYAVNVVKHIFDGHVVFQYNCTNTIPEQLLENVTVIVDASEAEEFAEVASKPLRSLP  706

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVPA+GKFSN LRFIVKEVDPSTGEAE+DGVEDEYQLE+LEVVAA
Sbjct  707  YDSPGQTFVAFEKPEGVPAVGKFSNMLRFIVKEVDPSTGEAEDDGVEDEYQLEELEVVAA  766

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+MGPDCERVDEY LGPR++LAEAVNAVINLLGMQPCEGTEVVP+
Sbjct  767  DYMLKVGVSNFRNAWESMGPDCERVDEYDLGPRENLAEAVNAVINLLGMQPCEGTEVVPS  826

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRL FGIDGPK+VAMKLAVRSED ++SDAIHEIVASG
Sbjct  827  NSRSHTCLLSGVYIGNVKVLVRLQFGIDGPKDVAMKLAVRSEDEAVSDAIHEIVASG  883



>ref|XP_009609407.1| PREDICTED: coatomer subunit gamma [Nicotiana tomentosiformis]
Length=887

 Score =   431 bits (1108),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/237 (90%), Positives = 229/237 (97%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSH+VF+YNCTNTIP Q LENV+VIVD SEAEEFSE ASKPLKSLP
Sbjct  651  AETEYAVNVVKHIFDSHLVFRYNCTNTIPGQLLENVSVIVDPSEAEEFSEIASKPLKSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFEKPEGVPA+GKFSNTL FIVKEVDP+TGEAE+DGVEDEYQLEDLEVVAA
Sbjct  711  YDTPGQTFVAFEKPEGVPAVGKFSNTLSFIVKEVDPTTGEAEDDGVEDEYQLEDLEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLK+GVSNFRNAWE++GPDCERVDEYGLGPR+SL EAVNAVINLLGMQPCEGTEVVP+
Sbjct  771  DYMLKLGVSNFRNAWESLGPDCERVDEYGLGPRESLTEAVNAVINLLGMQPCEGTEVVPS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIGS KVLVRLSFG+DG KEVAMKLAVRSED+S+SDAIHE++ASG
Sbjct  831  NSRSHTCLLSGVYIGSVKVLVRLSFGLDGAKEVAMKLAVRSEDISVSDAIHEVIASG  887



>ref|XP_006365093.1| PREDICTED: coatomer subunit gamma-like [Solanum tuberosum]
Length=886

 Score =   426 bits (1096),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 211/237 (89%), Positives = 229/237 (97%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSH+VFQYNCTNTIPEQ LENV+VIVDASEAEEFSE ASKPLKSLP
Sbjct  650  AETEYAVNVVKHIFDSHIVFQYNCTNTIPEQLLENVSVIVDASEAEEFSEVASKPLKSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFE+PEGVPA+GKFSNTLRFIVKEVDPSTGEAE+DGVEDEYQLEDLEVV+A
Sbjct  710  YDTPGQTFVAFERPEGVPAVGKFSNTLRFIVKEVDPSTGEAEDDGVEDEYQLEDLEVVSA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE++G DCE++DEYGLGP + L EAVNAVI+LLGMQPCEGTEVVP+
Sbjct  770  DYMLKVGVSNFRNAWESLGADCEKIDEYGLGPMEGLTEAVNAVISLLGMQPCEGTEVVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSG+YIG+ KVLVRLSFG+ GPKEVAMKLAVRSED+S+SDAIHEIVASG
Sbjct  830  NSRSHTCLLSGLYIGNVKVLVRLSFGVGGPKEVAMKLAVRSEDISVSDAIHEIVASG  886



>ref|XP_004230861.1| PREDICTED: coatomer subunit gamma [Solanum lycopersicum]
Length=886

 Score =   425 bits (1093),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/237 (89%), Positives = 228/237 (96%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSH+VFQYNCTNTIPEQ LENV+VIVDASEAEEFSE ASKPLKSLP
Sbjct  650  AETEYAVNVVKHIFDSHIVFQYNCTNTIPEQLLENVSVIVDASEAEEFSEVASKPLKSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFE+PEGVPA+GKFSNTLRFIVKEVDPSTGE E+DGVEDEYQLEDLEVV+A
Sbjct  710  YDTPGQTFVAFERPEGVPAVGKFSNTLRFIVKEVDPSTGEVEDDGVEDEYQLEDLEVVSA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE++G DCE++DEYGLGP + L EAVNAVI+LLGMQPCEGTEVVP+
Sbjct  770  DYMLKVGVSNFRNAWESLGADCEKIDEYGLGPMEGLTEAVNAVISLLGMQPCEGTEVVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSG+YIG+ KVLVRLSFG+ GPKEVAMKLAVRSED+S+SDAIHEIVASG
Sbjct  830  NSRSHTCLLSGLYIGNVKVLVRLSFGVGGPKEVAMKLAVRSEDISVSDAIHEIVASG  886



>ref|XP_008447037.1| PREDICTED: coatomer subunit gamma [Cucumis melo]
Length=887

 Score =   421 bits (1083),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 210/237 (89%), Positives = 225/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LENVTV+VDASEAEEFSE  S+PL+SLP
Sbjct  651  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLENVTVVVDASEAEEFSEVISRPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVPA+GKFSN LRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA
Sbjct  711  YDSPGQTFVAFEKPEGVPAVGKFSNMLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNF+NAW+++GPDCERVDEYGLGPR+SLAEAV AVINLLGMQPCEGTE V +
Sbjct  771  DYMLKVGVSNFKNAWDSLGPDCERVDEYGLGPRESLAEAVGAVINLLGMQPCEGTEAVAS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRLSFGID  +EVAMKLAVRS+D  +SDAIHEIVASG
Sbjct  831  NSRSHTCLLSGVYIGNVKVLVRLSFGIDSSREVAMKLAVRSDDEVVSDAIHEIVASG  887



>ref|XP_010263701.1| PREDICTED: coatomer subunit gamma-2 [Nelumbo nucifera]
Length=887

 Score =   421 bits (1082),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 210/237 (89%), Positives = 226/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+D HVVFQYNCTNTIPEQ LENVTVIVDASEAEEFSE  SKPL+SLP
Sbjct  651  AETEYAVNVVKHIYDGHVVFQYNCTNTIPEQLLENVTVIVDASEAEEFSEVTSKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKP GVPAIGKFSN L+FIVKEVDPSTGEAEEDGVEDEYQLEDL+VVAA
Sbjct  711  YDSPGQTFVAFEKPVGVPAIGKFSNMLKFIVKEVDPSTGEAEEDGVEDEYQLEDLDVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRN WE+MGPDCERVDEYGLG R+SLAEAV AVI++LGMQPCEGTEVVP+
Sbjct  771  DYMLKVGVSNFRNTWESMGPDCERVDEYGLGVRESLAEAVGAVIDILGMQPCEGTEVVPS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGIDGPK+VAMKLAVRSED ++SDAIHEI+ASG
Sbjct  831  NSRSHTCLLSGVFIGNVKVLVRLSFGIDGPKQVAMKLAVRSEDQTVSDAIHEIIASG  887



>ref|XP_003631645.1| PREDICTED: coatomer subunit gamma-2 [Vitis vinifera]
 emb|CBI32579.3| unnamed protein product [Vitis vinifera]
Length=887

 Score =   420 bits (1079),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 208/237 (88%), Positives = 228/237 (96%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENVTVIVDAS+AEEFSE ++KPL+SLP
Sbjct  651  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVTVIVDASDAEEFSEVSTKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKP+GVPA+GKFSN L+FIVKEVDP+TGE EEDGVEDEYQLEDLEVVAA
Sbjct  711  YDSPGQTFVAFEKPDGVPAVGKFSNMLKFIVKEVDPTTGETEEDGVEDEYQLEDLEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE+MGP+ ERVDEYGLGPR+SLAEAV+ VI+LLG+QPCEGTEVVP+
Sbjct  771  DYVLKVGVSNFRNAWESMGPEFERVDEYGLGPRESLAEAVSTVISLLGLQPCEGTEVVPS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGIDGPKEVAMKLAVRSED S+SDAIHEIVASG
Sbjct  831  NSRSHTCLLSGVFIGNMKVLVRLSFGIDGPKEVAMKLAVRSEDESVSDAIHEIVASG  887



>gb|KDO49097.1| hypothetical protein CISIN_1g0029002mg, partial [Citrus sinensis]
Length=505

 Score =   407 bits (1046),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 206/237 (87%), Positives = 224/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENVTVIVDASEAEEF+E ASKPL+SLP
Sbjct  269  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVTVIVDASEAEEFAEVASKPLRSLP  328

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ F AFEKPEGVPA+GKFSN LRFIVKEVDP+TG+ E+DGVEDEYQLEDLEVVAA
Sbjct  329  YDSPGQIFGAFEKPEGVPAVGKFSNMLRFIVKEVDPTTGDVEDDGVEDEYQLEDLEVVAA  388

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY++KVGVSNFRNAWE++GPD ERVDEYGLGPR+SLAEAV+AVI+LLGMQPCEGTEVV N
Sbjct  389  DYVMKVGVSNFRNAWESIGPDFERVDEYGLGPRESLAEAVSAVISLLGMQPCEGTEVVAN  448

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRL FGIDGPKEVAMKLAVRSED ++SD IHEIVASG
Sbjct  449  NSRSHTCLLSGVFIGNVKVLVRLQFGIDGPKEVAMKLAVRSEDDNVSDMIHEIVASG  505



>gb|KHG11475.1| hypothetical protein F383_06298 [Gossypium arboreum]
Length=887

 Score =   419 bits (1076),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 210/237 (89%), Positives = 224/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENVTVIVDASEAEEF+E ASKPL+ LP
Sbjct  651  AETEYAVNVVKHIFDGHVVFQYNCTNTIPEQLLENVTVIVDASEAEEFAEVASKPLRQLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A+GKFSN LRFIVKEVDPSTGEAE+DGVEDEYQLEDLE+VAA
Sbjct  711  YDSPGQTFVAFEKPEGVSAVGKFSNMLRFIVKEVDPSTGEAEDDGVEDEYQLEDLELVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE++G D ERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP 
Sbjct  771  DYMLKVGVSNFRNAWESVGVDFERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPP  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVY+G+ KVLVRL FG+DGPK+VAMKLAVRSED ++SD IHEIVASG
Sbjct  831  NSRSHTCLLSGVYLGNVKVLVRLQFGLDGPKDVAMKLAVRSEDETVSDTIHEIVASG  887



>gb|KDO49098.1| hypothetical protein CISIN_1g0029002mg, partial [Citrus sinensis]
Length=552

 Score =   408 bits (1048),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 206/237 (87%), Positives = 224/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENVTVIVDASEAEEF+E ASKPL+SLP
Sbjct  316  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVTVIVDASEAEEFAEVASKPLRSLP  375

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ F AFEKPEGVPA+GKFSN LRFIVKEVDP+TG+ E+DGVEDEYQLEDLEVVAA
Sbjct  376  YDSPGQIFGAFEKPEGVPAVGKFSNMLRFIVKEVDPTTGDVEDDGVEDEYQLEDLEVVAA  435

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY++KVGVSNFRNAWE++GPD ERVDEYGLGPR+SLAEAV+AVI+LLGMQPCEGTEVV N
Sbjct  436  DYVMKVGVSNFRNAWESIGPDFERVDEYGLGPRESLAEAVSAVISLLGMQPCEGTEVVAN  495

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRL FGIDGPKEVAMKLAVRSED ++SD IHEIVASG
Sbjct  496  NSRSHTCLLSGVFIGNVKVLVRLQFGIDGPKEVAMKLAVRSEDDNVSDMIHEIVASG  552



>gb|KDP46244.1| hypothetical protein JCGZ_10084 [Jatropha curcas]
Length=887

 Score =   418 bits (1074),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/237 (88%), Positives = 226/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVN VKHIFD HVVFQYNCTNTIPEQ LENV VIVDASEAEEFSE ASKPL+SLP
Sbjct  651  AETEYAVNAVKHIFDGHVVFQYNCTNTIPEQLLENVMVIVDASEAEEFSEVASKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVPA+GKFSN LRFIVKEVDP+TGEA+EDGVEDEYQLE+LEVVAA
Sbjct  711  YDSPGQTFVAFEKPEGVPAVGKFSNMLRFIVKEVDPTTGEADEDGVEDEYQLEELEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE+MGPDCERVDEYGLGPR+SL+EAV+AVINLLGMQPCEGTEVV +
Sbjct  771  DYMMKVGVSNFRNAWESMGPDCERVDEYGLGPRESLSEAVSAVINLLGMQPCEGTEVVAS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ +VLVRL FGIDG ++VAMKLAVRSED S+SDAIHEIVASG
Sbjct  831  NSRSHTCLLSGVFIGNVRVLVRLQFGIDGARDVAMKLAVRSEDESVSDAIHEIVASG  887



>gb|KJB32493.1| hypothetical protein B456_005G242900 [Gossypium raimondii]
Length=882

 Score =   417 bits (1073),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/237 (88%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNC NTIPEQ LENVTVIVDASEAEEF+E  SKPL+ LP
Sbjct  646  AETEYAVNVVKHIFDGHVVFQYNCRNTIPEQLLENVTVIVDASEAEEFAEVDSKPLRQLP  705

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A+GKFSN LRFIVKEVDPSTGEAE+DGVEDEYQLEDLE+VAA
Sbjct  706  YDSPGQTFVAFEKPEGVSAVGKFSNMLRFIVKEVDPSTGEAEDDGVEDEYQLEDLELVAA  765

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+MG D E VDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEV+P 
Sbjct  766  DYMLKVGVSNFRNAWESMGVDFEHVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVIPP  825

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRL FG+DGPK+VAMKLAVRSED ++SDAIHEIVASG
Sbjct  826  NSRSHTCLLSGVYIGNVKVLVRLQFGLDGPKDVAMKLAVRSEDGTVSDAIHEIVASG  882



>gb|KJB32494.1| hypothetical protein B456_005G242900 [Gossypium raimondii]
Length=887

 Score =   417 bits (1073),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/237 (88%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNC NTIPEQ LENVTVIVDASEAEEF+E  SKPL+ LP
Sbjct  651  AETEYAVNVVKHIFDGHVVFQYNCRNTIPEQLLENVTVIVDASEAEEFAEVDSKPLRQLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A+GKFSN LRFIVKEVDPSTGEAE+DGVEDEYQLEDLE+VAA
Sbjct  711  YDSPGQTFVAFEKPEGVSAVGKFSNMLRFIVKEVDPSTGEAEDDGVEDEYQLEDLELVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+MG D E VDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEV+P 
Sbjct  771  DYMLKVGVSNFRNAWESMGVDFEHVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVIPP  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRL FG+DGPK+VAMKLAVRSED ++SDAIHEIVASG
Sbjct  831  NSRSHTCLLSGVYIGNVKVLVRLQFGLDGPKDVAMKLAVRSEDGTVSDAIHEIVASG  887



>ref|XP_010254880.1| PREDICTED: coatomer subunit gamma-2 [Nelumbo nucifera]
Length=888

 Score =   417 bits (1072),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 207/237 (87%), Positives = 226/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+D HVVFQYNCTNTIPEQ LENVTVIVDASEAEEFSE +SK L+SLP
Sbjct  652  AETEYAVNVVKHIYDGHVVFQYNCTNTIPEQLLENVTVIVDASEAEEFSEVSSKLLRSLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+P QTFVAFEKP GVPA+GKFSN L+FIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA
Sbjct  712  YDSPKQTFVAFEKPAGVPAVGKFSNMLKFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+MGPDCERVDEYGLG R+SLAEAV+AV+N+LGMQPCEGTEVVP+
Sbjct  772  DYMLKVGVSNFRNAWESMGPDCERVDEYGLGARESLAEAVSAVVNILGMQPCEGTEVVPS  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV++G+ KVLVRLSFGIDGPK+VAMKLAVRSED ++SD IHEI+ASG
Sbjct  832  NSRSHTCLLSGVFMGNVKVLVRLSFGIDGPKQVAMKLAVRSEDQTVSDIIHEIIASG  888



>ref|XP_011088383.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Sesamum indicum]
Length=871

 Score =   416 bits (1070),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 226/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHI+DSHVVFQYNCTNTIPEQ LENVTVIVDAS+AEEFSE  +KPL+SLP
Sbjct  635  AETEYSVNVVKHIYDSHVVFQYNCTNTIPEQLLENVTVIVDASDAEEFSEVGTKPLRSLP  694

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFEKPEGVPA+GKFSN LRF VKEVDP+TGEAE+DGVEDEYQLED EVVAA
Sbjct  695  YDTPGQTFVAFEKPEGVPAVGKFSNVLRFTVKEVDPTTGEAEDDGVEDEYQLEDFEVVAA  754

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNF+NAWE++GPD ER+DEYGLGPR+SLAEAV+ VINLLGMQPCEGTEVVP+
Sbjct  755  DYILKVGVSNFKNAWESLGPDGERIDEYGLGPRESLAEAVSTVINLLGMQPCEGTEVVPS  814

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSG+YIG+ KVLVRLSFGIDG KEVAMKLAVRSE+ ++S+AIHEIVASG
Sbjct  815  NSRSHTCLLSGIYIGNVKVLVRLSFGIDGAKEVAMKLAVRSENENVSEAIHEIVASG  871



>ref|XP_002509477.1| coatomer gamma subunit, putative [Ricinus communis]
 gb|EEF50864.1| coatomer gamma subunit, putative [Ricinus communis]
Length=887

 Score =   416 bits (1070),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 208/237 (88%), Positives = 226/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNT+PEQ LENVTV+VDASEAE+F+E ASKPL+SLP
Sbjct  651  AETEYAVNVVKHIFDGHVVFQYNCTNTVPEQLLENVTVVVDASEAEDFAEVASKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEK EGVPA+GKFSN LRFIVKEVD +TGEAEEDGVEDEYQLEDLEVVAA
Sbjct  711  YDSPGQTFVAFEKLEGVPAVGKFSNMLRFIVKEVDQTTGEAEEDGVEDEYQLEDLEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE+MGPDCE VDEYGLG R+SLAEAV+AVINLLGMQPCEGTEVVP+
Sbjct  771  DYMMKVGVSNFRNAWESMGPDCECVDEYGLGARESLAEAVSAVINLLGMQPCEGTEVVPS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTC+LSGV+IG+ KVLV+L FGIDGPKEVAMKLAVRSED S+SDAIHEIVASG
Sbjct  831  NSRSHTCVLSGVFIGNVKVLVQLQFGIDGPKEVAMKLAVRSEDESVSDAIHEIVASG  887



>ref|XP_011088382.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Sesamum indicum]
Length=888

 Score =   416 bits (1069),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 226/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHI+DSHVVFQYNCTNTIPEQ LENVTVIVDAS+AEEFSE  +KPL+SLP
Sbjct  652  AETEYSVNVVKHIYDSHVVFQYNCTNTIPEQLLENVTVIVDASDAEEFSEVGTKPLRSLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFEKPEGVPA+GKFSN LRF VKEVDP+TGEAE+DGVEDEYQLED EVVAA
Sbjct  712  YDTPGQTFVAFEKPEGVPAVGKFSNVLRFTVKEVDPTTGEAEDDGVEDEYQLEDFEVVAA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNF+NAWE++GPD ER+DEYGLGPR+SLAEAV+ VINLLGMQPCEGTEVVP+
Sbjct  772  DYILKVGVSNFKNAWESLGPDGERIDEYGLGPRESLAEAVSTVINLLGMQPCEGTEVVPS  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSG+YIG+ KVLVRLSFGIDG KEVAMKLAVRSE+ ++S+AIHEIVASG
Sbjct  832  NSRSHTCLLSGIYIGNVKVLVRLSFGIDGAKEVAMKLAVRSENENVSEAIHEIVASG  888



>ref|XP_004150412.1| PREDICTED: coatomer subunit gamma-like [Cucumis sativus]
 ref|XP_004160233.1| PREDICTED: coatomer subunit gamma-like [Cucumis sativus]
 gb|KGN44347.1| hypothetical protein Csa_7G267950 [Cucumis sativus]
Length=887

 Score =   414 bits (1065),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 206/237 (87%), Positives = 223/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LENV V+VDAS+AEEFSE  S+PL+SLP
Sbjct  651  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLENVFVVVDASDAEEFSEVISRPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A+GKFSN LRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV+A
Sbjct  711  YDSPGQTFVAFEKPEGVSAVGKFSNMLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVSA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNF+NAW+++GPDCERVDEYGLGPR+SLAEAV AVINLLGMQPCEGTE V +
Sbjct  771  DYMLKVGVSNFKNAWDSLGPDCERVDEYGLGPRESLAEAVGAVINLLGMQPCEGTEAVAS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRLSFGID  +EVAMKLAVRS+D  +SDAIHEIVASG
Sbjct  831  NSRSHTCLLSGVYIGNVKVLVRLSFGIDSSREVAMKLAVRSDDEVVSDAIHEIVASG  887



>ref|XP_004500815.1| PREDICTED: coatomer subunit gamma-like [Cicer arietinum]
Length=887

 Score =   413 bits (1062),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 201/237 (85%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENV VIVD+SEA+EF+E  SKPLKSLP
Sbjct  651  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVIVIVDSSEADEFAEVFSKPLKSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPEG P +GKFSN L+FIV+EVDP+TGEAE+DGVEDEYQLEDLE+V+A
Sbjct  711  YDSPGQIFVAFEKPEGAPTLGKFSNVLKFIVREVDPTTGEAEDDGVEDEYQLEDLEIVSA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY LKV VSNFRNAWE+MGPDCERVDEYGLGPR+SLAEAVN VINLLG+QPCEGTEVVP 
Sbjct  771  DYTLKVAVSNFRNAWESMGPDCERVDEYGLGPRESLAEAVNTVINLLGLQPCEGTEVVPP  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRLSFG+DGPK+VAMKL VRS+D ++SDAIHEIVASG
Sbjct  831  NSRSHTCLLSGVYIGNVKVLVRLSFGLDGPKDVAMKLTVRSDDETVSDAIHEIVASG  887



>ref|XP_011092782.1| PREDICTED: coatomer subunit gamma-2-like [Sesamum indicum]
Length=888

 Score =   412 bits (1059),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 208/237 (88%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENVTVIVDASEAEEF+E  +KPLKSLP
Sbjct  652  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQCLENVTVIVDASEAEEFAEVGTKPLKSLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTP QTFVAFEKPEGVPA+GKFSN LRF VKEVDPSTGEAE+DGVEDEYQLED EVVAA
Sbjct  712  YDTPAQTFVAFEKPEGVPAVGKFSNVLRFTVKEVDPSTGEAEDDGVEDEYQLEDFEVVAA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LK+GVSNF+NAWE M P  ERVDEYGLGPR+SLAEAVNAVI LLGM PCEGTEVVP+
Sbjct  772  DYILKLGVSNFKNAWENMDPASERVDEYGLGPRESLAEAVNAVIILLGMHPCEGTEVVPS  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRLSFGIDG KEVAMKLAVRSED S+S+AIHEIVASG
Sbjct  832  NSRSHTCLLSGVYIGNVKVLVRLSFGIDGTKEVAMKLAVRSEDESVSEAIHEIVASG  888



>gb|EYU37789.1| hypothetical protein MIMGU_mgv1a001103mg [Erythranthe guttata]
Length=888

 Score =   412 bits (1059),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 206/237 (87%), Positives = 219/237 (92%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIFD HV+FQYNCTNTIPEQ LENVTVIVDASEAEEFSE  +K LKSLP
Sbjct  652  AETEYSVNVVKHIFDRHVLFQYNCTNTIPEQLLENVTVIVDASEAEEFSEVGTKLLKSLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTP QTFVAFEKPEGVP +GKFSN LRF VKEVD STGEA++DGVEDEYQLED EVVAA
Sbjct  712  YDTPAQTFVAFEKPEGVPTVGKFSNVLRFTVKEVDTSTGEADDDGVEDEYQLEDFEVVAA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNF+NAWE+MGPD ER+DEYGLGPRDSL EAVN VINLLGMQPCEGTEVVPN
Sbjct  772  DYILKVGVSNFKNAWESMGPDSERIDEYGLGPRDSLVEAVNTVINLLGMQPCEGTEVVPN  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVY G+ KVLVRLSFGIDG KEVAMKLAVRSED ++SDAIHEIVASG
Sbjct  832  NSRSHTCLLSGVYTGNVKVLVRLSFGIDGSKEVAMKLAVRSEDENVSDAIHEIVASG  888



>ref|XP_006487155.1| PREDICTED: coatomer subunit gamma-2-like isoform X2 [Citrus sinensis]
Length=885

 Score =   411 bits (1056),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 206/237 (87%), Positives = 224/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENVTVIVDASEAEEF+E ASKPL+SLP
Sbjct  649  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVTVIVDASEAEEFAEVASKPLRSLP  708

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ F AFEKPEGVPA+GKFSN LRFIVKEVDP+TG+ E+DGVEDEYQLEDLEVVAA
Sbjct  709  YDSPGQIFGAFEKPEGVPAVGKFSNMLRFIVKEVDPTTGDVEDDGVEDEYQLEDLEVVAA  768

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY++KVGVSNFRNAWE++GPD ERVDEYGLGPR+SLAEAV+AVI+LLGMQPCEGTEVV N
Sbjct  769  DYVMKVGVSNFRNAWESIGPDFERVDEYGLGPRESLAEAVSAVISLLGMQPCEGTEVVAN  828

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRL FGIDGPKEVAMKLAVRSED ++SD IHEIVASG
Sbjct  829  NSRSHTCLLSGVFIGNVKVLVRLQFGIDGPKEVAMKLAVRSEDDNVSDMIHEIVASG  885



>ref|XP_003541056.1| PREDICTED: coatomer subunit gamma-2-like [Glycine max]
Length=887

 Score =   411 bits (1056),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LE+V VIVDASEAEEFSE  SKPL+SLP
Sbjct  651  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLEDVIVIVDASEAEEFSEVFSKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEG+P  GKFSN L+FIVKEVDP+TGE E+DGVEDEYQLEDLEVV A
Sbjct  711  YDSPGQTFVAFEKPEGLPIAGKFSNVLKFIVKEVDPTTGETEDDGVEDEYQLEDLEVVTA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFR+AWE+MGPDCERVDEYGLGPR++LAEAVN VINLLGMQPCEGTEVVP 
Sbjct  771  DYILKVGVSNFRSAWESMGPDCERVDEYGLGPRENLAEAVNTVINLLGMQPCEGTEVVPP  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFG+DGPK+VAMKLAVRSED ++SD IHEIVASG
Sbjct  831  NSRSHTCLLSGVFIGNVKVLVRLSFGLDGPKDVAMKLAVRSEDETVSDTIHEIVASG  887



>ref|XP_006423248.1| hypothetical protein CICLE_v10027789mg [Citrus clementina]
 ref|XP_006487154.1| PREDICTED: coatomer subunit gamma-2-like isoform X1 [Citrus sinensis]
 gb|ESR36488.1| hypothetical protein CICLE_v10027789mg [Citrus clementina]
Length=886

 Score =   411 bits (1056),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 206/237 (87%), Positives = 224/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENVTVIVDASEAEEF+E ASKPL+SLP
Sbjct  650  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVTVIVDASEAEEFAEVASKPLRSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ F AFEKPEGVPA+GKFSN LRFIVKEVDP+TG+ E+DGVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQIFGAFEKPEGVPAVGKFSNMLRFIVKEVDPTTGDVEDDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY++KVGVSNFRNAWE++GPD ERVDEYGLGPR+SLAEAV+AVI+LLGMQPCEGTEVV N
Sbjct  770  DYVMKVGVSNFRNAWESIGPDFERVDEYGLGPRESLAEAVSAVISLLGMQPCEGTEVVAN  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRL FGIDGPKEVAMKLAVRSED ++SD IHEIVASG
Sbjct  830  NSRSHTCLLSGVFIGNVKVLVRLQFGIDGPKEVAMKLAVRSEDDNVSDMIHEIVASG  886



>ref|XP_011464120.1| PREDICTED: coatomer subunit gamma [Fragaria vesca subsp. vesca]
Length=886

 Score =   410 bits (1053),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENV V VDASEAE+F+EA SKPL+SLP
Sbjct  650  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVIVAVDASEAEDFTEAGSKPLRSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTF+AFEKPEGVPA+GKFSNTLRFIVKEVDP+TGEAEEDGVEDEYQLEDL+VVAA
Sbjct  710  YDTPGQTFLAFEKPEGVPAVGKFSNTLRFIVKEVDPTTGEAEEDGVEDEYQLEDLDVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LK  V NFR+AWE MGPDCERVDEYGLG R+SL EAV+ VI+LLGMQPCEGTEV+P+
Sbjct  770  DYILKEQVHNFRHAWENMGPDCERVDEYGLGQRESLNEAVSTVISLLGMQPCEGTEVIPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRLSFGID  KEVAMKLAVRSED+++SDAIHEIVASG
Sbjct  830  NSRSHTCLLSGVYIGNVKVLVRLSFGIDSSKEVAMKLAVRSEDVTVSDAIHEIVASG  886



>ref|XP_007131844.1| hypothetical protein PHAVU_011G046000g [Phaseolus vulgaris]
 gb|ESW03838.1| hypothetical protein PHAVU_011G046000g [Phaseolus vulgaris]
Length=887

 Score =   410 bits (1053),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/237 (86%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENV VIVDASEAEEFS+  SKPL+SLP
Sbjct  651  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVIVIVDASEAEEFSDVFSKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEG+P  GKFSN L+FIVKEVDPSTGEAE+DGVEDEYQLED+EVV A
Sbjct  711  YDSPGQTFVAFEKPEGLPVAGKFSNVLKFIVKEVDPSTGEAEDDGVEDEYQLEDMEVVTA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFR AWE+MGPD ERVDEYGLGPR+SLAEAVN VINLLGMQPCEGTE VP 
Sbjct  771  DYILKVGVSNFRGAWESMGPDYERVDEYGLGPRESLAEAVNTVINLLGMQPCEGTETVPP  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFG+DGPK+VAMKL+VRSED ++SD IHEIVASG
Sbjct  831  NSRSHTCLLSGVFIGNVKVLVRLSFGLDGPKDVAMKLSVRSEDETVSDTIHEIVASG  887



>ref|XP_003603909.1| Coatomer subunit gamma [Medicago truncatula]
 gb|AES74160.1| coatomer subunit gamma-like protein [Medicago truncatula]
Length=887

 Score =   409 bits (1052),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/237 (86%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LE+V VIVD SEA+EFSEA SKPLKSLP
Sbjct  651  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLEHVIVIVDNSEADEFSEAFSKPLKSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPEGVP +GKFSN L+FIV+EVDP+TGEAE+DGVEDEYQLEDLE+V+A
Sbjct  711  YDSPGQIFVAFEKPEGVPTLGKFSNVLKFIVREVDPTTGEAEDDGVEDEYQLEDLEIVSA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY LKVGVSNFRNAWE+MGPD ERVDEYGLGPR+SLAEAVN VINLLG+QPCEGTEVVP 
Sbjct  771  DYTLKVGVSNFRNAWESMGPDFERVDEYGLGPRESLAEAVNTVINLLGLQPCEGTEVVPP  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFG+DGPK+VAMKL VRSED ++SDAIHEIVASG
Sbjct  831  NSRSHTCLLSGVFIGNIKVLVRLSFGLDGPKDVAMKLTVRSEDETVSDAIHEIVASG  887



>ref|XP_010096181.1| Coatomer subunit gamma-2 [Morus notabilis]
 gb|EXB63576.1| Coatomer subunit gamma-2 [Morus notabilis]
Length=859

 Score =   408 bits (1049),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 210/237 (89%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVN VKHIFDSHVV QYNCTNTIPEQ LENVTVIVDASEAEEFSE A+KPL+S P
Sbjct  623  AETEYAVNAVKHIFDSHVVIQYNCTNTIPEQLLENVTVIVDASEAEEFSEVATKPLRSFP  682

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQ FVAFEKPEGV A+GKFSN LRFIVKEVD STGEAEEDGVEDEYQLEDLEVVAA
Sbjct  683  YDTPGQIFVAFEKPEGVTAVGKFSNMLRFIVKEVDLSTGEAEEDGVEDEYQLEDLEVVAA  742

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKV VSNFRNAWE+M P+ ERVDEYGLGPR+SLAEAV+AVINLLGMQPCEGTEVVPN
Sbjct  743  DYMLKVPVSNFRNAWESMDPNGERVDEYGLGPRESLAEAVSAVINLLGMQPCEGTEVVPN  802

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHT LLSGVYIG+ KVLVRLSFGID  KEVAMKLAVRSED +ISDAIHE+VASG
Sbjct  803  NSRSHTALLSGVYIGNVKVLVRLSFGIDSSKEVAMKLAVRSEDENISDAIHEVVASG  859



>gb|KHN25367.1| Coatomer subunit gamma [Glycine soja]
Length=887

 Score =   409 bits (1050),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 203/237 (86%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LE+V VIVDASEAEEFSE  SKPL+SLP
Sbjct  651  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLEDVIVIVDASEAEEFSEVFSKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEG+P  GKFSN L+FIVKEVDP+TGE E+DGVEDEYQLEDLEVV A
Sbjct  711  YDSPGQTFVAFEKPEGLPIAGKFSNVLKFIVKEVDPTTGETEDDGVEDEYQLEDLEVVTA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFR+AWE+MGPDCERVDEYGLGPR++LAEAVN VINLLGMQPCEGTEVVP 
Sbjct  771  DYILKVGVSNFRSAWESMGPDCERVDEYGLGPRENLAEAVNTVINLLGMQPCEGTEVVPP  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ K LVRLSFG+DGPK+VAMKLAVRSED ++SD IHEIVASG
Sbjct  831  NSRSHTCLLSGVFIGNVKGLVRLSFGLDGPKDVAMKLAVRSEDETVSDTIHEIVASG  887



>gb|KHN20073.1| Coatomer subunit gamma [Glycine soja]
Length=882

 Score =   408 bits (1049),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 200/237 (84%), Positives = 224/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNV+KHIFD HVVFQYNCTNTIPEQ LE+V V VDAS+A+EFSE  SKPL+SLP
Sbjct  646  AETEYAVNVIKHIFDRHVVFQYNCTNTIPEQLLEHVIVTVDASDADEFSEVFSKPLRSLP  705

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVP +GKFSN L+FIVKEVDP+TGEAE+DGVEDEYQLEDLE+VAA
Sbjct  706  YDSPGQTFVAFEKPEGVPTVGKFSNILKFIVKEVDPTTGEAEDDGVEDEYQLEDLEIVAA  765

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE++GPD ERVDEYGLGPR+SLAEAVN VINLLG++PCEGTE VP 
Sbjct  766  DYVLKVGVSNFRNAWESLGPDFERVDEYGLGPRESLAEAVNTVINLLGLEPCEGTEEVPP  825

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+AKVLVRLSFG+DGPK+VAMKL+VRSED ++SDAIHEIVASG
Sbjct  826  NSRSHTCLLSGVFIGNAKVLVRLSFGLDGPKDVAMKLSVRSEDETVSDAIHEIVASG  882



>ref|XP_004507423.1| PREDICTED: coatomer subunit gamma-like [Cicer arietinum]
Length=884

 Score =   407 bits (1046),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 201/237 (85%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD+HVVFQYNC NTIPEQ LE+V VIVDASEAEEFS+  SKPL+SLP
Sbjct  648  AETEYAVNVVKHIFDTHVVFQYNCINTIPEQLLEDVIVIVDASEAEEFSQVFSKPLRSLP  707

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKP+G PA GKFSN L+FIVKEVDP++GEAE+DGVEDEYQLEDLEVVAA
Sbjct  708  YDSPGQTFVAFEKPDGSPATGKFSNILKFIVKEVDPTSGEAEDDGVEDEYQLEDLEVVAA  767

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKV VSNFRNAWE++GPDCERVDEYGLGPR+SL+EAVN VINLLGMQPCEGTEVVP 
Sbjct  768  DYILKVPVSNFRNAWESLGPDCERVDEYGLGPRESLSEAVNTVINLLGMQPCEGTEVVPP  827

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG  KVLVRLSFG+DG K+VAMKLAVRS+D ++SDAIHEIVASG
Sbjct  828  NSRSHTCLLSGVFIGDVKVLVRLSFGLDGAKDVAMKLAVRSDDETVSDAIHEIVASG  884



>gb|KHN39778.1| Coatomer subunit gamma-2 [Glycine soja]
Length=887

 Score =   407 bits (1045),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LE+V VIVDASEAEEFSE  SKPL+SLP
Sbjct  651  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLEDVIVIVDASEAEEFSEVFSKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFV FEKPEG+   GKFSN L+FIVKEVDP+TGE E+DGVEDEYQLEDLEVV A
Sbjct  711  YDSPGQTFVGFEKPEGLSIAGKFSNVLKFIVKEVDPTTGETEDDGVEDEYQLEDLEVVTA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFR+AWE++GPDCERVDEYGLGPR+SLAEAVN VINLLGMQPCEGTEVVP 
Sbjct  771  DYMLKVGVSNFRSAWESIGPDCERVDEYGLGPRESLAEAVNTVINLLGMQPCEGTEVVPP  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFG+DGPK+VAMKL+VRSED ++SD IHEIVASG
Sbjct  831  NSRSHTCLLSGVFIGNVKVLVRLSFGLDGPKDVAMKLSVRSEDETVSDTIHEIVASG  887



>ref|XP_003537872.1| PREDICTED: coatomer subunit gamma-2-like [Glycine max]
Length=887

 Score =   406 bits (1044),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LE+V VIVDASEAEEFSE  SKPL+SLP
Sbjct  651  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLEDVIVIVDASEAEEFSEVFSKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFV FEKPEG+   GKFSN L+FIVKEVDP+TGE E+DGVEDEYQLEDLEVV A
Sbjct  711  YDSPGQTFVGFEKPEGLSIAGKFSNVLKFIVKEVDPTTGETEDDGVEDEYQLEDLEVVTA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFR+AWE++GPDCERVDEYGLGPR+SLAEAVN VINLLGMQPCEGTEVVP 
Sbjct  771  DYMLKVGVSNFRSAWESIGPDCERVDEYGLGPRESLAEAVNTVINLLGMQPCEGTEVVPP  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFG+DGPK+VAMKL+VRSED ++SD IHEIVASG
Sbjct  831  NSRSHTCLLSGVFIGNVKVLVRLSFGLDGPKDVAMKLSVRSEDETVSDTIHEIVASG  887



>ref|XP_003527225.1| PREDICTED: coatomer subunit gamma-like [Glycine max]
Length=882

 Score =   406 bits (1044),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 223/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNV+KHIFD HVVFQYNCTNTIPEQ LE+V V VDAS+A+EFSE  SKPL+SLP
Sbjct  646  AETEYAVNVIKHIFDRHVVFQYNCTNTIPEQLLEHVIVTVDASDADEFSEVFSKPLRSLP  705

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVP +GKFSN L+FIVKEVDP+TGEAE+DGVEDEYQLEDLE+VAA
Sbjct  706  YDSPGQTFVAFEKPEGVPTVGKFSNILKFIVKEVDPTTGEAEDDGVEDEYQLEDLEIVAA  765

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE++GPD ERVDEYGLGPR+SLAEAVN VINLLG++PCEGTE VP 
Sbjct  766  DYVLKVGVSNFRNAWESLGPDFERVDEYGLGPRESLAEAVNTVINLLGLEPCEGTEEVPP  825

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFG+DGPK+VAMKL+VRSED ++SDAIHEIVASG
Sbjct  826  NSRSHTCLLSGVFIGNVKVLVRLSFGLDGPKDVAMKLSVRSEDETVSDAIHEIVASG  882



>ref|XP_010065395.1| PREDICTED: coatomer subunit gamma [Eucalyptus grandis]
 gb|KCW62849.1| hypothetical protein EUGRSUZ_G00444 [Eucalyptus grandis]
Length=887

 Score =   405 bits (1041),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            A TEYAVNVVKHIFDSHV+FQYNCTNTIPE  LENV VIVD+S+AEEFSE ASKPL+SLP
Sbjct  651  AGTEYAVNVVKHIFDSHVLFQYNCTNTIPEVLLENVAVIVDSSDAEEFSEVASKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKP+GVPA+GKFSN L+FIVKEVD  TGEAEEDGVEDEYQLEDLEVVAA
Sbjct  711  YDSPGQTFVAFEKPDGVPAVGKFSNMLKFIVKEVDLPTGEAEEDGVEDEYQLEDLEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+MG D ERVDEYGLG R+SL EA+NAVI+LLGMQPCEGTEVVP+
Sbjct  771  DYMLKVGVSNFRNAWESMGADFERVDEYGLGSRESLTEAMNAVIDLLGMQPCEGTEVVPS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSH+CLLSGVYIG+ KVLVRLSFGIDG ++VAMKLAVRSED S+SDAIHEIVASG
Sbjct  831  NSRSHSCLLSGVYIGNVKVLVRLSFGIDGQRDVAMKLAVRSEDESVSDAIHEIVASG  887



>ref|XP_008783467.1| PREDICTED: coatomer subunit gamma-2 [Phoenix dactylifera]
Length=886

 Score =   404 bits (1038),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 224/237 (95%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+D HVVFQYNCTNTIPEQ LENVTV VDASEAEEFSE ASKPL++LP
Sbjct  650  AETEYAVNVVKHIYDGHVVFQYNCTNTIPEQLLENVTVFVDASEAEEFSEVASKPLRTLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ+FVAFEKPEGVPA+GKFSN L+FIVKEVDP+TGEA+E+GVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQSFVAFEKPEGVPAVGKFSNLLKFIVKEVDPATGEADEEGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNF+NAW+ MG DCERVDEYGLG R+SLAEAV+A IN+LGMQ CEGT+VVP+
Sbjct  770  DYMLKVGVSNFKNAWDNMGADCERVDEYGLGVRESLAEAVSAAINILGMQTCEGTDVVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG+ KVL R+SFGIDGPK+VAMKLAVRSED ++SDAIHEIVA+G
Sbjct  830  NARSHTCLLSGVFIGNVKVLARISFGIDGPKQVAMKLAVRSEDQAVSDAIHEIVANG  886



>gb|EYU42621.1| hypothetical protein MIMGU_mgv1a001108mg [Erythranthe guttata]
Length=888

 Score =   404 bits (1037),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSHVVFQYNCTNTI EQ LENVTV+VDASEAEEFSE  +KP+KSLP
Sbjct  652  AETEYAVNVVKHIFDSHVVFQYNCTNTIAEQLLENVTVVVDASEAEEFSEVGTKPIKSLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTP QTFVA+EKPEG+PAIGKFSNTLRF VKEVD STGEAE+DGVEDEYQLED EVVAA
Sbjct  712  YDTPAQTFVAYEKPEGIPAIGKFSNTLRFTVKEVDTSTGEAEDDGVEDEYQLEDFEVVAA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNF+NAWE+M  + ERVDEYGLG R+SL EAVNAVINLLGMQPCEGTEVV +
Sbjct  772  DYILKVGVSNFKNAWESMDAESERVDEYGLGARESLTEAVNAVINLLGMQPCEGTEVVTS  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVYIG+ KVLVRLSFGIDG K+VAMKLAVRS+D+++SD IHEIVASG
Sbjct  832  NSRSHTCLLSGVYIGNVKVLVRLSFGIDGSKDVAMKLAVRSDDVNVSDVIHEIVASG  888



>ref|XP_010028581.1| PREDICTED: coatomer subunit gamma [Eucalyptus grandis]
 gb|KCW55343.1| hypothetical protein EUGRSUZ_I01263 [Eucalyptus grandis]
Length=887

 Score =   403 bits (1036),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 204/237 (86%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HV+FQYNCTNTIPEQ LENVTV+VDASEAEEFSE ASKPLKSLP
Sbjct  651  AETEYAVNVVKHIFDHHVLFQYNCTNTIPEQLLENVTVVVDASEAEEFSEVASKPLKSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEK +GVPA+GKFSN L+FIVKEVDP+TGEAEEDGVEDEYQLEDLEVVAA
Sbjct  711  YDSPGQTFVAFEKTDGVPAVGKFSNVLKFIVKEVDPTTGEAEEDGVEDEYQLEDLEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM KVGVSNFRNAWE+M P+ ERVDEYGLG R+SLAEAVNAV+NLLGMQPCEGTE VP+
Sbjct  771  DYMQKVGVSNFRNAWESMDPEGERVDEYGLGSRESLAEAVNAVMNLLGMQPCEGTEAVPS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGI G  EVAMKLAVRSED ++S+ IHEIVASG
Sbjct  831  NSRSHTCLLSGVFIGNVKVLVRLSFGISGQNEVAMKLAVRSEDENVSNTIHEIVASG  887



>ref|XP_011048664.1| PREDICTED: coatomer subunit gamma-like isoform X2 [Populus euphratica]
Length=885

 Score =   403 bits (1036),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENV+VIVD+SEA+ F+E ASKPL+SLP
Sbjct  649  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVSVIVDSSEADNFAEVASKPLQSLP  708

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFEKPEG+ A+GKFSNTLRFIVKEVDP+TGEAEEDGVEDEYQLEDLEVVAA
Sbjct  709  YDTPGQTFVAFEKPEGITAVGKFSNTLRFIVKEVDPTTGEAEEDGVEDEYQLEDLEVVAA  768

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE+MG D E VDEYGLGPR++LAEAV AVINLLGMQPCEGTEVV  
Sbjct  769  DYMMKVGVSNFRNAWESMGDDFEHVDEYGLGPRENLAEAVIAVINLLGMQPCEGTEVVAT  828

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV++G+ +VLVRL FGI G ++VAMKLAVRSED ++SD IHEIV+SG
Sbjct  829  NSRSHTCLLSGVFLGNVRVLVRLQFGIHGSRDVAMKLAVRSEDEAVSDTIHEIVSSG  885



>ref|XP_011048655.1| PREDICTED: coatomer subunit gamma-like isoform X1 [Populus euphratica]
Length=886

 Score =   403 bits (1035),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENV+VIVD+SEA+ F+E ASKPL+SLP
Sbjct  650  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVSVIVDSSEADNFAEVASKPLQSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFEKPEG+ A+GKFSNTLRFIVKEVDP+TGEAEEDGVEDEYQLEDLEVVAA
Sbjct  710  YDTPGQTFVAFEKPEGITAVGKFSNTLRFIVKEVDPTTGEAEEDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE+MG D E VDEYGLGPR++LAEAV AVINLLGMQPCEGTEVV  
Sbjct  770  DYMMKVGVSNFRNAWESMGDDFEHVDEYGLGPRENLAEAVIAVINLLGMQPCEGTEVVAT  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV++G+ +VLVRL FGI G ++VAMKLAVRSED ++SD IHEIV+SG
Sbjct  830  NSRSHTCLLSGVFLGNVRVLVRLQFGIHGSRDVAMKLAVRSEDEAVSDTIHEIVSSG  886



>ref|XP_003606893.1| Coatomer subunit gamma [Medicago truncatula]
 gb|AES89090.1| coatomer subunit gamma-like protein [Medicago truncatula]
Length=885

 Score =   402 bits (1034),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD+HVVFQYNCTNTIPEQ LE+V V+VDASEAEEFS+  SKPL+SLP
Sbjct  649  AETEYAVNVVKHIFDTHVVFQYNCTNTIPEQLLEDVIVVVDASEAEEFSQVISKPLRSLP  708

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPEG+P  GKFSN LRFIVKEVDP++GEAE+DGVEDEYQLEDLEVVAA
Sbjct  709  YDSPGQIFVAFEKPEGLPTSGKFSNILRFIVKEVDPTSGEAEDDGVEDEYQLEDLEVVAA  768

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE+M PD ERVDEYGLGPR+ L+EAVN VI LLGMQPCEGTEVVP 
Sbjct  769  DYILKVGVSNFRNAWESMDPDSERVDEYGLGPREGLSEAVNTVITLLGMQPCEGTEVVPP  828

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG  KVLVRLSFG+DG K+VAMKLAVRS+D+++SDAIHEIVASG
Sbjct  829  NSRSHTCLLSGVFIGGVKVLVRLSFGLDGAKDVAMKLAVRSDDVTVSDAIHEIVASG  885



>ref|XP_008236878.1| PREDICTED: coatomer subunit gamma [Prunus mume]
Length=886

 Score =   402 bits (1034),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 203/236 (86%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LENV V VDASEAEEFSE ASKPL SLPY
Sbjct  651  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLENVIVAVDASEAEEFSEVASKPLASLPY  710

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
            DTPGQTF+AFE+PEGVPA+GKFSNTLRFIVKEVDP+TGEAEEDGVEDEYQLEDLEVV AD
Sbjct  711  DTPGQTFLAFERPEGVPAVGKFSNTLRFIVKEVDPTTGEAEEDGVEDEYQLEDLEVVPAD  770

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            Y+LKV V NFRNAWE+MGPD ER+DEYGLG R+SL EAVN VINLLG+QPCEGTEV+ +N
Sbjct  771  YILKVPVFNFRNAWESMGPDFERIDEYGLGQRESLTEAVNTVINLLGLQPCEGTEVLASN  830

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            SRSHTCLLSGVYIG+ KVLVRLSFGID  +EVAMKLAVRSED ++SDAIHEIV SG
Sbjct  831  SRSHTCLLSGVYIGNVKVLVRLSFGIDSSREVAMKLAVRSEDEAVSDAIHEIVGSG  886



>ref|XP_007200317.1| hypothetical protein PRUPE_ppa001186mg [Prunus persica]
 gb|EMJ01516.1| hypothetical protein PRUPE_ppa001186mg [Prunus persica]
Length=886

 Score =   402 bits (1033),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 203/236 (86%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LENV V VDASEAEEFSE ASKPL SLPY
Sbjct  651  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLENVIVAVDASEAEEFSEVASKPLASLPY  710

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
            DTPGQTF+AFE+PEGVPA+GKFSNTLRFIVKEVDP+TGEAEEDGVEDEYQLEDLEVV AD
Sbjct  711  DTPGQTFLAFERPEGVPAVGKFSNTLRFIVKEVDPTTGEAEEDGVEDEYQLEDLEVVPAD  770

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            Y+LKV V NFRNAWE+MGPD ER+DEYGLG R+SL EAVN VINLLG+QPCEGTEV+ +N
Sbjct  771  YILKVPVFNFRNAWESMGPDFERIDEYGLGQRESLTEAVNTVINLLGLQPCEGTEVLASN  830

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            SRSHTCLLSGVYIG+ KVLVRLSFGID  +EVAMKLAVRSED ++SDAIHEIV SG
Sbjct  831  SRSHTCLLSGVYIGNVKVLVRLSFGIDSSREVAMKLAVRSEDEAVSDAIHEIVGSG  886



>emb|CDO97061.1| unnamed protein product [Coffea canephora]
Length=889

 Score =   402 bits (1032),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 203/237 (86%), Positives = 218/237 (92%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD+HVV QYNCTNTIPEQ LENV V+VDAS+AEEF+E ASKPL+SLP
Sbjct  653  AETEYAVNVVKHIFDNHVVLQYNCTNTIPEQLLENVIVVVDASDAEEFAEIASKPLRSLP  712

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP GVPA+GKFSN LRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA
Sbjct  713  YDSPGQIFVAFEKPGGVPAVGKFSNVLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  772

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNF+NAWE+MG D ER++EYGLGPRDSL EAVNAVI+LLGMQPCEGTEVV  
Sbjct  773  DYMLKVGVSNFKNAWESMGSDFERLEEYGLGPRDSLTEAVNAVISLLGMQPCEGTEVVAT  832

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGID  KEVAMKL VRSED S+  AIHEIVASG
Sbjct  833  NSRSHTCLLSGVFIGNVKVLVRLSFGIDAQKEVAMKLVVRSEDESVCVAIHEIVASG  889



>gb|KHN33760.1| Coatomer subunit gamma [Glycine soja]
Length=886

 Score =   402 bits (1032),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 195/237 (82%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNV+KHIFD HVVFQYNCTNTIPEQ LE+V V VDAS+A+EFSE  SKPL+SLP
Sbjct  650  AETEYAVNVIKHIFDRHVVFQYNCTNTIPEQLLEDVIVTVDASDADEFSEVFSKPLRSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVP +GKFSN L+FI+KEVDP+TGEAE+DGVEDEYQLEDLE+VAA
Sbjct  710  YDSPGQTFVAFEKPEGVPTVGKFSNVLKFIIKEVDPTTGEAEDDGVEDEYQLEDLEIVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE++GPD ERVDEYGLGPR+SLAEAVN VINLLG++PCEGTE VP 
Sbjct  770  DYVLKVGVSNFRNAWESLGPDFERVDEYGLGPRESLAEAVNTVINLLGLEPCEGTEEVPP  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+ G+ KVLVRLSFG+DGPK++AMKL+VRSED ++SD IHEIVASG
Sbjct  830  NSRSHTCLLSGVFTGNIKVLVRLSFGLDGPKDIAMKLSVRSEDETVSDTIHEIVASG  886



>ref|XP_003522954.1| PREDICTED: coatomer subunit gamma-like [Glycine max]
Length=886

 Score =   401 bits (1031),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 195/237 (82%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNV+KHIFD HVVFQYNCTNTIPEQ LE+V V VDAS+A+EFSE  SKPL+SLP
Sbjct  650  AETEYAVNVIKHIFDRHVVFQYNCTNTIPEQLLEDVIVTVDASDADEFSEVFSKPLRSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVP +GKFSN L+FI+KEVDP+TGEAE+DGVEDEYQLEDLE+VAA
Sbjct  710  YDSPGQTFVAFEKPEGVPTVGKFSNVLKFIIKEVDPTTGEAEDDGVEDEYQLEDLEIVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE++GPD ERVDEYGLGPR+SLAEAVN VINLLG++PCEGTE VP 
Sbjct  770  DYVLKVGVSNFRNAWESLGPDFERVDEYGLGPRESLAEAVNTVINLLGLEPCEGTEEVPP  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+ G+ KVLVRLSFG+DGPK++AMKL+VRSED ++SD IHEIVASG
Sbjct  830  NSRSHTCLLSGVFTGNIKVLVRLSFGLDGPKDIAMKLSVRSEDETVSDTIHEIVASG  886



>gb|EPS63349.1| coatomer subunit gamma [Genlisea aurea]
Length=887

 Score =   401 bits (1031),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 198/237 (84%), Positives = 219/237 (92%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIFD HVVFQ+NCTNTIPEQ LENV VIVDASEAEEFSE  +K LKSLP
Sbjct  651  AETEYSVNVVKHIFDQHVVFQFNCTNTIPEQLLENVVVIVDASEAEEFSEVGTKVLKSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTP Q FVAF+KPE VPA+GKFSN L+F VKEVDPSTGEAE+DGVEDEYQLED EVV+A
Sbjct  711  YDTPAQAFVAFDKPESVPAVGKFSNLLKFTVKEVDPSTGEAEDDGVEDEYQLEDFEVVSA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE +GPD ER+DEYGLGPR+SL+EAVN VINLLGMQPCEGTEVV +
Sbjct  771  DYILKVGVSNFRNAWEALGPDGERIDEYGLGPRESLSEAVNVVINLLGMQPCEGTEVVAS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGVY+G+ KVLVRLSFGIDG KEVAMKLAVRSED+++SDAIH+I+ASG
Sbjct  831  NSRSHTCLLSGVYMGNVKVLVRLSFGIDGAKEVAMKLAVRSEDIAVSDAIHDIIASG  887



>ref|XP_011037539.1| PREDICTED: coatomer subunit gamma [Populus euphratica]
Length=885

 Score =   400 bits (1029),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 220/235 (94%), Gaps = 0/235 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENV+VIVDASEA+EF+E ASKPL+SLP
Sbjct  649  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVSVIVDASEADEFAEVASKPLRSLP  708

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFEKPEG+ A+GKF+N LRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA
Sbjct  709  YDTPGQTFVAFEKPEGITAVGKFTNMLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  768

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            D+M+KVGVSNFRNAWE+MG D ERVDEYGLGPR+SLAEAV+AVINLLGMQPCEGTEVV  
Sbjct  769  DFMMKVGVSNFRNAWESMGEDFERVDEYGLGPRESLAEAVSAVINLLGMQPCEGTEVVAT  828

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVA  237
            NSRSHTCLLSGV +G+ KVLVRL FGI+G ++VAMKL+VRSED +I DAIHEIV+
Sbjct  829  NSRSHTCLLSGVSLGNVKVLVRLQFGIEGTRDVAMKLSVRSEDEAIGDAIHEIVS  883



>ref|XP_007136172.1| hypothetical protein PHAVU_009G024100g [Phaseolus vulgaris]
 gb|ESW08166.1| hypothetical protein PHAVU_009G024100g [Phaseolus vulgaris]
Length=887

 Score =   399 bits (1026),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 198/237 (84%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNV+KHIFD HVVFQYNCTNTI EQ LE+V V VDASEA+EFSE  SKP++SLP
Sbjct  651  AETEYAVNVIKHIFDRHVVFQYNCTNTIAEQLLEDVIVNVDASEADEFSEVFSKPIRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+P QTFVAFEKPEGV A+GKFSN L+FIVKEVDP+TGEAE+DGVEDEYQLEDLEVVAA
Sbjct  711  YDSPAQTFVAFEKPEGVSAVGKFSNILKFIVKEVDPTTGEAEDDGVEDEYQLEDLEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE++GPD ERVDEYGLGPR+SLAEAVN VINLLG+QPCEGTE VP 
Sbjct  771  DYVLKVGVSNFRNAWESLGPDFERVDEYGLGPRESLAEAVNTVINLLGLQPCEGTEEVPP  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFG+DGPK+VAMKL+VRSED ++SDA+HEIVASG
Sbjct  831  NSRSHTCLLSGVFIGNVKVLVRLSFGLDGPKDVAMKLSVRSEDETVSDAVHEIVASG  887



>ref|XP_002305424.1| hypothetical protein POPTR_0004s16090g [Populus trichocarpa]
 gb|EEE85935.1| hypothetical protein POPTR_0004s16090g [Populus trichocarpa]
Length=885

 Score =   399 bits (1024),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 219/235 (93%), Gaps = 0/235 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENV+VIVDASEA++F+E ASKPL+SLP
Sbjct  649  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVSVIVDASEADDFAEVASKPLRSLP  708

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFEKPEG+  +GKF+N LRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA
Sbjct  709  YDTPGQTFVAFEKPEGITTVGKFTNMLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  768

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            D+M+KVGVSNFRNAWE+MG D ERVDEYGLGPR+SLAEAV+AVINLLGMQPCEGTEVV  
Sbjct  769  DFMMKVGVSNFRNAWESMGDDFERVDEYGLGPRESLAEAVSAVINLLGMQPCEGTEVVAT  828

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVA  237
            NSRSHTCLLSGV +G+ KVLVRL FGI+G ++VAMKL+VRSED +I DAIHEIV+
Sbjct  829  NSRSHTCLLSGVSLGNVKVLVRLQFGIEGSRDVAMKLSVRSEDEAIGDAIHEIVS  883



>ref|XP_002313799.1| hypothetical protein POPTR_0009s11800g [Populus trichocarpa]
 gb|EEE87754.1| hypothetical protein POPTR_0009s11800g [Populus trichocarpa]
Length=886

 Score =   399 bits (1024),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 196/237 (83%), Positives = 219/237 (92%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENV+VIVD+SEA+ F+E ASKPL+SLP
Sbjct  650  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVSVIVDSSEADNFAEVASKPLRSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQTFVAFEKP+G+ A+GKFSNTLRFIVKEVDP+TGEAEEDGVEDEYQLEDLEVVAA
Sbjct  710  YDTPGQTFVAFEKPKGITAVGKFSNTLRFIVKEVDPTTGEAEEDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE+MG + E VDEYGLGPR++LAEAV AVINLLGMQPCEGTEVV  
Sbjct  770  DYMMKVGVSNFRNAWESMGDEFEHVDEYGLGPRENLAEAVIAVINLLGMQPCEGTEVVAT  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV++G+ +VL RL FGI G ++VAMKLAVRSED ++SD IHEIV+SG
Sbjct  830  NSRSHTCLLSGVFLGNVRVLARLQFGIHGSRDVAMKLAVRSEDEAVSDTIHEIVSSG  886



>ref|XP_010942029.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Elaeis guineensis]
Length=886

 Score =   398 bits (1022),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 198/237 (84%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+D HVVFQYNCTNTIPEQ LENVTV VDASEAEEFSE ASKPLK+LP
Sbjct  650  AETEYAVNVVKHIYDGHVVFQYNCTNTIPEQLLENVTVFVDASEAEEFSEVASKPLKTLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ+FVAFEKPEGVPA+GKFSN L+FIVKEVD +TGEA+E+GVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQSFVAFEKPEGVPAVGKFSNLLKFIVKEVDSTTGEADEEGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            +YMLKVGVSNF++AW+ MG DCERVDEYGLG R+SLAEAV+AVIN+LGMQ CEGT+VVP+
Sbjct  770  EYMLKVGVSNFKHAWDNMGADCERVDEYGLGVRESLAEAVSAVINILGMQACEGTDVVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG+ KVL R+SFGIDGPK+VAMKLAVRSED  +SD IHEIVASG
Sbjct  830  NARSHTCLLSGVFIGNVKVLARISFGIDGPKQVAMKLAVRSEDQVVSDTIHEIVASG  886



>ref|XP_010942028.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Elaeis guineensis]
Length=887

 Score =   398 bits (1022),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 198/237 (84%), Positives = 222/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+D HVVFQYNCTNTIPEQ LENVTV VDASEAEEFSE ASKPLK+LP
Sbjct  651  AETEYAVNVVKHIYDGHVVFQYNCTNTIPEQLLENVTVFVDASEAEEFSEVASKPLKTLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ+FVAFEKPEGVPA+GKFSN L+FIVKEVD +TGEA+E+GVEDEYQLEDLEVVAA
Sbjct  711  YDSPGQSFVAFEKPEGVPAVGKFSNLLKFIVKEVDSTTGEADEEGVEDEYQLEDLEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            +YMLKVGVSNF++AW+ MG DCERVDEYGLG R+SLAEAV+AVIN+LGMQ CEGT+VVP+
Sbjct  771  EYMLKVGVSNFKHAWDNMGADCERVDEYGLGVRESLAEAVSAVINILGMQACEGTDVVPS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG+ KVL R+SFGIDGPK+VAMKLAVRSED  +SD IHEIVASG
Sbjct  831  NARSHTCLLSGVFIGNVKVLARISFGIDGPKQVAMKLAVRSEDQVVSDTIHEIVASG  887



>ref|XP_009412267.1| PREDICTED: coatomer subunit gamma-2 [Musa acuminata subsp. malaccensis]
Length=887

 Score =   397 bits (1021),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENVTV VDASEAEEFSE  +KPL+SLPY
Sbjct  652  ETEYAVNVVKHIFDGHVVFQYNCTNTIPEQLLENVTVFVDASEAEEFSEVLTKPLRSLPY  711

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
            D+PGQTFVAFEKPEGVPAIGKFSN L+F+VKEVDP+TGEA+E+GVEDEYQLEDLE+VAAD
Sbjct  712  DSPGQTFVAFEKPEGVPAIGKFSNLLKFVVKEVDPATGEADEEGVEDEYQLEDLEIVAAD  771

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            YMLKVGVSNF+NAWE + PD ER+DEYGLG ++SLAE V+AVI++LGMQPCEGTEVVPNN
Sbjct  772  YMLKVGVSNFKNAWENLDPDNERIDEYGLGVKESLAETVSAVIDILGMQPCEGTEVVPNN  831

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            SRSHTCLLSG++IG+ KVLVR+SFGIDG K+VAMKLAVRSED  IS+ IHEIVA G
Sbjct  832  SRSHTCLLSGIFIGNVKVLVRVSFGIDGSKQVAMKLAVRSEDPDISEKIHEIVAEG  887



>ref|XP_010690898.1| PREDICTED: coatomer subunit gamma [Beta vulgaris subsp. vulgaris]
Length=886

 Score =   397 bits (1020),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/237 (83%), Positives = 223/237 (94%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKH++D H+VFQYNCTNTIPEQ LE+VTV+V+ASEAEEF+E ASK LKSLP
Sbjct  650  AETEYAVNVVKHVYDGHIVFQYNCTNTIPEQLLEDVTVVVEASEAEEFAEIASKHLKSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTPGQT+VAFEKPEGVPA+GKFSNTLRF +KEVDPSTG+ E+DGVE++YQLEDLEVVAA
Sbjct  710  YDTPGQTYVAFEKPEGVPAVGKFSNTLRFFMKEVDPSTGDVEDDGVEEDYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE++G D E+VDEYGLGPR++L+EAVNAVINLLG+QPCEGTEVVPN
Sbjct  770  DYMLKVGVSNFRNAWESIGADFEKVDEYGLGPRENLSEAVNAVINLLGLQPCEGTEVVPN  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRL FG+D  +EVAMKLAVRSED ++SD IHEIVASG
Sbjct  830  NSRSHTCLLSGVFIGNVKVLVRLQFGLDSSREVAMKLAVRSEDEAVSDTIHEIVASG  886



>ref|XP_008787310.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit gamma-2-like 
[Phoenix dactylifera]
Length=886

 Score =   394 bits (1013),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/237 (83%), Positives = 220/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+D HVVFQYNCTNTIPEQ LENVTV VDASEAEEFSE ASKPLK+LP
Sbjct  650  AETEYAVNVVKHIYDGHVVFQYNCTNTIPEQLLENVTVFVDASEAEEFSEVASKPLKTLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ+FVAFEKPEGVPA+GKFSN L+FIVKEVDPS GEA+E+GVEDEYQLED EVV+A
Sbjct  710  YDSPGQSFVAFEKPEGVPAVGKFSNLLKFIVKEVDPSMGEADEEGVEDEYQLEDFEVVSA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGV NF++AW+ MG DCERVDEYGLG R+SLAEAV+AVIN+LGMQ CEGT+VVP+
Sbjct  770  DYMLKVGVXNFKHAWDNMGADCERVDEYGLGVRESLAEAVSAVINILGMQACEGTDVVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
             +RSHT LLSGV+IG+ KVL R+SFGIDGPK+VAMKLAVRSED ++SDAIHEIVASG
Sbjct  830  TARSHTSLLSGVFIGNVKVLARISFGIDGPKQVAMKLAVRSEDQAVSDAIHEIVASG  886



>ref|XP_006658376.1| PREDICTED: coatomer subunit gamma-2-like [Oryza brachyantha]
Length=889

 Score =   393 bits (1010),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 197/237 (83%), Positives = 219/237 (92%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHI+D+HVV QYNCTNTIPEQ LE V V VDASEA+EFSE ASK LKSLP
Sbjct  653  AETEYSVNVVKHIYDAHVVLQYNCTNTIPEQLLEEVVVFVDASEADEFSEVASKSLKSLP  712

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVPA GKFSN L+FIVKEVDPSTGEA++DGVEDEYQLEDLE+ +A
Sbjct  713  YDSPGQTFVAFEKPEGVPATGKFSNILKFIVKEVDPSTGEADDDGVEDEYQLEDLEIASA  772

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGT+VVP+
Sbjct  773  DYMLKVGVSNFRNAWESMDPESERVDEYGLGVRESLAEAVSAVISILGMQPCEGTDVVPS  832

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGI GPKEVAMKLAVRS+D  ISD IHEIVA+G
Sbjct  833  NSRSHTCLLSGVFIGNVKVLVRLSFGISGPKEVAMKLAVRSDDPEISDKIHEIVANG  889



>ref|XP_004148851.1| PREDICTED: coatomer subunit gamma-like [Cucumis sativus]
 ref|XP_004167678.1| PREDICTED: coatomer subunit gamma-like [Cucumis sativus]
 gb|KGN61788.1| hypothetical protein Csa_2G245520 [Cucumis sativus]
Length=887

 Score =   393 bits (1009),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 195/237 (82%), Positives = 216/237 (91%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LENV VIVDASEAEEFSE  SKPL+SLP
Sbjct  651  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVNVIVDASEAEEFSEVVSKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            Y++PGQTFVAFEKP+GV A+GKFSN L+FIVKE+DPSTGEAE+DGVEDEYQLED+EVVAA
Sbjct  711  YNSPGQTFVAFEKPDGVAAVGKFSNMLKFIVKEIDPSTGEAEDDGVEDEYQLEDVEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKV VSNFRNAWE+MG D ERVDEYGLGPR SLAEAV AVI+LLGMQPCEGTEVVP 
Sbjct  771  DYMLKVAVSNFRNAWESMGEDGERVDEYGLGPRGSLAEAVRAVIDLLGMQPCEGTEVVPA  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N RSHTCLLSG++IG+ KVL RLSFG+D  +EVAMKL VRS+D ++SD IHEI++SG
Sbjct  831  NLRSHTCLLSGIFIGNVKVLARLSFGLDASREVAMKLVVRSDDEAVSDLIHEIISSG  887



>ref|XP_010942771.1| PREDICTED: coatomer subunit gamma-2-like [Elaeis guineensis]
Length=888

 Score =   392 bits (1008),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 197/237 (83%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEYAVNVVKHI+D HVVFQYNCTNTIPEQ LE+VTV VDASEAEEFSE ASKPL++L 
Sbjct  652  SETEYAVNVVKHIYDGHVVFQYNCTNTIPEQLLESVTVFVDASEAEEFSEVASKPLRTLH  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ+FVAFEKPEGVPA+GKFSN L+FIVKEVDP+TGEA+E+GVEDEYQLEDLEVVAA
Sbjct  712  YDSPGQSFVAFEKPEGVPAVGKFSNLLKFIVKEVDPATGEADEEGVEDEYQLEDLEVVAA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNF+NAW+ MG D ERVDEYGLG R+SLAEAV+AVIN+LGMQ CEGT+VVP+
Sbjct  772  DYMLKVGVSNFKNAWDNMGVDRERVDEYGLGVRESLAEAVSAVINILGMQACEGTDVVPS  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG  KVL R+SFGIDGPK+VAMKLAVRSED SISD IHEIVA+G
Sbjct  832  NARSHTCLLSGVFIGDVKVLARISFGIDGPKQVAMKLAVRSEDQSISDTIHEIVANG  888



>ref|XP_009345731.1| PREDICTED: coatomer subunit gamma-like [Pyrus x bretschneideri]
Length=886

 Score =   392 bits (1006),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 201/237 (85%), Positives = 220/237 (93%), Gaps = 1/237 (0%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LE+V V+VDASEAEEFSE AS+ L+SLPY
Sbjct  650  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLEDVIVVVDASEAEEFSEVASRSLRSLPY  709

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
            DTPGQTF+AFEKPEGVPA+GKF+N LRFIVKEVDP+TGEAEEDGVEDEYQLEDLEVVAAD
Sbjct  710  DTPGQTFLAFEKPEGVPAVGKFTNLLRFIVKEVDPTTGEAEEDGVEDEYQLEDLEVVAAD  769

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            Y+LKV V NF+NAWE+MG D ERVDEYGLGPR++L EAVNAVI+LLGMQPCEGTEVV +N
Sbjct  770  YILKVPVFNFKNAWESMGADFERVDEYGLGPRENLTEAVNAVISLLGMQPCEGTEVVASN  829

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGID-GPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            SRSHTC+LSGVYIG+ KVLVRL FGID   KEVAMKLAVRSED ++SDAIHEIVASG
Sbjct  830  SRSHTCVLSGVYIGNVKVLVRLLFGIDSSSKEVAMKLAVRSEDGAVSDAIHEIVASG  886



>ref|XP_009374177.1| PREDICTED: coatomer subunit gamma [Pyrus x bretschneideri]
Length=886

 Score =   391 bits (1005),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 200/237 (84%), Positives = 219/237 (92%), Gaps = 1/237 (0%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LE+V V+VDASEAEEFSE AS+ L+SLPY
Sbjct  650  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLEDVIVVVDASEAEEFSEVASRSLRSLPY  709

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
            DTPGQTF+AFEKPEGVPA+GKF+N LRFIVKEVDP+TGEAEEDGVEDEYQLEDLEVVAAD
Sbjct  710  DTPGQTFLAFEKPEGVPAVGKFTNLLRFIVKEVDPTTGEAEEDGVEDEYQLEDLEVVAAD  769

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            Y+LKV V NF+NAW++MG D ERVDEYGLGPR++L EAVNAVINLLGMQPCEGTEVV +N
Sbjct  770  YILKVPVFNFKNAWDSMGADFERVDEYGLGPRENLTEAVNAVINLLGMQPCEGTEVVASN  829

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGID-GPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            SRSHTC+LSGVYIG+ KVLVRL FGID   KEVAMKL VRSED ++SDAIHEIVASG
Sbjct  830  SRSHTCVLSGVYIGNVKVLVRLLFGIDSSSKEVAMKLTVRSEDGTVSDAIHEIVASG  886



>ref|XP_002459514.1| hypothetical protein SORBIDRAFT_02g005920 [Sorghum bicolor]
 gb|EER96035.1| hypothetical protein SORBIDRAFT_02g005920 [Sorghum bicolor]
Length=888

 Score =   390 bits (1003),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 195/237 (82%), Positives = 217/237 (92%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIFD HVV QYNCTNTIPEQ LE V V VDASEA+EF E AS+PL+SLP
Sbjct  652  AETEYSVNVVKHIFDGHVVLQYNCTNTIPEQLLEQVVVFVDASEADEFLEVASRPLESLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A GKFSN L+FIVKEVDPSTGEAE+DGVEDEYQLEDLE+V+A
Sbjct  712  YDSPGQTFVAFEKPEGVIATGKFSNILKFIVKEVDPSTGEAEDDGVEDEYQLEDLEIVSA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGT+VVP+
Sbjct  772  DYMLKVGVSNFRNAWESMDPESERVDEYGLGVRESLAEAVSAVISILGMQPCEGTDVVPS  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV++G+ KVLVRLSFGI  PKEVAMKLAVRS+D  ISD IHEIVA+G
Sbjct  832  NSRSHTCLLSGVFVGNVKVLVRLSFGISAPKEVAMKLAVRSDDPEISDKIHEIVANG  888



>ref|NP_001132662.1| uncharacterized protein LOC100194138 [Zea mays]
 gb|ACG28715.1| coatomer subunit gamma [Zea mays]
 gb|ACN34045.1| unknown [Zea mays]
 tpg|DAA42450.1| TPA: coatomer subunit gamma [Zea mays]
Length=888

 Score =   390 bits (1001),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 196/237 (83%), Positives = 215/237 (91%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIFD HVV QYNCTNTIPEQ LE V V VDASEA+EF E ASKPL+SLP
Sbjct  652  AETEYSVNVVKHIFDGHVVLQYNCTNTIPEQLLEQVIVFVDASEADEFLEVASKPLESLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A GKFSN L+FIVKEVDPSTGE E+DGVEDEYQLEDLE+V+A
Sbjct  712  YDSPGQTFVAFEKPEGVIATGKFSNILKFIVKEVDPSTGETEDDGVEDEYQLEDLEIVSA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGT+VVP+
Sbjct  772  DYMLKVGVSNFRNAWENMDPETERVDEYGLGVRESLAEAVSAVISILGMQPCEGTDVVPS  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGI  PKEVAMKLAVRS+D  ISD IHEIVA+G
Sbjct  832  NSRSHTCLLSGVFIGNVKVLVRLSFGISAPKEVAMKLAVRSDDPEISDKIHEIVANG  888



>gb|AAN60990.1| Putative Nonclathrin coat protein gamma - like protein [Oryza 
sativa Japonica Group]
Length=826

 Score =   387 bits (995),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYA+NVVKHI+ SHVV QYNCTNTIPEQ LENVTV VDA++AEEFSE  SKPL+SLP
Sbjct  590  AETEYAINVVKHIYSSHVVLQYNCTNTIPEQLLENVTVYVDATDAEEFSEVCSKPLRSLP  649

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPE VPA GKFSN L+FIVKEVD STGE +EDGVEDEYQ+EDLE+V+A
Sbjct  650  YDSPGQIFVAFEKPEHVPATGKFSNVLKFIVKEVDTSTGEVDEDGVEDEYQIEDLEIVSA  709

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGTEVVP 
Sbjct  710  DYMLRVAVSNFRNAWENMDPESERVDEYGLGVRESLAEAVSAVISILGMQPCEGTEVVPK  769

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG AKVLVRLSFG+ GPKEVAMKLAVRS+D  +SD IHEIVASG
Sbjct  770  NARSHTCLLSGVFIGDAKVLVRLSFGLSGPKEVAMKLAVRSDDPEVSDKIHEIVASG  826



>ref|XP_008650919.1| PREDICTED: uncharacterized protein LOC100193726 isoform X1 [Zea 
mays]
 tpg|DAA59936.1| TPA: hypothetical protein ZEAMMB73_271533 [Zea mays]
Length=888

 Score =   389 bits (998),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 195/237 (82%), Positives = 215/237 (91%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIFD HVV QYNCTNTIPEQ LE V V+VDASEA+EF E ASKPL+SLP
Sbjct  652  AETEYSVNVVKHIFDRHVVLQYNCTNTIPEQLLEQVIVLVDASEADEFLEVASKPLESLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFE PEGV A GKFSN L+F VKEVDPSTGEAE+DGVEDEYQLEDLE+V+A
Sbjct  712  YDSPGQTFVAFENPEGVIATGKFSNILKFFVKEVDPSTGEAEDDGVEDEYQLEDLEIVSA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGT+VVP+
Sbjct  772  DYMLKVGVSNFRNAWENMDPETERVDEYGLGVRESLAEAVSAVISILGMQPCEGTDVVPS  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGI  PKEVAMKLAVRS+D  ISD IHEIVA+G
Sbjct  832  NSRSHTCLLSGVFIGNVKVLVRLSFGISAPKEVAMKLAVRSDDPEISDRIHEIVANG  888



>sp|Q8H852.2|COPG1_ORYSJ RecName: Full=Coatomer subunit gamma-1; AltName: Full=Gamma-1-coat 
protein; Short=Gamma-1-COP [Oryza sativa Japonica Group]
Length=884

 Score =   389 bits (998),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYA+NVVKHI+ SHVV QYNCTNTIPEQ LENVTV VDA++AEEFSE  SKPL+SLP
Sbjct  648  AETEYAINVVKHIYSSHVVLQYNCTNTIPEQLLENVTVYVDATDAEEFSEVCSKPLRSLP  707

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPE VPA GKFSN L+FIVKEVD STGE +EDGVEDEYQ+EDLE+V+A
Sbjct  708  YDSPGQIFVAFEKPEHVPATGKFSNVLKFIVKEVDTSTGEVDEDGVEDEYQIEDLEIVSA  767

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGTEVVP 
Sbjct  768  DYMLRVAVSNFRNAWENMDPESERVDEYGLGVRESLAEAVSAVISILGMQPCEGTEVVPK  827

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG AKVLVRLSFG+ GPKEVAMKLAVRS+D  +SD IHEIVASG
Sbjct  828  NARSHTCLLSGVFIGDAKVLVRLSFGLSGPKEVAMKLAVRSDDPEVSDKIHEIVASG  884



>gb|ACL54542.1| unknown [Zea mays]
Length=888

 Score =   389 bits (998),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 195/237 (82%), Positives = 215/237 (91%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIFD HVV QYNCTNTIPEQ LE V V+VDASEA+EF E ASKPL+SLP
Sbjct  652  AETEYSVNVVKHIFDRHVVLQYNCTNTIPEQLLEQVIVLVDASEADEFLEVASKPLESLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFE PEGV A GKFSN L+F VKEVDPSTGEAE+DGVEDEYQLEDLE+V+A
Sbjct  712  YDSPGQTFVAFENPEGVIATGKFSNILKFFVKEVDPSTGEAEDDGVEDEYQLEDLEIVSA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGT+VVP+
Sbjct  772  DYMLKVGVSNFRNAWENMDPETERVDEYGLGVRESLAEAVSAVISILGMQPCEGTDVVPS  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGI  PKEVAMKLAVRS+D  ISD IHEIVA+G
Sbjct  832  NSRSHTCLLSGVFIGNVKVLVRLSFGISAPKEVAMKLAVRSDDPEISDRIHEIVANG  888



>gb|EEC74799.1| hypothetical protein OsI_10600 [Oryza sativa Indica Group]
Length=903

 Score =   389 bits (998),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYA+NVVKHI+ SHVV QYNCTNTIPEQ LENVTV VDA++AEEFSE  SKPL+SLP
Sbjct  667  AETEYAINVVKHIYSSHVVLQYNCTNTIPEQLLENVTVYVDATDAEEFSEVCSKPLRSLP  726

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPE VPA GKFSN L+FIVKEVD STGE +EDGVEDEYQ+EDLE+V+A
Sbjct  727  YDSPGQIFVAFEKPEHVPATGKFSNVLKFIVKEVDTSTGEVDEDGVEDEYQIEDLEIVSA  786

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGTEVVP 
Sbjct  787  DYMLRVAVSNFRNAWENMDPESERVDEYGLGVRESLAEAVSAVISILGMQPCEGTEVVPK  846

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG AKVLVRLSFG+ GPKEVAMKLAVRS+D  +SD IHEIVASG
Sbjct  847  NARSHTCLLSGVFIGDAKVLVRLSFGLSGPKEVAMKLAVRSDDPEVSDKIHEIVASG  903



>ref|XP_008375923.1| PREDICTED: coatomer subunit gamma [Malus domestica]
Length=886

 Score =   388 bits (997),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 198/237 (84%), Positives = 218/237 (92%), Gaps = 1/237 (0%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LE+V V+VDASEAEEFSE AS+ L+SLPY
Sbjct  650  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLEDVIVVVDASEAEEFSEVASRSLRSLPY  709

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
            DTPGQTF+AFEKPEG+PA+GKF+N LRFIVKEVDP+TGEAEEDGVEDEYQLEDLEVVAAD
Sbjct  710  DTPGQTFLAFEKPEGIPAVGKFTNLLRFIVKEVDPTTGEAEEDGVEDEYQLEDLEVVAAD  769

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            Y+LKV V NF+NAWE+MG D ERVDEYGLGPR++L EAVNAVI+LLGMQPCEGTE V +N
Sbjct  770  YILKVPVFNFKNAWESMGADFERVDEYGLGPRENLTEAVNAVISLLGMQPCEGTEAVASN  829

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGID-GPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            SRSHTC+LSGVYIG+ KVLVRL FGID   KEVAMKL VRSED ++SDAIHEIVASG
Sbjct  830  SRSHTCVLSGVYIGNVKVLVRLLFGIDSSSKEVAMKLTVRSEDGAVSDAIHEIVASG  886



>gb|EEE58633.1| hypothetical protein OsJ_09998 [Oryza sativa Japonica Group]
Length=913

 Score =   389 bits (998),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYA+NVVKHI+ SHVV QYNCTNTIPEQ LENVTV VDA++AEEFSE  SKPL+SLP
Sbjct  677  AETEYAINVVKHIYSSHVVLQYNCTNTIPEQLLENVTVYVDATDAEEFSEVCSKPLRSLP  736

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPE VPA GKFSN L+FIVKEVD STGE +EDGVEDEYQ+EDLE+V+A
Sbjct  737  YDSPGQIFVAFEKPEHVPATGKFSNVLKFIVKEVDTSTGEVDEDGVEDEYQIEDLEIVSA  796

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGTEVVP 
Sbjct  797  DYMLRVAVSNFRNAWENMDPESERVDEYGLGVRESLAEAVSAVISILGMQPCEGTEVVPK  856

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG AKVLVRLSFG+ GPKEVAMKLAVRS+D  +SD IHEIVASG
Sbjct  857  NARSHTCLLSGVFIGDAKVLVRLSFGLSGPKEVAMKLAVRSDDPEVSDKIHEIVASG  913



>ref|NP_001049443.1| Os03g0227000 [Oryza sativa Japonica Group]
 gb|ABF94752.1| Adaptin N terminal region family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11357.1| Os03g0227000 [Oryza sativa Japonica Group]
 dbj|BAG90916.1| unnamed protein product [Oryza sativa Japonica Group]
Length=897

 Score =   388 bits (997),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYA+NVVKHI+ SHVV QYNCTNTIPEQ LENVTV VDA++AEEFSE  SKPL+SLP
Sbjct  661  AETEYAINVVKHIYSSHVVLQYNCTNTIPEQLLENVTVYVDATDAEEFSEVCSKPLRSLP  720

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPE VPA GKFSN L+FIVKEVD STGE +EDGVEDEYQ+EDLE+V+A
Sbjct  721  YDSPGQIFVAFEKPEHVPATGKFSNVLKFIVKEVDTSTGEVDEDGVEDEYQIEDLEIVSA  780

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGTEVVP 
Sbjct  781  DYMLRVAVSNFRNAWENMDPESERVDEYGLGVRESLAEAVSAVISILGMQPCEGTEVVPK  840

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG AKVLVRLSFG+ GPKEVAMKLAVRS+D  +SD IHEIVASG
Sbjct  841  NARSHTCLLSGVFIGDAKVLVRLSFGLSGPKEVAMKLAVRSDDPEVSDKIHEIVASG  897



>ref|XP_008457930.1| PREDICTED: coatomer subunit gamma-like [Cucumis melo]
Length=887

 Score =   386 bits (992),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/237 (80%), Positives = 215/237 (91%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LEN++V+VDASEAEEFSE  SKPL+SLP
Sbjct  651  AETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENISVVVDASEAEEFSEVVSKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            Y++PGQTFVAFEKP+GV A+GKF N L+FIVKE+DPSTGEAE+DGVEDEYQLED+EVVAA
Sbjct  711  YNSPGQTFVAFEKPDGVAAVGKFPNVLKFIVKEIDPSTGEAEDDGVEDEYQLEDVEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKV VSNFRNAWE+MG D ERVDEYGLGPR SLAEAV AVI+LLGMQPCEGTEVVP 
Sbjct  771  DYMLKVAVSNFRNAWESMGEDGERVDEYGLGPRGSLAEAVRAVIDLLGMQPCEGTEVVPT  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N RSHTCLLSG++IG+ KVL RLSFG+D  +EVAMKL VRS++ ++SD IHEI++ G
Sbjct  831  NVRSHTCLLSGIFIGNVKVLARLSFGLDASREVAMKLVVRSDNEAVSDLIHEIISCG  887



>dbj|BAJ96771.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=856

 Score =   385 bits (988),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 194/237 (82%), Positives = 216/237 (91%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHI+D HVV QYNCTNTIPEQ LE V V VDASEAEEFSE ASKPL+SLP
Sbjct  620  AETEYSVNVVKHIYDGHVVLQYNCTNTIPEQLLEEVMVFVDASEAEEFSEVASKPLRSLP  679

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A GKFSN L+FIVKEVD STGEAE+DGVEDEYQLED E+++A
Sbjct  680  YDSPGQTFVAFEKPEGVLATGKFSNILKFIVKEVDSSTGEAEDDGVEDEYQLEDFEIISA  739

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+M P+ ERVDEYGLG R++LAEAV+AVI++LGMQPCEGT+VV N
Sbjct  740  DYMLKVGVSNFRNAWESMDPESERVDEYGLGVRENLAEAVSAVISILGMQPCEGTDVVQN  799

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGI GPKEVAMKLAVRS+D  +SD IHEIVA+G
Sbjct  800  NSRSHTCLLSGVFIGNVKVLVRLSFGISGPKEVAMKLAVRSDDPEVSDRIHEIVANG  856



>dbj|BAJ99125.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=889

 Score =   385 bits (988),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 194/237 (82%), Positives = 216/237 (91%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHI+D HVV QYNCTNTIPEQ LE V V VDASEAEEFSE ASKPL+SLP
Sbjct  653  AETEYSVNVVKHIYDGHVVLQYNCTNTIPEQLLEEVMVFVDASEAEEFSEVASKPLRSLP  712

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A GKFSN L+FIVKEVD STGEAE+DGVEDEYQLED E+++A
Sbjct  713  YDSPGQTFVAFEKPEGVLATGKFSNILKFIVKEVDSSTGEAEDDGVEDEYQLEDFEIISA  772

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+M P+ ERVDEYGLG R++LAEAV+AVI++LGMQPCEGT+VV N
Sbjct  773  DYMLKVGVSNFRNAWESMDPESERVDEYGLGVRENLAEAVSAVISILGMQPCEGTDVVQN  832

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGI GPKEVAMKLAVRS+D  +SD IHEIVA+G
Sbjct  833  NSRSHTCLLSGVFIGNVKVLVRLSFGISGPKEVAMKLAVRSDDPEVSDRIHEIVANG  889



>ref|XP_004955766.1| PREDICTED: coatomer subunit gamma-2-like [Setaria italica]
Length=888

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHI+D H+V QYNCTNTIPEQ LE V V VDASEA+EF E  SKPL+SLP
Sbjct  652  AETEYSVNVVKHIYDGHIVLQYNCTNTIPEQLLEQVIVFVDASEADEFLEVTSKPLESLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A GKFSN L+FIVKEVDPSTGEAE+DGVEDEYQLEDLE+V+A
Sbjct  712  YDSPGQTFVAFEKPEGVIATGKFSNILKFIVKEVDPSTGEAEDDGVEDEYQLEDLEIVSA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+M P+ ERVDEYGLG R+ LAEAV+AVI++LGMQPCEGT+VVP+
Sbjct  772  DYMLKVGVSNFRNAWESMDPESERVDEYGLGVREGLAEAVSAVISILGMQPCEGTDVVPS  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGI   KEVAMKLAVRS+D  ISD IHEIVA+G
Sbjct  832  NSRSHTCLLSGVFIGNVKVLVRLSFGITSSKEVAMKLAVRSDDPEISDKIHEIVANG  888



>gb|EMS53044.1| Coatomer subunit gamma-1 [Triticum urartu]
Length=883

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+++HVV QYNCTNTIPEQ LE+VTV VDA++AEEFSE  SKPLKSLP
Sbjct  647  AETEYAVNVVKHIYENHVVLQYNCTNTIPEQLLEDVTVYVDATDAEEFSEVCSKPLKSLP  706

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPE VPAIGKFSN L+F VKEVD S+GEA+EDGVEDEYQLEDLE+V+A
Sbjct  707  YDSPGQIFVAFEKPEHVPAIGKFSNVLKFTVKEVDTSSGEADEDGVEDEYQLEDLEIVSA  766

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AV ++LGMQPCEGTEVVP+
Sbjct  767  DYMLRVAVSNFRNAWENMDPESERVDEYGLGARESLAEAVSAVTSILGMQPCEGTEVVPS  826

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSH CLLSGVYIG  KVLVRLSFG+ GPKEVAMKLAVRS+D  +SD IHEIVASG
Sbjct  827  NARSHVCLLSGVYIGGVKVLVRLSFGLSGPKEVAMKLAVRSDDPEVSDKIHEIVASG  883



>gb|EMS56973.1| Coatomer subunit gamma-2 [Triticum urartu]
Length=895

 Score =   384 bits (985),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 193/237 (81%), Positives = 215/237 (91%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHI+D HVV QYNCTNTIPEQ LE V V VDASEAEEFSE ASKPL+SLP
Sbjct  659  AETEYSVNVVKHIYDGHVVLQYNCTNTIPEQLLEEVVVFVDASEAEEFSEVASKPLRSLP  718

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPEGV A GKFSN L+FIVKEVD STGEAE+DGVEDEYQLED E+++A
Sbjct  719  YDSPGQAFVAFEKPEGVLATGKFSNILKFIVKEVDSSTGEAEDDGVEDEYQLEDFEIISA  778

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVG+SNFRNAWE+M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGT+VV N
Sbjct  779  DYMLKVGISNFRNAWESMDPESERVDEYGLGVRESLAEAVSAVISILGMQPCEGTDVVQN  838

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGI GPKEVAMKLAVRS+D  +SD IHEIVA+G
Sbjct  839  NSRSHTCLLSGVFIGNVKVLVRLSFGISGPKEVAMKLAVRSDDPEVSDRIHEIVANG  895



>gb|EEC81692.1| hypothetical protein OsI_25286 [Oryza sativa Indica Group]
Length=889

 Score =   383 bits (984),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 215/237 (91%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHI+D HVV QYNCTNTIPEQ LE V V VDASEA+EFSE A+K L+SLP
Sbjct  653  AETEYSVNVVKHIYDGHVVLQYNCTNTIPEQLLEEVVVFVDASEADEFSEVATKSLRSLP  712

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEK EGV A GKFSN L+FIVKEVDPSTGEA++DGVEDEYQLEDLE+ +A
Sbjct  713  YDSPGQTFVAFEKLEGVLATGKFSNILKFIVKEVDPSTGEADDDGVEDEYQLEDLEITSA  772

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+M P+ ERVDEYGLG R+SLAEAV+AVI +LGMQPCEGT+VVP+
Sbjct  773  DYMLKVGVSNFRNAWESMDPESERVDEYGLGARESLAEAVSAVIGILGMQPCEGTDVVPS  832

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFG+ GPKEVAMKLAVRS+D  ISD IHEIVA+G
Sbjct  833  NSRSHTCLLSGVFIGNVKVLVRLSFGLSGPKEVAMKLAVRSDDPEISDKIHEIVANG  889



>ref|NP_001059131.1| Os07g0201100 [Oryza sativa Japonica Group]
 sp|Q6Z382.1|COPG2_ORYSJ RecName: Full=Coatomer subunit gamma-2; AltName: Full=Gamma-2-coat 
protein; Short=Gamma-2-COP [Oryza sativa Japonica Group]
 dbj|BAC84213.1| putative coatomer protein gamma 2-subunit [Oryza sativa Japonica 
Group]
 dbj|BAF21045.1| Os07g0201100 [Oryza sativa Japonica Group]
 gb|EEE66759.1| hypothetical protein OsJ_23473 [Oryza sativa Japonica Group]
Length=889

 Score =   383 bits (984),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 215/237 (91%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHI+D HVV QYNCTNTIPEQ LE V V VDASEA+EFSE A+K L+SLP
Sbjct  653  AETEYSVNVVKHIYDGHVVLQYNCTNTIPEQLLEEVVVFVDASEADEFSEVATKSLRSLP  712

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEK EGV A GKFSN L+FIVKEVDPSTGEA++DGVEDEYQLEDLE+ +A
Sbjct  713  YDSPGQTFVAFEKLEGVLATGKFSNILKFIVKEVDPSTGEADDDGVEDEYQLEDLEITSA  772

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+M P+ ERVDEYGLG R+SLAEAV+AVI +LGMQPCEGT+VVP+
Sbjct  773  DYMLKVGVSNFRNAWESMDPESERVDEYGLGARESLAEAVSAVIGILGMQPCEGTDVVPS  832

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFG+ GPKEVAMKLAVRS+D  ISD IHEIVA+G
Sbjct  833  NSRSHTCLLSGVFIGNVKVLVRLSFGLSGPKEVAMKLAVRSDDPEISDKIHEIVANG  889



>ref|XP_009112399.1| PREDICTED: coatomer subunit gamma [Brassica rapa]
Length=886

 Score =   381 bits (979),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 213/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD+HVVFQYNCTNTIPEQ LE V VIVDASEAEEFSE  SK L SLP
Sbjct  650  AETEYAVNVVKHIFDNHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSELTSKALNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP GVPA+GKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQAFVAFEKPAGVPAVGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KV VSNFRNAWE+M  + E VDEYGLG R+SL EA+ AVI+LLGMQPCEGTE VP+
Sbjct  770  DYMVKVSVSNFRNAWESMNEEDEHVDEYGLGQRESLGEAIKAVIDLLGMQPCEGTETVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  KE+AMKLAVR+ED+S+++AIHEIVA+G
Sbjct  830  NARSHTCLLSGVYIGNVKVLVRAQFGMDSSKEIAMKLAVRAEDVSVAEAIHEIVANG  886



>emb|CDX75435.1| BnaA01g02670D [Brassica napus]
Length=886

 Score =   381 bits (979),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 213/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD+HVVFQYNCTNTIPEQ LE V VIVDASEAEEFSE  SK L SLP
Sbjct  650  AETEYAVNVVKHIFDNHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSELTSKALNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP GVPA+GKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQAFVAFEKPAGVPAVGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KV VSNFRNAWE+M  + E VDEYGLG R+SL EA+ AVI+LLGMQPCEGTE VP+
Sbjct  770  DYMVKVSVSNFRNAWESMNEEDEHVDEYGLGQRESLGEAIKAVIDLLGMQPCEGTETVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  KE+AMKLAVR+ED+S+++AIHEIVA+G
Sbjct  830  NARSHTCLLSGVYIGNVKVLVRAQFGMDSSKEIAMKLAVRAEDVSVAEAIHEIVANG  886



>dbj|BAE98672.1| Nonclathrin coat protein gamma - like protein [Arabidopsis thaliana]
Length=670

 Score =   375 bits (963),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 210/237 (89%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LE V VIVDASEAEEFSE  SK L SLP
Sbjct  434  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSEVTSKALNSLP  493

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FV FEKP GVPA+GKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLEDLEVVA 
Sbjct  494  YDSPGQAFVVFEKPAGVPAVGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVAG  553

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE+M  + ERVDEYGLG R+SL EAV AV++LLGMQ CEGTE +P 
Sbjct  554  DYMVKVGVSNFRNAWESMDEEDERVDEYGLGQRESLGEAVKAVMDLLGMQTCEGTETIPL  613

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  K++AMKL VR+ED+S+++AIHEIVASG
Sbjct  614  NARSHTCLLSGVYIGNVKVLVRAQFGMDSSKDIAMKLTVRAEDVSVAEAIHEIVASG  670



>ref|XP_006412224.1| hypothetical protein EUTSA_v10024368mg [Eutrema salsugineum]
 gb|ESQ53677.1| hypothetical protein EUTSA_v10024368mg [Eutrema salsugineum]
Length=886

 Score =   381 bits (978),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 213/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD+HVVFQYNCTNTI EQ LE V VIVDASEAEEFSE  SK L SLP
Sbjct  650  AETEYAVNVVKHIFDNHVVFQYNCTNTIEEQLLERVNVIVDASEAEEFSEVTSKALNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKP GVPA+GKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQTFVAFEKPAGVPAVGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KV VSNFRNAWE+M  + E VDEYGLG R+SL EA+ AVI+LLGMQPCEGTE VP+
Sbjct  770  DYMMKVLVSNFRNAWESMDEEDEHVDEYGLGQRESLGEAIKAVIDLLGMQPCEGTETVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  KE+AMKLAVR+ED+S+++AIHEIVASG
Sbjct  830  NARSHTCLLSGVYIGNVKVLVRAQFGMDSSKEIAMKLAVRAEDVSVAEAIHEIVASG  886



>emb|CDY46248.1| BnaC03g66090D [Brassica napus]
Length=886

 Score =   380 bits (977),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD+HVVFQYNCTNTIPEQ LE V VIVDASEAEEFSE ASK L SLP
Sbjct  650  AETEYAVNVVKHIFDNHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSEVASKALNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP GVPA+GKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLEDLEVV+A
Sbjct  710  YDSPGQAFVAFEKPAGVPAVGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVSA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KV VSNFRNAWE+M  + E VDEYGLG R+SL EA+ AVI+LLGMQPCEGTE VP+
Sbjct  770  DYMVKVSVSNFRNAWESMNEEDEHVDEYGLGQRESLGEAIKAVIDLLGMQPCEGTETVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  KE+AMKLAVR+ED+S+++AIHEIVA+G
Sbjct  830  NARSHTCLLSGVYIGNVKVLVRAQFGMDSSKEIAMKLAVRAEDVSVAEAIHEIVANG  886



>dbj|BAK02925.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=896

 Score =   380 bits (977),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 213/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+++HVV QYNCTNTIPEQ LE+VTV VDA++AEEFSE  SKPLKSLP
Sbjct  660  AETEYAVNVVKHIYENHVVLQYNCTNTIPEQLLEDVTVYVDATDAEEFSEVFSKPLKSLP  719

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPE VPAIG+FSN L+F VKEVD S+GEA+EDGVEDEYQLEDLE+V+A
Sbjct  720  YDSPGQIFVAFEKPEHVPAIGRFSNVLKFTVKEVDTSSGEADEDGVEDEYQLEDLEIVSA  779

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AV ++LGMQPCEGTEVV +
Sbjct  780  DYMLRVAVSNFRNAWENMDPESERVDEYGLGARESLAEAVSAVTSILGMQPCEGTEVVSS  839

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSH CLLSGVYIG  KVLVRLSFG+ GPKEVAMKLAVRS+D  +SD IHEIVASG
Sbjct  840  NARSHVCLLSGVYIGGVKVLVRLSFGLSGPKEVAMKLAVRSDDPEVSDKIHEIVASG  896



>ref|XP_010526924.1| PREDICTED: coatomer subunit gamma [Tarenaya hassleriana]
Length=886

 Score =   380 bits (976),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LE VTV+VDASEAEEFSE ASKPL SLP
Sbjct  650  SETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLERVTVVVDASEAEEFSEVASKPLNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP GVPA+GKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQAFVAFEKPAGVPAVGKFSNTLAFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE M P+ E VDEYGLG R+SLAEAV AVI+LLG+Q CEGTE V +
Sbjct  770  DYILKVGVSNFRNAWENMDPENEHVDEYGLGQRESLAEAVKAVIDLLGLQTCEGTETVAS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCL+SGVYIG+ KV+VR  FG+D  KE+ MKL+VR++D S+S+AIHEIVASG
Sbjct  830  NARSHTCLMSGVYIGNVKVVVRAQFGMDSEKEIMMKLSVRADDASVSEAIHEIVASG  886



>ref|XP_006283082.1| hypothetical protein CARUB_v10004095mg [Capsella rubella]
 gb|EOA15980.1| hypothetical protein CARUB_v10004095mg [Capsella rubella]
Length=912

 Score =   380 bits (977),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 190/237 (80%), Positives = 210/237 (89%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LE V VIVDASEAE+F+E  SK L SLP
Sbjct  676  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLERVNVIVDASEAEDFNEVTSKALNSLP  735

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YDTP Q FV FEKP GVPA+GKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLEDLEVVA 
Sbjct  736  YDTPAQAFVVFEKPAGVPAVGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVAG  795

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE M  + ERVDEYGLG RDSL EAVNAVI+LLGMQ CEGTE +P+
Sbjct  796  DYMVKVGVSNFRNAWEGMDEEDERVDEYGLGQRDSLGEAVNAVIDLLGMQTCEGTETIPS  855

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  K++AMKL VR+ED+S+++AIHEIVASG
Sbjct  856  NARSHTCLLSGVYIGNVKVLVRAQFGMDSSKDIAMKLTVRAEDVSVAEAIHEIVASG  912



>ref|XP_009108729.1| PREDICTED: coatomer subunit gamma-like [Brassica rapa]
 emb|CDX76283.1| BnaA08g11170D [Brassica napus]
Length=886

 Score =   380 bits (975),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 190/237 (80%), Positives = 213/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD+HVVFQYNCTNTIPEQ LE V VIVDASEAEEFSE  SK L SLP
Sbjct  650  AETEYAVNVVKHIFDNHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSEITSKALNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP GVPA+GKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLEDLEVV+A
Sbjct  710  YDSPGQAFVAFEKPAGVPAVGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVSA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKV VSNFRNAWE+M  + E VDEYGLG R+SL EA+ AVI+LLGMQPCEGTE VP+
Sbjct  770  DYILKVSVSNFRNAWESMNEEDEHVDEYGLGQRESLGEAIKAVIDLLGMQPCEGTETVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  KE+AMKLAVR+ED+S+++AIHEIVA+G
Sbjct  830  NARSHTCLLSGVYIGNVKVLVRAQFGMDSSKEIAMKLAVRAEDVSVAEAIHEIVANG  886



>ref|XP_002465599.1| hypothetical protein SORBIDRAFT_01g041860 [Sorghum bicolor]
 gb|EER92597.1| hypothetical protein SORBIDRAFT_01g041860 [Sorghum bicolor]
Length=898

 Score =   380 bits (975),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 188/237 (79%), Positives = 213/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAV+VVKHI+D ++V QYNCTNTI EQ LE+VTV VDAS+AEEFSE  SKPL SLP
Sbjct  662  AETEYAVSVVKHIYDGYIVLQYNCTNTIEEQLLEDVTVCVDASDAEEFSEICSKPLTSLP  721

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            Y++PGQ FVAFEKPEGVPA+GKFSN L+F VKEVD +TGEA+EDGVEDEYQLED E+V++
Sbjct  722  YNSPGQVFVAFEKPEGVPAVGKFSNLLKFTVKEVDTTTGEADEDGVEDEYQLEDFEIVSS  781

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAVNAVIN+LGMQPCEGTEVVP 
Sbjct  782  DYMLRVAVSNFRNAWENMDPESERVDEYGLGVRESLAEAVNAVINILGMQPCEGTEVVPR  841

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG+AKVLVRLSFG+ GP EVAMKLAVRS+D  +SD IHEIVASG
Sbjct  842  NARSHTCLLSGVFIGNAKVLVRLSFGLSGPNEVAMKLAVRSDDSEVSDKIHEIVASG  898



>ref|XP_003557417.1| PREDICTED: coatomer subunit gamma-2 [Brachypodium distachyon]
Length=888

 Score =   379 bits (973),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHI+D HVV QYNCTNTIPEQ LE V V VDASEAEEFSE ASKPL+SLP
Sbjct  652  AETEYSVNVVKHIYDGHVVLQYNCTNTIPEQLLEEVVVFVDASEAEEFSEVASKPLRSLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A GKFSN L+FIVKEVD STGEA++DGVEDEYQLED E+++A
Sbjct  712  YDSPGQTFVAFEKPEGVLATGKFSNILKFIVKEVDSSTGEADDDGVEDEYQLEDFEIISA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+M  + ERVDEYGLG R+SL EAV+AVI++LGMQPCEGT+VV N
Sbjct  772  DYMLKVGVSNFRNAWESMDLESERVDEYGLGVRESLGEAVSAVISILGMQPCEGTDVVQN  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRLSFGI GPKEVAMKLAVRS+D  +SD IHEIVA+G
Sbjct  832  NSRSHTCLLSGVFIGNVKVLVRLSFGISGPKEVAMKLAVRSDDPEVSDRIHEIVANG  888



>ref|XP_006649665.1| PREDICTED: coatomer subunit gamma-1-like [Oryza brachyantha]
Length=897

 Score =   379 bits (974),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 187/237 (79%), Positives = 210/237 (89%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+ SHVV QYNCTNTIPEQ LENV V VDA++AEEFSE  SKPL+SLP
Sbjct  661  AETEYAVNVVKHIYGSHVVLQYNCTNTIPEQLLENVIVYVDATDAEEFSEVCSKPLRSLP  720

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPE VPA GKFSN L+FI +EVD STGE +EDGVEDEYQ+EDLE+V+A
Sbjct  721  YDSPGQIFVAFEKPEHVPATGKFSNVLKFIAREVDTSTGEVDEDGVEDEYQIEDLEIVSA  780

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGTE VP 
Sbjct  781  DYMLRVAVSNFRNAWENMDPESERVDEYGLGARESLAEAVSAVISILGMQPCEGTEAVPK  840

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV++G  KVLVRLSFG+ GPKEVAMKLAVRS+D  +SD IHEIVASG
Sbjct  841  NARSHTCLLSGVFVGDVKVLVRLSFGLSGPKEVAMKLAVRSDDPEVSDKIHEIVASG  897



>gb|KFK29733.1| hypothetical protein AALP_AA7G171600 [Arabis alpina]
Length=886

 Score =   379 bits (972),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LE V VIVDASEAEEFSEAASK L SLP
Sbjct  650  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSEAASKALNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP GVPA+GKFSNTL F+VKEVD STGEAE+DGVEDEYQLEDLE+VAA
Sbjct  710  YDSPGQAFVAFEKPAGVPAVGKFSNTLTFVVKEVDTSTGEAEDDGVEDEYQLEDLEIVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE+M  + E VDEYGLG R+SL EA+ AVI+LLGMQ CEGTE VP+
Sbjct  770  DYMVKVGVSNFRNAWESMDEEDEHVDEYGLGQRESLGEAIKAVIDLLGMQSCEGTETVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  KE+AMKLAVR+ED+S+++AIHEIVA+G
Sbjct  830  NARSHTCLLSGVYIGNVKVLVRAQFGMDSTKEIAMKLAVRAEDVSVAEAIHEIVANG  886



>gb|KFK29732.1| hypothetical protein AALP_AA7G171600 [Arabis alpina]
Length=869

 Score =   378 bits (971),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LE V VIVDASEAEEFSEAASK L SLP
Sbjct  633  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSEAASKALNSLP  692

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP GVPA+GKFSNTL F+VKEVD STGEAE+DGVEDEYQLEDLE+VAA
Sbjct  693  YDSPGQAFVAFEKPAGVPAVGKFSNTLTFVVKEVDTSTGEAEDDGVEDEYQLEDLEIVAA  752

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE+M  + E VDEYGLG R+SL EA+ AVI+LLGMQ CEGTE VP+
Sbjct  753  DYMVKVGVSNFRNAWESMDEEDEHVDEYGLGQRESLGEAIKAVIDLLGMQSCEGTETVPS  812

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  KE+AMKLAVR+ED+S+++AIHEIVA+G
Sbjct  813  NARSHTCLLSGVYIGNVKVLVRAQFGMDSTKEIAMKLAVRAEDVSVAEAIHEIVANG  869



>ref|XP_009392974.1| PREDICTED: coatomer subunit gamma-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392975.1| PREDICTED: coatomer subunit gamma-2-like [Musa acuminata subsp. 
malaccensis]
Length=887

 Score =   379 bits (972),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 187/237 (79%), Positives = 214/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VN VKHIFD HVVFQYNCTNTIPEQ LE VTV VDASEAE+FSE  SKPL++LP
Sbjct  651  AETEYSVNAVKHIFDGHVVFQYNCTNTIPEQLLEMVTVFVDASEAEDFSEVVSKPLRTLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTF+AFEKPEGVPA GKFSN L+F+VKEVDP+TGEAEEDGVEDEYQLEDLE+VAA
Sbjct  711  YDSPGQTFLAFEKPEGVPATGKFSNLLKFVVKEVDPATGEAEEDGVEDEYQLEDLEIVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNF+NAWE+M P  ER+DEYGLG ++SLAE V AVI++LGMQPCEGTEVV +
Sbjct  771  DYMLKVGVSNFKNAWESMDPGNERIDEYGLGVKESLAETVTAVIDILGMQPCEGTEVVSS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NS+SHT LLSG+++G+ KVLVR+SFGIDG K+VAM+LAVRSED  IS+ IHEIVA G
Sbjct  831  NSKSHTSLLSGIFVGNVKVLVRVSFGIDGSKQVAMRLAVRSEDPEISEKIHEIVAEG  887



>gb|EMT19755.1| Coatomer subunit gamma-1 [Aegilops tauschii]
Length=883

 Score =   378 bits (971),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 212/237 (89%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+++HVV QYNCTNTIPEQ LE+VTV VDA++AEEFSE  SKPLKSLP
Sbjct  647  AETEYAVNVVKHIYENHVVLQYNCTNTIPEQLLEDVTVYVDATDAEEFSEVCSKPLKSLP  706

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEK E VPAIGKFSN L+F VKEVD S+GEA+EDGVEDEYQLEDLE+V+A
Sbjct  707  YDSPGQIFVAFEKLEHVPAIGKFSNVLKFTVKEVDTSSGEADEDGVEDEYQLEDLEIVSA  766

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AV ++LGMQPCEGTEVVP+
Sbjct  767  DYMLRVAVSNFRNAWENMDPESERVDEYGLGARESLAEAVSAVTSILGMQPCEGTEVVPS  826

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSH CLLSGVYIG  KVLVRLS G+ GPKEVAMKLAVRS+D  +SD IHEIVASG
Sbjct  827  NARSHVCLLSGVYIGGVKVLVRLSLGLSGPKEVAMKLAVRSDDPEVSDKIHEIVASG  883



>emb|CDX69060.1| BnaC01g03930D [Brassica napus]
Length=886

 Score =   378 bits (971),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 212/237 (89%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD+HVVFQYNCTNTIPEQ LE V VIVDASEAEEFSE  SK L SLP
Sbjct  650  AETEYAVNVVKHIFDNHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSELTSKALNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP GVPA+GKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQAFVAFEKPAGVPAVGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KV VSNFRNAWE+M  + E VDEYGLG R+SL EA+ AVI+LLGMQPCEGTE VP+
Sbjct  770  DYMVKVSVSNFRNAWESMNEEDEHVDEYGLGQRESLGEAIKAVIDLLGMQPCEGTETVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KV+VR  FG+D  KE+AMKLAVR+ED S+++AIH+IVA+G
Sbjct  830  NARSHTCLLSGVYIGNVKVIVRAQFGMDSSKEIAMKLAVRAEDASVAEAIHDIVANG  886



>ref|NP_195171.2| coatomer subunit gamma [Arabidopsis thaliana]
 sp|Q0WW26.2|COPG_ARATH RecName: Full=Coatomer subunit gamma; AltName: Full=Gamma-coat 
protein; Short=Gamma-COP [Arabidopsis thaliana]
 dbj|BAH20306.1| AT4G34450 [Arabidopsis thaliana]
 gb|AEE86378.1| coatomer subunit gamma [Arabidopsis thaliana]
Length=886

 Score =   376 bits (966),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 189/237 (80%), Positives = 210/237 (89%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LE V VIVDASEAEEFSE  SK L SLP
Sbjct  650  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSEVTSKALNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FV FEKP GVPA+GKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLEDLEVVA 
Sbjct  710  YDSPGQAFVVFEKPAGVPAVGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVAG  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE+M  + ERVDEYGLG R+SL EAV AV++LLGMQ CEGTE +P 
Sbjct  770  DYMVKVGVSNFRNAWESMDEEDERVDEYGLGQRESLGEAVKAVMDLLGMQTCEGTETIPL  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  K++AMKL VR+ED+S+++AIHEIVASG
Sbjct  830  NARSHTCLLSGVYIGNVKVLVRAQFGMDSSKDIAMKLTVRAEDVSVAEAIHEIVASG  886



>ref|XP_002869144.1| hypothetical protein ARALYDRAFT_491217 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45403.1| hypothetical protein ARALYDRAFT_491217 [Arabidopsis lyrata subsp. 
lyrata]
Length=889

 Score =   376 bits (966),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 190/237 (80%), Positives = 210/237 (89%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAV+VVKHIFDSHVVFQYNCTNTIPEQ LE V VIVDASEAEEFSE  SK L SLP
Sbjct  653  AETEYAVDVVKHIFDSHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSEVTSKALNSLP  712

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FV FEKP GVPAIGKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLEDLEVVA 
Sbjct  713  YDSPGQAFVVFEKPAGVPAIGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLEDLEVVAG  772

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE++  + ERVDEYGLG RDSL EAV AVI+LLGMQ CEGTE +P 
Sbjct  773  DYMVKVGVSNFRNAWESLDEEDERVDEYGLGQRDSLGEAVKAVIDLLGMQTCEGTETIPL  832

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  K++AMKL VR+ED+S+++AIHEIVASG
Sbjct  833  NARSHTCLLSGVYIGNVKVLVRAQFGMDSSKDIAMKLTVRAEDVSVAEAIHEIVASG  889



>ref|XP_006856032.1| hypothetical protein AMTR_s00059p00069290 [Amborella trichopoda]
 gb|ERN17499.1| hypothetical protein AMTR_s00059p00069290 [Amborella trichopoda]
Length=887

 Score =   375 bits (964),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 218/237 (92%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIFD HVVFQYNCTNT+PE  LENV V VDASEAE+F++  SKPL+SLP
Sbjct  651  AETEYSVNVVKHIFDGHVVFQYNCTNTVPEILLENVNVFVDASEAEDFTQVYSKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFV+FEKPEGVPA+GKFSN L+F +KEVDP+TGEAEE+G EDEYQLED EV AA
Sbjct  711  YDSPGQTFVSFEKPEGVPAVGKFSNMLKFFIKEVDPTTGEAEEEGNEDEYQLEDFEVCAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE++GPD ERVDEYGLG R+SLAEAV+AVIN+LGMQPCEGT+VVP+
Sbjct  771  DYMVKVGVSNFRNAWESLGPDGERVDEYGLGVRESLAEAVSAVINILGMQPCEGTDVVPS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSG +IG  KVLVRLSFGIDGPK+VAMKLAVRSED ++SD IHEIVA+G
Sbjct  831  NSRSHTCLLSGKFIGDVKVLVRLSFGIDGPKQVAMKLAVRSEDPAVSDTIHEIVANG  887



>gb|ACL53471.1| unknown [Zea mays]
 tpg|DAA44252.1| TPA: hypothetical protein ZEAMMB73_398050 [Zea mays]
Length=645

 Score =   368 bits (945),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 208/237 (88%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAV+VVKHI+D ++V QYNC NTI EQ LE+VTV VDAS+AEEFSE  SKPL SLP
Sbjct  409  AETEYAVSVVKHIYDGYIVLQYNCANTIEEQLLEDVTVCVDASDAEEFSEICSKPLASLP  468

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            Y++PGQ FVAFEKPE VP +GKF N L+F VKEVD +TGEA+EDGVEDEYQLED E+V+A
Sbjct  469  YNSPGQVFVAFEKPERVPVVGKFLNLLKFTVKEVDTTTGEADEDGVEDEYQLEDFEIVSA  528

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M PD ERVDEYGLG R+SLAEAVNAVIN+LGMQPCEGTEVVP 
Sbjct  529  DYMLRVVVSNFRNAWENMDPDSERVDEYGLGVRESLAEAVNAVINILGMQPCEGTEVVPK  588

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG+ KVLVRLSFG+ GP EVAMKLAVRS+D  +SD IHEIVASG
Sbjct  589  NARSHTCLLSGVFIGNMKVLVRLSFGLSGPNEVAMKLAVRSDDPEVSDKIHEIVASG  645



>gb|KFK30073.1| hypothetical protein AALP_AA7G213200 [Arabis alpina]
Length=886

 Score =   374 bits (959),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 212/237 (89%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LE V VIVDASEAEEFSEAASK L SLP
Sbjct  650  AETEYAVNVVKHIFDGHVVFQYNCTNTIPEQLLERVNVIVDASEAEEFSEAASKALNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP GVPA+GKFSNTL F+VKEVD STGEAE+DGVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQAFVAFEKPAGVPAVGKFSNTLTFVVKEVDTSTGEAEDDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY++KVGVSNFRNAWE M  + E VDEYGLG R+SL EA+ AVI+LLGMQ CEGTE VP+
Sbjct  770  DYIVKVGVSNFRNAWENMDEEDEHVDEYGLGQRESLGEAIKAVIDLLGMQSCEGTETVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGVYIG+ KVLVR  FG+D  KE+AMKLAVR+ED+S+++AIHEIVA+G
Sbjct  830  NARSHTCLLSGVYIGNVKVLVRAQFGMDSTKEIAMKLAVRAEDVSVAEAIHEIVANG  886



>ref|NP_001146210.1| uncharacterized protein LOC100279780 [Zea mays]
 gb|ACL52566.1| unknown [Zea mays]
Length=899

 Score =   369 bits (947),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 208/237 (88%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAV+VVKHI+D ++V QYNC NTI EQ LE+VTV VDAS+AEEFSE  SKPL SLP
Sbjct  663  AETEYAVSVVKHIYDGYIVLQYNCANTIEEQLLEDVTVCVDASDAEEFSEICSKPLASLP  722

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            Y++PGQ FVAFEKPE VP +GKF N L+F VKEVD +TGEA+EDGVEDEYQLED E+V+A
Sbjct  723  YNSPGQVFVAFEKPERVPVVGKFLNLLKFTVKEVDTTTGEADEDGVEDEYQLEDFEIVSA  782

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M PD ERVDEYGLG R+SLAEAVNAVIN+LGMQPCEGTEVVP 
Sbjct  783  DYMLRVVVSNFRNAWENMDPDSERVDEYGLGVRESLAEAVNAVINILGMQPCEGTEVVPK  842

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG+ KVLVRLSFG+ GP EVAMKLAVRS+D  +SD IHEIVASG
Sbjct  843  NARSHTCLLSGVFIGNMKVLVRLSFGLSGPNEVAMKLAVRSDDPEVSDKIHEIVASG  899



>ref|XP_004985097.1| PREDICTED: coatomer subunit gamma-1-like [Setaria italica]
Length=899

 Score =   369 bits (946),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 205/237 (86%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+DS+VV QYNCTNTI EQ LENVTV VD+S AEEFSE  SKPL SLP
Sbjct  663  AETEYAVNVVKHIYDSYVVLQYNCTNTIEEQLLENVTVCVDSSVAEEFSEICSKPLASLP  722

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            Y++ GQ FVAFEKPE VPAIGK  N L+F VKEVD  TGEA+EDGV+DEYQLED E+ AA
Sbjct  723  YNSTGQIFVAFEKPERVPAIGKMFNLLKFTVKEVDTFTGEADEDGVDDEYQLEDFEIFAA  782

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVIN+LGMQPCEGTEVVP 
Sbjct  783  DYMLRVAVSNFRNAWENMDPESERVDEYGLGVRESLAEAVSAVINILGMQPCEGTEVVPR  842

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSGV+IG  KVLVRLSFG+ GP EVAMKLAVRS+D  +SD IHEIVASG
Sbjct  843  NARSHTCLLSGVFIGDVKVLVRLSFGLSGPNEVAMKLAVRSDDPEVSDKIHEIVASG  899



>ref|XP_010516946.1| PREDICTED: coatomer subunit gamma-like [Camelina sativa]
Length=484

 Score =   356 bits (913),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 206/237 (87%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVK IF+SHVVFQYNCTNT+PEQ LE V VIVDASEAEEFSE +SKPL SLP
Sbjct  248  AETEYSVNVVKRIFESHVVFQYNCTNTVPEQLLERVNVIVDASEAEEFSELSSKPLNSLP  307

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVPA+GKFSNTL FIVKEV+ STGE  +DGVEDEYQLEDLEVVAA
Sbjct  308  YDSPGQTFVAFEKPEGVPAVGKFSNTLTFIVKEVEQSTGEPLDDGVEDEYQLEDLEVVAA  367

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+ VGVSNFRNAWE M  + E VDEYGLGPRDSL EAV AV +LLGMQ CEGTE V +
Sbjct  368  DYMVNVGVSNFRNAWENMDEENELVDEYGLGPRDSLGEAVKAVTDLLGMQSCEGTETVAS  427

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHT LLSG+YIG+ KVLV+  FG+D  KE+ MKLAVR+ED S+SDAIH +VA+G
Sbjct  428  NARSHTSLLSGLYIGNVKVLVKAQFGMDSSKEIVMKLAVRAEDPSVSDAIHALVANG  484



>ref|XP_006409466.1| hypothetical protein EUTSA_v10022539mg [Eutrema salsugineum]
 gb|ESQ50919.1| hypothetical protein EUTSA_v10022539mg [Eutrema salsugineum]
Length=886

 Score =   367 bits (942),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 208/237 (88%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIF+SH+VFQYNCTNT+P+Q LE V VIVDASEAEEFSE +SK L SLP
Sbjct  650  AETEYSVNVVKHIFESHIVFQYNCTNTVPQQLLERVNVIVDASEAEEFSELSSKELNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPEGVPA+GKFSNTL FIVKEVD +TGE E+DGVEDEYQLEDLEVV+A
Sbjct  710  YDSPGQAFVAFEKPEGVPAVGKFSNTLTFIVKEVDQNTGEPEDDGVEDEYQLEDLEVVSA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+KVGVSNFRNAWE M P+ E VDEYGLG RDSLAEAV AV ++LGMQ CEGTE V +
Sbjct  770  DYMVKVGVSNFRNAWENMDPENELVDEYGLGQRDSLAEAVKAVTDILGMQSCEGTETVAS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSG+YIG+ KVLVR  FG+D  KE+ MKLAVR+ED S+SDAIH IVA G
Sbjct  830  NARSHTCLLSGLYIGNVKVLVRAQFGMDSTKEIVMKLAVRAEDRSVSDAIHTIVACG  886



>ref|XP_009121225.1| PREDICTED: coatomer subunit gamma [Brassica rapa]
 emb|CDY46215.1| BnaA07g03550D [Brassica napus]
Length=887

 Score =   365 bits (938),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 209/237 (88%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIF+SHVVFQYNCTNT+PEQ LE V VIVDASEAEEFSE +SKPL SLP
Sbjct  651  AETEYSVNVVKHIFESHVVFQYNCTNTVPEQLLERVNVIVDASEAEEFSELSSKPLNSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPEGVPA+GKFSNTL F+VKEVDP+TGEAEEDGVEDEYQLEDLEVV A
Sbjct  711  YDSPGQAFVAFEKPEGVPAVGKFSNTLTFVVKEVDPNTGEAEEDGVEDEYQLEDLEVVPA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+ VGVSNFRNAWE M P+ E VDEYGLGPR+SL EAV AV ++LGMQ CEGTE V +
Sbjct  771  DYMVNVGVSNFRNAWENMDPENELVDEYGLGPRESLGEAVKAVTDVLGMQSCEGTETVAS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHT LLSG+YIG+ KVLV+  FG+D  KE+AMKLAVR++D S+S+AIH IV+ G
Sbjct  831  NARSHTSLLSGLYIGNVKVLVKAQFGMDNRKEIAMKLAVRADDQSVSEAIHAIVSGG  887



>emb|CDX71272.1| BnaC07g05510D [Brassica napus]
Length=887

 Score =   365 bits (936),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 209/237 (88%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIF SHVVFQYNCTNT+PEQ LE V VIVDASEAEEFSE +SKPL SLP
Sbjct  651  AETEYSVNVVKHIFGSHVVFQYNCTNTVPEQLLERVNVIVDASEAEEFSELSSKPLNSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKPEGVPA+GKFSNTL F+VKEVDP+TGEAEEDGVEDEYQLEDLE+V A
Sbjct  711  YDSPGQAFVAFEKPEGVPAVGKFSNTLTFVVKEVDPNTGEAEEDGVEDEYQLEDLEIVPA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+ VGVSNFRNAWE+M P+ E VDEYGLGPR+SL EAV AV ++LGMQ CEGTE V +
Sbjct  771  DYMVNVGVSNFRNAWESMDPENELVDEYGLGPRESLGEAVKAVTDVLGMQSCEGTETVAS  830

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHT LLSG+YIG+ KVLV+  FG+D  KE+AMKLAVR++D S+S+AIH IV+ G
Sbjct  831  NARSHTSLLSGLYIGNVKVLVKAQFGMDNRKEIAMKLAVRADDQSVSEAIHAIVSGG  887



>ref|XP_010489193.1| PREDICTED: coatomer subunit gamma-like [Camelina sativa]
Length=642

 Score =   358 bits (918),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 206/237 (87%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIF+SHVVFQYNCTNT+PEQ LE V VIVDASEAEEFSE +SKPL SLP
Sbjct  406  AETEYSVNVVKHIFESHVVFQYNCTNTVPEQLLERVNVIVDASEAEEFSELSSKPLNSLP  465

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVPA+GKFSNTL FIVKEV+ STGE  +DGVEDEYQLEDLEVVAA
Sbjct  466  YDSPGQTFVAFEKPEGVPAVGKFSNTLTFIVKEVEQSTGEPLDDGVEDEYQLEDLEVVAA  525

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+ V VSNFRNAWE M  + E VDEYGLGPRDSL EAV AV +LLGMQ CEGTE V +
Sbjct  526  DYMVNVRVSNFRNAWENMDEENELVDEYGLGPRDSLGEAVKAVTDLLGMQSCEGTETVAS  585

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHT LLSG+YIG+ KVLV+  FG+D  KE+ MKLAVR+ED S+SDAIH +VA+G
Sbjct  586  NARSHTSLLSGLYIGNVKVLVKAQFGMDSSKEIVMKLAVRAEDPSVSDAIHALVANG  642



>tpg|DAA44254.1| TPA: hypothetical protein ZEAMMB73_398050 [Zea mays]
Length=1015

 Score =   367 bits (943),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 208/237 (88%), Gaps = 0/237 (0%)
 Frame = -1

Query  941   AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
             AETEYAV+VVKHI+D ++V QYNC NTI EQ LE+VTV VDAS+AEEFSE  SKPL SLP
Sbjct  779   AETEYAVSVVKHIYDGYIVLQYNCANTIEEQLLEDVTVCVDASDAEEFSEICSKPLASLP  838

Query  761   YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
             Y++PGQ FVAFEKPE VP +GKF N L+F VKEVD +TGEA+EDGVEDEYQLED E+V+A
Sbjct  839   YNSPGQVFVAFEKPERVPVVGKFLNLLKFTVKEVDTTTGEADEDGVEDEYQLEDFEIVSA  898

Query  581   DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
             DYML+V VSNFRNAWE M PD ERVDEYGLG R+SLAEAVNAVIN+LGMQPCEGTEVVP 
Sbjct  899   DYMLRVVVSNFRNAWENMDPDSERVDEYGLGVRESLAEAVNAVINILGMQPCEGTEVVPK  958

Query  401   NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
             N+RSHTCLLSGV+IG+ KVLVRLSFG+ GP EVAMKLAVRS+D  +SD IHEIVASG
Sbjct  959   NARSHTCLLSGVFIGNMKVLVRLSFGLSGPNEVAMKLAVRSDDPEVSDKIHEIVASG  1015



>ref|XP_010447078.1| PREDICTED: coatomer subunit gamma-like [Camelina sativa]
Length=888

 Score =   364 bits (935),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 184/238 (77%), Positives = 206/238 (87%), Gaps = 2/238 (1%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEYAVNVVKHI+DSHVV QYNCTNT+PEQ LE V VIVDASEAEEF+E  SK L SLPY
Sbjct  651  ETEYAVNVVKHIYDSHVVLQYNCTNTVPEQLLERVNVIVDASEAEEFNEVTSKALNSLPY  710

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAE--EDGVEDEYQLEDLEVVA  585
            D PGQ FV F+KP GVPA+GKFSNTL F+VKEVDPSTGEA+  +DGVEDEYQLEDLEVVA
Sbjct  711  DKPGQAFVVFKKPAGVPAVGKFSNTLTFVVKEVDPSTGEADADDDGVEDEYQLEDLEVVA  770

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
             DYM+KVGVSNFRNAWE+M  + ERVDEYGLG RDSL EAVNAV +LLGMQ CEGTE +P
Sbjct  771  GDYMVKVGVSNFRNAWESMDEEDERVDEYGLGQRDSLGEAVNAVTDLLGMQICEGTETIP  830

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
             N+RSHTCLLSGVYIG+ KVLVR  FG+D  K++AMKL VR+ED+S++DAIHEIVA G
Sbjct  831  TNARSHTCLLSGVYIGNVKVLVRAQFGMDSSKDIAMKLTVRAEDVSVADAIHEIVACG  888



>ref|XP_010432412.1| PREDICTED: coatomer subunit gamma-like [Camelina sativa]
Length=888

 Score =   364 bits (935),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 184/238 (77%), Positives = 206/238 (87%), Gaps = 2/238 (1%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEYAVNVVKHI+DSHVV QYNCTNT+PEQ LE V VIVDASEAEEF+E  SK L SLPY
Sbjct  651  ETEYAVNVVKHIYDSHVVLQYNCTNTVPEQLLERVNVIVDASEAEEFNEVTSKALNSLPY  710

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAE--EDGVEDEYQLEDLEVVA  585
            D PGQ FV F+KP GVPA+GKFSNTL F+VKEVDPSTGEA+  +DGVEDEYQLEDLEVVA
Sbjct  711  DKPGQAFVVFKKPAGVPAVGKFSNTLTFVVKEVDPSTGEADADDDGVEDEYQLEDLEVVA  770

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
             DYM+KVGVSNFRNAWE+M  + ERVDEYGLG RDSL EAVNAV +LLGMQ CEGTE +P
Sbjct  771  GDYMVKVGVSNFRNAWESMDEEDERVDEYGLGQRDSLGEAVNAVTDLLGMQICEGTEKIP  830

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
             N+RSHTCLLSGVYIG+ KVLVR  FG+D  K++AMKL VR+ED+S++DAIHEIVA G
Sbjct  831  TNARSHTCLLSGVYIGNVKVLVRAQFGMDSSKDIAMKLTVRAEDVSVADAIHEIVACG  888



>ref|XP_010437613.1| PREDICTED: coatomer subunit gamma [Camelina sativa]
Length=888

 Score =   364 bits (934),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 184/238 (77%), Positives = 205/238 (86%), Gaps = 2/238 (1%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEYAVNVVKHI+DSHVV QYNCTNT+PEQ LE V VIVDASEAEEF+E  SK L SLPY
Sbjct  651  ETEYAVNVVKHIYDSHVVLQYNCTNTVPEQLLERVNVIVDASEAEEFNEVTSKALNSLPY  710

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAE--EDGVEDEYQLEDLEVVA  585
            D PGQ FV F+KP GVPA+GKFSNTL F+VKEVDPSTGEA+  +DGVEDEYQLEDLEVVA
Sbjct  711  DKPGQAFVVFKKPAGVPAVGKFSNTLTFVVKEVDPSTGEADADDDGVEDEYQLEDLEVVA  770

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
             DYM+KVGVSNFRNAWE M  + ERVDEYGLG RDSL EAVNAV +LLGMQ CEGTE +P
Sbjct  771  GDYMVKVGVSNFRNAWENMDEEDERVDEYGLGQRDSLGEAVNAVTDLLGMQICEGTETIP  830

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
             N+RSHTCLLSGVYIG+ KVLVR  FG+D  K++AMKL VR+ED+S++DAIHEIVA G
Sbjct  831  TNARSHTCLLSGVYIGNVKVLVRAQFGMDSSKDIAMKLTVRAEDVSVADAIHEIVACG  888



>ref|XP_006296595.1| hypothetical protein CARUB_v10012945mg [Capsella rubella]
 gb|EOA29493.1| hypothetical protein CARUB_v10012945mg [Capsella rubella]
Length=886

 Score =   363 bits (931),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 207/237 (87%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+V VVKHIF+SHVVFQYNCTNT+PEQ LE V VIVDAS+AEEFSE +SKPL SLP
Sbjct  650  AETEYSVTVVKHIFESHVVFQYNCTNTVPEQLLERVNVIVDASDAEEFSELSSKPLNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVPA+GKFSNTL FIVKEV+ STGE+ +DGVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQTFVAFEKPEGVPAVGKFSNTLTFIVKEVEQSTGESLDDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+ VGVSNFRNAWE M    E VDEYGLGPRD+L EAV AV +LLGMQ CEGTE V +
Sbjct  770  DYMVNVGVSNFRNAWENMDEGNELVDEYGLGPRDTLGEAVKAVTDLLGMQSCEGTETVAS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSG+YIG+ KVLV+  FG+D  +E+ MKLAVRSED S+SDAIH +VA+G
Sbjct  830  NARSHTCLLSGLYIGNVKVLVKAQFGMDSSREIVMKLAVRSEDPSVSDAIHALVANG  886



>ref|XP_003558423.1| PREDICTED: coatomer subunit gamma-1 [Brachypodium distachyon]
Length=897

 Score =   363 bits (932),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/237 (76%), Positives = 207/237 (87%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI++SHVV QYNCTNTIPEQ L++VTV VDA++AEEFSE   K LK+L 
Sbjct  661  AETEYAVNVVKHIYESHVVLQYNCTNTIPEQLLQDVTVYVDATDAEEFSEVCLKSLKTLA  720

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP  VPA  KFSN L+F VKEVD S+GE ++DGVEDEYQ+EDLE+V+A
Sbjct  721  YDSPGQIFVAFEKPGRVPATCKFSNVLKFTVKEVDTSSGEVDDDGVEDEYQIEDLEIVSA  780

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML+V VSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AV ++LGMQPCEGTEVVP+
Sbjct  781  DYMLRVAVSNFRNAWENMDPESERVDEYGLGVRESLAEAVSAVTSILGMQPCEGTEVVPS  840

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSH CLLSGV+IG  KVLVRLSFG+ GPKEVAMKLAVRS+D  +SD IHEIVASG
Sbjct  841  NARSHVCLLSGVFIGDVKVLVRLSFGLSGPKEVAMKLAVRSDDPEVSDKIHEIVASG  897



>gb|EMT05643.1| Coatomer subunit gamma-2 [Aegilops tauschii]
Length=1168

 Score =   368 bits (945),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 186/223 (83%), Positives = 205/223 (92%), Gaps = 0/223 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHI+D HVV QYNCTNTIPEQ LE V V VDASEAEEFSE ASKPL+SLP
Sbjct  652  AETEYSVNVVKHIYDGHVVLQYNCTNTIPEQLLEEVVVFVDASEAEEFSEVASKPLRSLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A GKFSN L+FIVKEVD STGEAE+DGVEDEYQLED E+++A
Sbjct  712  YDSPGQTFVAFEKPEGVLATGKFSNILKFIVKEVDSSTGEAEDDGVEDEYQLEDFEIISA  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGT+VV N
Sbjct  772  DYMLKVGVSNFRNAWESMDPESERVDEYGLGVRESLAEAVSAVISILGMQPCEGTDVVQN  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSED  273
            NSRSHTCLLSGV+IG+ KVLVRLSFGI GPKEVAMKLAVRS+D
Sbjct  832  NSRSHTCLLSGVFIGNVKVLVRLSFGISGPKEVAMKLAVRSDD  874



>ref|XP_010467348.1| PREDICTED: coatomer subunit gamma-like [Camelina sativa]
Length=886

 Score =   362 bits (929),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 185/237 (78%), Positives = 207/237 (87%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIF+SHVVFQYNCTNT+PEQ LE V VIVDASEAEEFSE +SKPL SLP
Sbjct  650  AETEYSVNVVKHIFESHVVFQYNCTNTVPEQLLERVNVIVDASEAEEFSELSSKPLNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVPA+GKFSNTL FIVKEV+ STGE  +DGVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQTFVAFEKPEGVPAVGKFSNTLTFIVKEVEQSTGEPLDDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+ VGVSNFRNAWE M  + E VDEYGLGPRDSL EAV AV +LLGMQ CEGTE V +
Sbjct  770  DYMVNVGVSNFRNAWENMDEENELVDEYGLGPRDSLGEAVKAVTDLLGMQSCEGTETVAS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHT LLSG+YIG+ KVLV+  FG+D  KE+ MKLAVR+ED S+SDAIH +VA+G
Sbjct  830  NARSHTSLLSGLYIGNVKVLVKAQFGMDSSKEIVMKLAVRAEDPSVSDAIHALVANG  886



>ref|XP_002884158.1| hypothetical protein ARALYDRAFT_900277 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60417.1| hypothetical protein ARALYDRAFT_900277 [Arabidopsis lyrata subsp. 
lyrata]
Length=886

 Score =   361 bits (927),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 184/237 (78%), Positives = 206/237 (87%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+VNVVKHIF+SHVVFQYNCTNT+PEQ LE V VIVDASEAEEFSE +SKPL SLP
Sbjct  650  AETEYSVNVVKHIFESHVVFQYNCTNTVPEQLLERVNVIVDASEAEEFSELSSKPLNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ +VAFEKPEGVPA+GKFSNTL FIVKEV+ STGE  +DGVEDEYQLEDLEVVAA
Sbjct  710  YDSPGQAYVAFEKPEGVPAVGKFSNTLTFIVKEVELSTGEPLDDGVEDEYQLEDLEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYM+ VGVSNFRNAWE M    E VDEYGLGPRDSL EAV AV +LLGMQ CEGTE V +
Sbjct  770  DYMVNVGVSNFRNAWENMDEGNELVDEYGLGPRDSLGEAVKAVTDLLGMQSCEGTETVAS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCLLSG+YIG+ KVLV+  FG+D  KE+ MKLAVR+ED S+SDAIH +VA+G
Sbjct  830  NARSHTCLLSGLYIGNVKVLVKAQFGMDSSKEIVMKLAVRAEDPSVSDAIHALVANG  886



>ref|XP_009411250.1| PREDICTED: coatomer subunit gamma-2-like [Musa acuminata subsp. 
malaccensis]
Length=888

 Score =   361 bits (926),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 191/235 (81%), Positives = 214/235 (91%), Gaps = 0/235 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+D HVVFQYNCTNTIPEQ LENVTV VDASEAE+FSE ASKPL+SLP
Sbjct  652  AETEYAVNVVKHIYDGHVVFQYNCTNTIPEQLLENVTVFVDASEAEDFSEVASKPLRSLP  711

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKP G+PA G+FSN L+F VKEVDP+T EAEE+GVEDEYQLEDLE+V  
Sbjct  712  YDSPGQTFVAFEKPYGLPATGRFSNLLKFFVKEVDPATVEAEEEGVEDEYQLEDLEIVPV  771

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNF+NAWE+M PD ERVDEYGLG R+SLAEAV +VIN+LGMQPCEGTEVVP+
Sbjct  772  DYMLKVGVSNFKNAWESMAPDNERVDEYGLGARESLAEAVCSVINILGMQPCEGTEVVPS  831

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVA  237
            NSRSH CLLSG++IG+ KVLVRLSFG+D  K+VAMKLAVRSED +IS+ IHEIVA
Sbjct  832  NSRSHACLLSGIFIGNVKVLVRLSFGVDESKQVAMKLAVRSEDPNISERIHEIVA  886



>emb|CAA18824.1| Nonclathrin coat protein gamma-like protein [Arabidopsis thaliana]
 emb|CAB80162.1| Nonclathrin coat protein gamma-like protein [Arabidopsis thaliana]
Length=831

 Score =   359 bits (921),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 205/239 (86%), Gaps = 6/239 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LE V  I    EAEEFSE  SK L SLP
Sbjct  597  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLERVLNI----EAEEFSEVTSKALNSLP  652

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEV--DPSTGEAEEDGVEDEYQLEDLEVV  588
            YD+PGQ FV FEKP GVPA+GKFSNTL F+VKEV  DPSTGEAE+DGVEDEYQLEDLEVV
Sbjct  653  YDSPGQAFVVFEKPAGVPAVGKFSNTLTFVVKEVHVDPSTGEAEDDGVEDEYQLEDLEVV  712

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
            A DYM+KVGVSNFRNAWE+M  + ERVDEYGLG R+SL EAV AV++LLGMQ CEGTE +
Sbjct  713  AGDYMVKVGVSNFRNAWESMDEEDERVDEYGLGQRESLGEAVKAVMDLLGMQTCEGTETI  772

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            P N+RSHTCLLSGVYIG+ KVLVR  FG+D  K++AMKL VR+ED+S+++AIHEIVASG
Sbjct  773  PLNARSHTCLLSGVYIGNVKVLVRAQFGMDSSKDIAMKLTVRAEDVSVAEAIHEIVASG  831



>gb|KFK41271.1| hypothetical protein AALP_AA2G108400 [Arabis alpina]
Length=800

 Score =   353 bits (905),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/237 (76%), Positives = 203/237 (86%), Gaps = 0/237 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY VNVVKHIFD+HVVFQYNCTNT+ EQ LE V VIVDASEAEEFSE +SKP+ SLP
Sbjct  564  AETEYTVNVVKHIFDNHVVFQYNCTNTVLEQLLERVNVIVDASEAEEFSELSSKPINSLP  623

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ F+AFEKPEGVP +GKFSNTL FIVKEVD +TGE ++DGVEDEYQLEDLEVVA 
Sbjct  624  YDSPGQAFLAFEKPEGVPVVGKFSNTLTFIVKEVDINTGEPDDDGVEDEYQLEDLEVVAT  683

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYML VGVSNFRNAWE M P+ E VDEYGLG RDSLAEAV AV ++LGMQ CEGTE V +
Sbjct  684  DYMLNVGVSNFRNAWENMDPENELVDEYGLGQRDSLAEAVKAVTDILGMQSCEGTETVAS  743

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            N++SHT LLSG+YIG+ KVLV+  FG+D  KE+ MKLAVR+ED S+SDAIH IVA G
Sbjct  744  NAKSHTRLLSGLYIGNVKVLVKAQFGMDSTKEIVMKLAVRAEDRSVSDAIHAIVACG  800



>ref|XP_010548052.1| PREDICTED: coatomer subunit gamma-like [Tarenaya hassleriana]
Length=887

 Score =   352 bits (903),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 185/238 (78%), Positives = 216/238 (91%), Gaps = 1/238 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQ LE VTV+VDAS+AEEF+E ASKPL SLP
Sbjct  650  SETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLERVTVVVDASDAEEFTEVASKPLNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ +VA+EKP GVPA+GKFSNTL F+VKEVD STGE EE+GVEDEYQLED+EVVAA
Sbjct  710  YDSPGQAYVAYEKPSGVPAVGKFSNTLAFVVKEVDASTGEVEEEGVEDEYQLEDVEVVAA  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY++KVGVSNFRNAWE M P+ E VDEYGLGPR+SL++AV AVI+LLGMQPCEGTE VP+
Sbjct  770  DYIVKVGVSNFRNAWENMDPENEHVDEYGLGPRESLSDAVKAVIDLLGMQPCEGTEAVPS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGP-KEVAMKLAVRSEDLSISDAIHEIVASG  231
            N+RSHTCL+SGVYIG+ K +V+  FG+DG  KE+ MKL+VRS+D+S+S+AIHEIVASG
Sbjct  830  NARSHTCLMSGVYIGNVKAVVKTQFGMDGKTKEIMMKLSVRSDDISVSEAIHEIVASG  887



>ref|XP_010530844.1| PREDICTED: coatomer subunit gamma-like [Tarenaya hassleriana]
Length=887

 Score =   346 bits (888),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 190/238 (80%), Positives = 210/238 (88%), Gaps = 1/238 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEYAVNVVKHIFDSHVVFQYNC NTIPEQ LE VTV+VDASEAEEFSE ASKPL SLP
Sbjct  650  SETEYAVNVVKHIFDSHVVFQYNCMNTIPEQLLERVTVVVDASEAEEFSEVASKPLNSLP  709

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ FVAFEKP GVP++GKFSNTL FIVKEVDPSTGE EEDGVEDEYQLED+EVVA+
Sbjct  710  YDSPGQAFVAFEKPAGVPSVGKFSNTLAFIVKEVDPSTGEVEEDGVEDEYQLEDVEVVAS  769

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNFRNAWE M P+ E VDEYGLGPR+SLAEAV AVI+LLGMQPCEGTE V +
Sbjct  770  DYILKVGVSNFRNAWENMDPENEHVDEYGLGPRESLAEAVKAVIDLLGMQPCEGTETVGS  829

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGP-KEVAMKLAVRSEDLSISDAIHEIVASG  231
            N RSHT L+SGVY G+ KVLVR  FG+D   KE+ MKL+VR++ LSIS+AIHEIVA G
Sbjct  830  NERSHTSLMSGVYTGNVKVLVRAQFGMDSSTKEIMMKLSVRADHLSISEAIHEIVACG  887



>ref|XP_006423249.1| hypothetical protein CICLE_v10027789mg [Citrus clementina]
 gb|ESR36489.1| hypothetical protein CICLE_v10027789mg [Citrus clementina]
Length=860

 Score =   343 bits (881),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 182/237 (77%), Positives = 200/237 (84%), Gaps = 26/237 (11%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVV                          TVIVDASEAEEF+E ASKPL+SLP
Sbjct  650  AETEYAVNVV--------------------------TVIVDASEAEEFAEVASKPLRSLP  683

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ F AFEKPEGVPA+GKFSN LRFIVKEVDP+TG+ E+DGVEDEYQLEDLEVVAA
Sbjct  684  YDSPGQIFGAFEKPEGVPAVGKFSNMLRFIVKEVDPTTGDVEDDGVEDEYQLEDLEVVAA  743

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY++KVGVSNFRNAWE++GPD ERVDEYGLGPR+SLAEAV+AVI+LLGMQPCEGTEVV N
Sbjct  744  DYVMKVGVSNFRNAWESIGPDFERVDEYGLGPRESLAEAVSAVISLLGMQPCEGTEVVAN  803

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            NSRSHTCLLSGV+IG+ KVLVRL FGIDGPKEVAMKLAVRSED ++SD IHEIVASG
Sbjct  804  NSRSHTCLLSGVFIGNVKVLVRLQFGIDGPKEVAMKLAVRSEDDNVSDMIHEIVASG  860



>ref|XP_001780339.1| predicted protein [Physcomitrella patens]
 gb|EDQ54898.1| predicted protein [Physcomitrella patens]
Length=892

 Score =   327 bits (838),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 196/236 (83%), Gaps = 0/236 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKH++  H+VFQ+NCTNTI EQ LENV +++D  E E+F++AASKPL S+P
Sbjct  657  AETEYAVNVVKHVYPGHIVFQFNCTNTIAEQLLENVNIVMDLVEGEDFTQAASKPLASMP  716

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
               PGQ FVAFEKPEG  ++G+FSNT+RF VKEVDPSTG+A++ G EDEYQLEDLE+ A 
Sbjct  717  CGVPGQVFVAFEKPEGACSLGRFSNTMRFYVKEVDPSTGDADDTGYEDEYQLEDLEITAP  776

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LK GVSNFRNAWE++  + ERVDEY LG R++L +AV AV  +LGMQ CE T+VVPN
Sbjct  777  DYILKEGVSNFRNAWESLDSESERVDEYSLGARENLQDAVQAVTTILGMQICEATDVVPN  836

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVAS  234
            N+RSHTCLL+G ++G  +VLVRLS GID  K+VAMKLAVR+ED+++SD IH+I+ S
Sbjct  837  NARSHTCLLAGRFLGDTQVLVRLSVGIDSQKQVAMKLAVRAEDIAVSDIIHDIINS  892



>ref|XP_001760258.1| predicted protein [Physcomitrella patens]
 gb|EDQ75014.1| predicted protein [Physcomitrella patens]
Length=890

 Score =   325 bits (834),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/236 (67%), Positives = 193/236 (82%), Gaps = 0/236 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNV+KH++  H+VFQ+NCTNTI EQ LENVTV+ +  E E+F+  A+KPL S+P
Sbjct  655  AETEYAVNVIKHVYSGHIVFQFNCTNTISEQLLENVTVVSECIEGEDFTHVATKPLASMP  714

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
               PGQ FVAFEKPEG  ++GKFSNTLRF+VKEVDPSTG+A+EDG EDEYQLEDLEV +A
Sbjct  715  CGVPGQAFVAFEKPEGSCSLGKFSNTLRFLVKEVDPSTGDADEDGYEDEYQLEDLEVASA  774

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LK  +SNF+NAWE++  D ERVDEY LG R+ LA+AV AV  +LGMQ CEGT++VP+
Sbjct  775  DYILKTRISNFKNAWESLDSDLERVDEYSLGVREDLADAVQAVTTILGMQTCEGTDIVPS  834

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVAS  234
            N+RSH  LL+G +IG   VLVRLS GID  K+VAMKLAVRSED ++SD IHEI+ S
Sbjct  835  NARSHIWLLAGKFIGDILVLVRLSVGIDSQKQVAMKLAVRSEDPAVSDIIHEIINS  890



>ref|XP_007036527.1| Coatomer gamma-2 subunit / gamma-2 coat protein / gamma-2 COP, 
putative [Theobroma cacao]
 gb|EOY21028.1| Coatomer gamma-2 subunit / gamma-2 coat protein / gamma-2 COP, 
putative [Theobroma cacao]
Length=375

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQYNCTNTIPEQ LEN TVIVDASEAEEF+E A+KPL+SLP
Sbjct  169  AETEYAVNVVKHIFDGHVVFQYNCTNTIPEQLLENATVIVDASEAEEFAEVATKPLRSLP  228

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGVPA+GKFSN LRFI KEVDPSTGEAEEDGVE+EYQLEDLEVVAA
Sbjct  229  YDSPGQTFVAFEKPEGVPAVGKFSNMLRFIAKEVDPSTGEAEEDGVEEEYQLEDLEVVAA  288

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLKVGVSNFRNAWE+MG DCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEG EVVP+
Sbjct  289  DYMLKVGVSNFRNAWESMGADCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGMEVVPS  348

Query  401  NSRS  390
            NSRS
Sbjct  349  NSRS  352



>ref|XP_001754805.1| predicted protein [Physcomitrella patens]
 gb|EDQ80259.1| predicted protein, partial [Physcomitrella patens]
Length=843

 Score =   322 bits (825),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 190/235 (81%), Gaps = 0/235 (0%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEYAVNVVKH++  HVV Q+NCTNTI E  LENV V +D  E E+F++ A+ PL S+P 
Sbjct  609  ETEYAVNVVKHVYPGHVVLQFNCTNTIAEHLLENVNVAMDLIEGEDFNQVATNPLASMPC  668

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
               GQ FVAFEKPEG  ++GKFS+TLRF VKEVDPSTG+A+EDG EDEYQLEDLE+ AAD
Sbjct  669  GVTGQAFVAFEKPEGACSLGKFSSTLRFYVKEVDPSTGDADEDGYEDEYQLEDLEITAAD  728

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            Y+LK GVSNFRNAWE++  + ERVDEY LG R+SL +AV AV  +LGMQ CE T+VVP+N
Sbjct  729  YILKAGVSNFRNAWESLDSESERVDEYSLGTRESLQDAVQAVTTILGMQVCEATDVVPSN  788

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVAS  234
            +RSHTCLL+G ++G  +VLVRLS GID  K+VAMKLAVRSED S+SD IHEI+ S
Sbjct  789  ARSHTCLLAGRFLGDTQVLVRLSVGIDSQKQVAMKLAVRSEDPSVSDIIHEIINS  843



>dbj|BAD94079.1| Nonclathrin coat protein gamma - like protein [Arabidopsis thaliana]
Length=190

 Score =   301 bits (772),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  782  KPLKSLPYDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLE  603
            K L SLPYD+PGQ FV FEKP GVPA+GKFSNTL F+VKEVDPSTGEAE+DGVEDEYQLE
Sbjct  7    KALNSLPYDSPGQAFVVFEKPAGVPAVGKFSNTLTFVVKEVDPSTGEAEDDGVEDEYQLE  66

Query  602  DLEVVAADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCE  423
            DLEVVA DYM+KVGVSNFRNAWE+M  + ERVDEYGLG R+SL EAV AV++LLGMQ CE
Sbjct  67   DLEVVAGDYMVKVGVSNFRNAWESMDEEDERVDEYGLGQRESLGEAVKAVMDLLGMQTCE  126

Query  422  GTEVVPNNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEI  243
            GTE +P N+RSHTCLLSGVYIG+ KVLVR  FG+D  K++AMKL VR+ED+S+++AIHEI
Sbjct  127  GTETIPLNARSHTCLLSGVYIGNVKVLVRAQFGMDSSKDIAMKLTVRAEDVSVAEAIHEI  186

Query  242  VASG  231
            VASG
Sbjct  187  VASG  190



>ref|XP_007042214.1| Coatomer gamma-2 subunit / gamma-2 coat protein / gamma-2 COP, 
putative isoform 2 [Theobroma cacao]
 gb|EOX98045.1| Coatomer gamma-2 subunit / gamma-2 coat protein / gamma-2 COP, 
putative isoform 2 [Theobroma cacao]
Length=869

 Score =   318 bits (814),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHIFD HVVFQ+NCTNTIPEQ LENVTVIVDASEAEEF+E A+KPL+SLP
Sbjct  651  AETEYAVNVVKHIFDGHVVFQFNCTNTIPEQLLENVTVIVDASEAEEFAEVATKPLRSLP  710

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQTFVAFEKPEGV A+GKFSN LRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA
Sbjct  711  YDSPGQTFVAFEKPEGVSAVGKFSNMLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  770

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCE  423
            DYMLKVGVSNFRNAWE+MG DCERVDEYGLGPRDSLAEAVNAVINLLGMQPCE
Sbjct  771  DYMLKVGVSNFRNAWESMGADCERVDEYGLGPRDSLAEAVNAVINLLGMQPCE  823



>gb|AAS21023.1| coatomer protein gamma subunit [Hyacinthus orientalis]
Length=290

 Score =   290 bits (743),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 181/218 (83%), Gaps = 2/218 (1%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKH++D H+VFQYNCTNTIPEQ LENVT+ VDASEAEEFSE ASKPLK+LP
Sbjct  68   AETEYAVNVVKHVYDEHIVFQYNCTNTIPEQLLENVTIFVDASEAEEFSEVASKPLKTLP  127

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
            YD+PGQ+FVAFEKP GVPA+GKFSN L+FIVKEVD +TGEA+++GVEDEYQLE+ EVVAA
Sbjct  128  YDSPGQSFVAFEKPAGVPAVGKFSNMLKFIVKEVDLATGEADDEGVEDEYQLEEFEVVAA  187

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DY+LKVGVSNF+NAW++M P+ ERVDEYGLG R+SL +AVNAV+N+LGMQPCEGTEVV  
Sbjct  188  DYVLKVGVSNFKNAWDSMDPESERVDEYGLGTRESLVDAVNAVVNILGMQPCEGTEVV-L  246

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLA  288
            + R              KVLV L  G+ GP    +KLA
Sbjct  247  SMRGPILACCPACSWHTKVLVTLPLGLMGPTS-CLKLA  283



>ref|XP_004301551.1| PREDICTED: coatomer subunit gamma-like [Fragaria vesca subsp. 
vesca]
Length=894

 Score =   303 bits (776),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 190/242 (79%), Gaps = 6/242 (2%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEYAV+VVKHIFD H+VF+YNC+NTIPE  LE V V VD  E E+F++A  KP+KSLPY
Sbjct  653  ETEYAVSVVKHIFDRHIVFEYNCSNTIPEHLLEKVVVAVDPYEGEDFTQAGYKPIKSLPY  712

Query  758  -DTPGQTFVAFEKPEGVPA-IGKFSNTLRFIVKEVDPSTGEAEED--GVEDEYQLEDLEV  591
             DTPGQ F  FEKP+GVPA +GKFSN LRF V EVDP+ GE  ED  GVEDEYQL+D+EV
Sbjct  713  GDTPGQAFSEFEKPKGVPAAVGKFSNMLRFRVTEVDPTAGEVVEDDNGVEDEYQLDDIEV  772

Query  590  VAADYMLK-VGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTE  414
            V ADYMLK   V +FR+AW+TMGPD E V+EY +  R+SL E V A INLLGMQPCEGTE
Sbjct  773  VPADYMLKGEEVLDFRHAWKTMGPDFELVEEYRVDQRESLGEVVAAAINLLGMQPCEGTE  832

Query  413  VVPNNSRSHTCLLSGVYIGSAKVLVRLSFGID-GPKEVAMKLAVRSEDLSISDAIHEIVA  237
            VV  NSRSH  LLSGVY G+  VLVRLSFG+D   KEV MK+AVRS+D S+S AIH++V 
Sbjct  833  VVAGNSRSHMVLLSGVYTGNVDVLVRLSFGVDSSSKEVVMKVAVRSKDGSVSCAIHDMVE  892

Query  236  SG  231
            SG
Sbjct  893  SG  894



>ref|XP_001762251.1| predicted protein [Physcomitrella patens]
 gb|EDQ73043.1| predicted protein [Physcomitrella patens]
Length=800

 Score =   273 bits (697),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 142/236 (60%), Positives = 176/236 (75%), Gaps = 14/236 (6%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEYAVNVVKHI+ S++VF++NC+NTI EQ LENV  +++  E E+F   A+  L SLP
Sbjct  579  AETEYAVNVVKHIYPSYIVFKFNCSNTISEQLLENVIAVMEGIEGEDFKHVATTTLASLP  638

Query  761  YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAA  582
               PGQTFVAFEKP G    GKFSNTLRF VKEV+ STG+A+ED  EDEYQLE L+V AA
Sbjct  639  CGIPGQTFVAFEKPVGACTFGKFSNTLRFFVKEVELSTGDADEDRYEDEYQLEALKVTAA  698

Query  581  DYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPN  402
            DYMLK+G+              ERVDEY L  R++LA+A+ A   +LGMQ CEGT+VVP+
Sbjct  699  DYMLKMGL--------------ERVDEYSLDVRENLADALQAATTILGMQTCEGTDVVPS  744

Query  401  NSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVAS  234
            N+RSHTCLL+G+++G  +VLV LS GID  K+VAMKL VRSED ++SD IHEI+ S
Sbjct  745  NARSHTCLLAGIFLGDIQVLVCLSVGIDSQKQVAMKLEVRSEDPAVSDIIHEIINS  800



>ref|XP_002946805.1| hypothetical protein VOLCADRAFT_72994 [Volvox carteri f. nagariensis]
 gb|EFJ52031.1| hypothetical protein VOLCADRAFT_72994 [Volvox carteri f. nagariensis]
Length=884

 Score =   272 bits (696),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 173/233 (74%), Gaps = 0/233 (0%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            +TEYAV  VKHI++SH+VFQ+NCTNTI EQ LE+V+V +D +EA +F EA + PL ++P 
Sbjct  649  DTEYAVFCVKHIYESHIVFQFNCTNTIAEQVLEDVSVAMDLAEAADFEEAFTVPLDTMPL  708

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
            +  GQ F    +  G  A GK  N L+F VKE+DP TGEAEE+G +DEYQLEDLEV  AD
Sbjct  709  NGVGQCFTVVSRQPGAIATGKVVNILKFKVKEIDPGTGEAEEEGYDDEYQLEDLEVTPAD  768

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            Y+    + NFR AWE + P  E+ DEYGLG R+ L EAV AVI +LGMQPCEG+E VP N
Sbjct  769  YVKPTLLGNFRKAWEELDPATEKEDEYGLGTREGLQEAVEAVIGILGMQPCEGSEAVPPN  828

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIV  240
            +RSHT LL+G+++G  +VLVR+SFGID    VAMKL VR+E L +S+AIH+I+
Sbjct  829  ARSHTVLLAGIFVGYQQVLVRMSFGIDSASNVAMKLVVRAESLELSEAIHQII  881



>ref|XP_002990584.1| hypothetical protein SELMODRAFT_185391 [Selaginella moellendorffii]
 gb|EFJ08461.1| hypothetical protein SELMODRAFT_185391 [Selaginella moellendorffii]
Length=886

 Score =   272 bits (695),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 180/236 (76%), Gaps = 3/236 (1%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEY+VN VKHI+  HVVF++NCTNT+ EQ LE VTV+VD SEAE+F E  S+ + SLPY
Sbjct  654  ETEYSVNAVKHIYAEHVVFEFNCTNTVAEQVLEKVTVVVDGSEAEDFQELLSRSIPSLPY  713

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
             +PGQ +V F+KPEGV + GKF+NT++F++KEVDP+T + E++G +DEYQLEDL+V AAD
Sbjct  714  GSPGQAYVVFQKPEGV-STGKFANTMKFVLKEVDPTTNQPEDEGYDDEYQLEDLQVTAAD  772

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            Y +K  V +F++ WE++  + E   EYGLGPR+S+ EAV AVI +LGMQPCEG+EVV  N
Sbjct  773  YFVKTSVVSFKSTWESLQSEFEA--EYGLGPRESVQEAVQAVIGILGMQPCEGSEVVAAN  830

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            +RSH C L+  ++G  +VLV+L+FG+D  K V MKL  RS+D  +   +H+I+ + 
Sbjct  831  ARSHVCFLAAKFLGEIQVLVKLAFGMDAKKAVMMKLTARSDDEGVCSIVHDIIGNA  886



>ref|XP_002983626.1| hypothetical protein SELMODRAFT_268757 [Selaginella moellendorffii]
 gb|EFJ15122.1| hypothetical protein SELMODRAFT_268757 [Selaginella moellendorffii]
Length=886

 Score =   272 bits (695),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 180/236 (76%), Gaps = 3/236 (1%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEY+VN VKHI+  HVVF++NCTNT+ EQ LE VTV+VD SEAE+F E  S+ + SLPY
Sbjct  654  ETEYSVNAVKHIYAEHVVFEFNCTNTVAEQVLEKVTVVVDGSEAEDFQELLSRSIPSLPY  713

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
             +PGQ +V F+KPEGV + GKF+NT++F++KEVDP+T + E++G +DEYQLEDL+V AAD
Sbjct  714  GSPGQAYVVFQKPEGV-STGKFANTMKFVLKEVDPTTNQPEDEGYDDEYQLEDLQVTAAD  772

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            Y +K  V +F++ WE++  + E   EYGLGPR+S+ EAV AVI +LGMQPCEG+EVV  N
Sbjct  773  YFVKTSVVSFKSTWESLQSEFEA--EYGLGPRESVQEAVQAVIGILGMQPCEGSEVVAAN  830

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            +RSH C L+  ++G  +VLV+L+FG+D  K V MKL  RS+D  +   +H+I+ + 
Sbjct  831  ARSHVCFLAAKFLGEIQVLVKLAFGMDAKKAVMMKLTARSDDEGVCSIVHDIIGNA  886



>ref|XP_001691193.1| gamma-cop [Chlamydomonas reinhardtii]
 gb|EDP04926.1| gamma-cop [Chlamydomonas reinhardtii]
Length=883

 Score =   265 bits (676),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 172/233 (74%), Gaps = 0/233 (0%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            +TEYA+  VKH+F+ H+VFQ+NCTNTI EQ LE+V+V +D ++A +F EA + PL ++P 
Sbjct  648  DTEYAIFCVKHVFEGHIVFQFNCTNTIAEQVLEDVSVAMDLADAGDFEEAFTIPLDTMPL  707

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
            +  GQ +    +P G  A GK  N L+F VKE+DP TGEAEE+G +DEY LEDLEV  AD
Sbjct  708  NGVGQCYTVVTRPPGAIATGKIVNILKFKVKEIDPGTGEAEEEGYDDEYVLEDLEVSPAD  767

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            Y+    +SNFR +WE + P  E+ DEYGLG R+ L EAV AVI +LGMQPCEG+E VP N
Sbjct  768  YVKPTLLSNFRKSWEELDPSTEKEDEYGLGVREGLQEAVEAVIGILGMQPCEGSEAVPPN  827

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIV  240
            +RSHT LL+G+++G  +VLVR+S GID    VAMKL VR+E L +S+A+H+I+
Sbjct  828  ARSHTVLLAGIFVGYQQVLVRMSSGIDAANNVAMKLVVRAESLELSEAVHQII  880



>ref|XP_005651915.1| Coatomer, gamma subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE27371.1| Coatomer, gamma subunit [Coccomyxa subellipsoidea C-169]
Length=866

 Score =   254 bits (650),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 170/235 (72%), Gaps = 0/235 (0%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPY  759
            ETEY + VV HIF +HV+ Q+NCTNT+ EQ LENV+V VD SEAEEF +  S PL  + Y
Sbjct  632  ETEYNIAVVVHIFAAHVLLQFNCTNTVQEQVLENVSVAVDLSEAEEFEQELSLPLARMEY  691

Query  758  DTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVAAD  579
             + GQT+V  ++P    ++GK    L+F VKE+DPS+GEAEEDG EDEYQLED+++ AA+
Sbjct  692  GSVGQTYVLLQRPPDSLSMGKLGANLQFTVKEIDPSSGEAEEDGYEDEYQLEDIDIGAAN  751

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            Y+  V VSNFR AWE   P  E  D+YGLG RDSL +AV AV+++LGM PC+G++ VP N
Sbjct  752  YIKAVPVSNFRKAWEDTDPASEISDDYGLGVRDSLQDAVEAVMSILGMAPCDGSDAVPPN  811

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVAS  234
            +RSHT LL+G ++G    L R+SFGID  + VAMKL  RS+   ISD +H+I+ S
Sbjct  812  ARSHTLLLAGHFVGDVPALARISFGIDIGRNVAMKLVSRSDQHEISDFLHQIIQS  866



>ref|XP_005847180.1| hypothetical protein CHLNCDRAFT_31542 [Chlorella variabilis]
 gb|EFN55078.1| hypothetical protein CHLNCDRAFT_31542 [Chlorella variabilis]
Length=910

 Score =   243 bits (619),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 175/235 (74%), Gaps = 2/235 (1%)
 Frame = -1

Query  938  ETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP-  762
            ETEY V  V+H+ + H+VFQ+NCTNT+ EQ LE+V+V +D ++AEEFSE A  PLK +P 
Sbjct  673  ETEYKVVCVRHVLEGHIVFQFNCTNTVREQVLEDVSVTMDLADAEEFSEEAVLPLKVMPG  732

Query  761  -YDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVA  585
              + PGQT+V   +P G  A+G+F N LRF +KE+DP+TGEAEE+G EDEYQLED+EV A
Sbjct  733  VEEGPGQTYVVLARPPGSMALGRFLNILRFRIKEIDPTTGEAEEEGYEDEYQLEDVEVAA  792

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
            ADY+      NFR  W+ +  + E VD+YG+G RDSL +AV AV  +LGMQ CEGT+ VP
Sbjct  793  ADYIKPAFAPNFRAGWDALPEESEMVDDYGIGQRDSLQDAVEAVGRILGMQACEGTDAVP  852

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIV  240
             N+RSHT LLSG+ +G  +VLVRLSFGID  + VAMKLAVRSE   +S+AIH I+
Sbjct  853  PNARSHTLLLSGIVVGDVQVLVRLSFGIDAQRNVAMKLAVRSESADVSEAIHAII  907



>ref|XP_003056073.1| coatomer protein gamma-subunit [Micromonas pusilla CCMP1545]
 gb|EEH59449.1| coatomer protein gamma-subunit [Micromonas pusilla CCMP1545]
Length=893

 Score =   230 bits (587),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 154/236 (65%), Gaps = 1/236 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSK-PLKSL  765
            AETEY V  +KH+F  HVVFQ+ CTNTI EQ LENV+V ++  +     E  +  PL+S+
Sbjct  656  AETEYKVTCIKHVFKLHVVFQFKCTNTIKEQVLENVSVAMELLDGAGCFEECASIPLESM  715

Query  764  PYDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVA  585
            P    G T+VAF + EG     KF+ TL+F  KEVDP +   EE G EDEY +ED+E+  
Sbjct  716  PLGKSGSTYVAFSRVEGKRFSAKFACTLKFTSKEVDPISDIPEECGYEDEYTIEDVELSL  775

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
             D+M    +SNFR AW+ +  + E  +EY LG R+SL EAV  V  +LG+QPCEGT  VP
Sbjct  776  LDFMCMTPLSNFRKAWDALPIETETANEYSLGKRESLGEAVETVTKVLGLQPCEGTGAVP  835

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVA  237
             N+RSHT LLSG Y+G   +LVRL+ GID   EVA+KL  R+ED S+S+    IV+
Sbjct  836  PNARSHTALLSGTYVGDVALLVRLNLGIDVSNEVALKLTARAEDASVSEVAQLIVS  891



>ref|XP_007509254.1| coatomer protein gamma-subunit [Bathycoccus prasinos]
 emb|CCO19711.1| coatomer protein gamma-subunit [Bathycoccus prasinos]
Length=924

 Score =   226 bits (577),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/254 (46%), Positives = 162/254 (64%), Gaps = 17/254 (7%)
 Frame = -1

Query  941  AETEYAVNV----------------VKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDase  810
            AETEY VN+                + H+F SHVVF++ CTNTI EQ LE+++V ++  E
Sbjct  671  AETEYKVNLSNIKFISTHVLSQVTCIVHLFQSHVVFEFKCTNTIEEQVLEDISVSMEMIE  730

Query  809  aeefseaaSK-PLKSLPYDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEE  633
              +F    S   L  +P    G TFV F++ EGV    KFS  LRF  KE+DP+TGE EE
Sbjct  731  GVDFLAENSTISLDRMPLGDEGSTFVIFDRKEGVFEQAKFSCILRFTSKEIDPATGEPEE  790

Query  632  DGVEDEYQLEDLEVVAADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAV  453
            +G +DEY LED+++   DY+    +SNF+ AW+++  +CE   +Y +G R+ L +AV  V
Sbjct  791  EGYDDEYTLEDVDLKLTDYLRPTNISNFKKAWDSLSEECECSSDYDIGKREGLQQAVEMV  850

Query  452  INLLGMQPCEGTEVVPNNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSED  273
            IN++G QPCEGTE VP NSRSH+ LLSGV IG ++VL+R +FG+D    V MK+  RSE 
Sbjct  851  INIIGCQPCEGTEAVPPNSRSHSTLLSGVCIGESQVLIRTNFGLDELNNVTMKITARSER  910

Query  272  LSISDAIHEIVASG  231
            L IS+ +H I+++ 
Sbjct  911  LDISELVHAIISNS  924



>ref|XP_002507482.1| coatomer protein gamma-subunit [Micromonas sp. RCC299]
 gb|ACO68740.1| coatomer protein gamma-subunit [Micromonas sp. RCC299]
Length=897

 Score =   220 bits (560),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 156/236 (66%), Gaps = 1/236 (0%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSK-PLKSL  765
            AETEY V   KHIF  H+VF + C+NTI +Q LENV+V+ D  E  E     S  PL ++
Sbjct  660  AETEYKVTCTKHIFKEHIVFHFMCSNTIEDQILENVSVVTDPIEGIEVFAKVSTIPLGTM  719

Query  764  PYDTPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVA  585
            P    G TFV++++ +G+  + K + TL+F  KE+DPS+GE E +G EDEY LED++V  
Sbjct  720  PLGQFGSTFVSYKRAQGLHPVAKMACTLKFTSKEIDPSSGEPESEGYEDEYTLEDIDVTV  779

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
             D++    +S FR  W+T+  + E+V +Y LG RDSL EA+ AV+ +LGM  CEG+EV+ 
Sbjct  780  TDFLTGNPLSAFRKVWDTLPIENEKVGDYSLGTRDSLGEALEAVVGILGMAACEGSEVIA  839

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVA  237
             ++RSHT LLSG ++G   VLV+L+ G+     VAMKL VR+E   I+D IH +V+
Sbjct  840  PHARSHTTLLSGFFVGGHSVLVQLNLGMGPSNSVAMKLIVRAEKPYIADMIHTLVS  895



>gb|ACF81600.1| unknown [Zea mays]
Length=115

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -1

Query  575  MLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNNS  396
            MLKVGVSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGT+VVP+NS
Sbjct  1    MLKVGVSNFRNAWENMDPETERVDEYGLGVRESLAEAVSAVISILGMQPCEGTDVVPSNS  60

Query  395  RSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            RSHTCLLSGV+IG+ KVLVRLSFGI  PKEVAMKLAVRS+D  ISD IHEIVA+G
Sbjct  61   RSHTCLLSGVFIGNVKVLVRLSFGISAPKEVAMKLAVRSDDPEISDKIHEIVANG  115



>gb|AFB33382.1| hypothetical protein 2_4723_01, partial [Pinus cembra]
 gb|AFB33383.1| hypothetical protein 2_4723_01, partial [Pinus cembra]
Length=115

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = -1

Query  575  MLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNNS  396
            MLKVGVSNF+NAWE++G D ERVDEYGLG R+SL+EAV AVINLLGMQ CEGT+VVP+NS
Sbjct  1    MLKVGVSNFKNAWESLGADFERVDEYGLGVRESLSEAVQAVINLLGMQGCEGTDVVPSNS  60

Query  395  RSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            RSHTCLL+G +IG+ +VLVRLSFGIDGPK+VAMKLAVRSED  +SDAIHEIVA+G
Sbjct  61   RSHTCLLAGRFIGNVQVLVRLSFGIDGPKQVAMKLAVRSEDQFVSDAIHEIVANG  115



>ref|NP_001132286.1| uncharacterized protein LOC100193726 [Zea mays]
 gb|ACF81072.1| unknown [Zea mays]
Length=115

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -1

Query  575  MLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNNS  396
            MLKVGVSNFRNAWE M P+ ERVDEYGLG R+SLAEAV+AVI++LGMQPCEGT+VVP+NS
Sbjct  1    MLKVGVSNFRNAWENMDPETERVDEYGLGVRESLAEAVSAVISILGMQPCEGTDVVPSNS  60

Query  395  RSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVASG  231
            RSHTCLLSGV+IG+ KVLVRLSFGI  PKEVAMKLAVRS+D  ISD IHEIVA+G
Sbjct  61   RSHTCLLSGVFIGNVKVLVRLSFGISAPKEVAMKLAVRSDDPEISDRIHEIVANG  115



>ref|XP_009867475.1| PREDICTED: coatomer subunit gamma-2-like, partial [Apaloderma 
vittatum]
Length=356

 Score =   185 bits (470),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V   KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  124  AETEYFVRCTKHVFTNHMVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  181

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  PA     FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  182  YNQPGMCYTLVQIPQDDPAAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  241

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  242  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  301

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  302  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETAVDVI  351



>ref|XP_010154598.1| PREDICTED: coatomer subunit gamma-2-like, partial [Eurypyga helias]
Length=356

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  124  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  181

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  182  YNQPGMCYTLVQVPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  241

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  242  VSDHIQKVLKPNFAAAWEEVGEDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  301

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  302  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  351



>ref|XP_010179997.1| PREDICTED: coatomer subunit gamma-2-like, partial [Mesitornis 
unicolor]
Length=279

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  +L 
Sbjct  47   AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--NLA  104

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  105  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  164

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN ++  LGMQPCE ++ V
Sbjct  165  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIVKFLGMQPCERSDKV  224

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  225  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  274



>ref|XP_004341555.1| coatomer subunit gamma, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR19469.1| coatomer subunit gamma, putative [Acanthamoeba castellanii str. 
Neff]
Length=876

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 140/224 (63%), Gaps = 4/224 (2%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEY VN VKHIF  HVVFQ+NCTNT+  Q LENV V +DAS A  F         SL 
Sbjct  641  SETEYVVNCVKHIFAEHVVFQFNCTNTLDAQVLENVVVKMDASSAPGFRVEWELEASSLV  700

Query  761  YDTPGQTFV-AFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVA  585
            Y  PG  +V A   PE  P  G F N L+F VK+VDP+TGEA+E G ED+Y L++L+V  
Sbjct  701  YGVPGAAYVCASHDPEAYPT-GSFGNVLKFQVKDVDPATGEADETGYEDQYPLDNLDVTV  759

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
            ADYM K   ++F++ W  +G D E V+ + L    SL +AVN +I+ LGMQ C+ TEVVP
Sbjct  760  ADYMKKTYCTSFKDEWAALGEDNELVEIFALSTMKSLKDAVNEIIDFLGMQACDKTEVVP  819

Query  404  NNSRSHTCLLSGVYI-GSAKVLVRLSFGIDGPKE-VAMKLAVRS  279
                 H  LLSG ++ G+A  LVR+   +D     V+M+L VRS
Sbjct  820  PKRTKHILLLSGSFVDGNAPALVRIRMKMDDSAPGVSMELTVRS  863



>ref|XP_009708582.1| PREDICTED: coatomer subunit gamma-2, partial [Cariama cristata]
Length=381

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  149  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  206

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  207  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGMPEEDGYDDEYVLEDLEVT  266

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  267  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  326

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  327  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  376



>ref|XP_009058878.1| hypothetical protein LOTGIDRAFT_191967 [Lottia gigantea]
 gb|ESO90558.1| hypothetical protein LOTGIDRAFT_191967 [Lottia gigantea]
Length=876

 Score =   191 bits (485),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/236 (44%), Positives = 145/236 (61%), Gaps = 3/236 (1%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEY +  VKH F  +VVFQ++CTNT+ +Q LENVTV ++  +  E  +       SLP
Sbjct  643  SETEYVIQCVKHTFSHYVVFQFDCTNTLNDQVLENVTVHMEGGDGFEVMKYVK--CASLP  700

Query  761  YDTPGQTFVAFEKPEGVPAI-GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVA  585
            YD PG T+     PE   A+ G F+ +L+FIVK+ DP+TGE +++G EDEY LED+EV  
Sbjct  701  YDKPGITYTLIRLPEEPTAVTGTFTCSLKFIVKDCDPNTGEPDDEGYEDEYVLEDVEVTV  760

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
            AD++ +V   NF  +WE +GP+ E  D Y L   +SL EAV  ++  LGMQPCE ++ VP
Sbjct  761  ADHVQRVIKPNFGASWEEVGPENELEDTYALSSMNSLEEAVKNIVLYLGMQPCERSDKVP  820

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVA  237
                SHT  L+GV+ G    LVR    +     V M+L VRS D ++S+ +   +A
Sbjct  821  EGKSSHTLYLAGVFRGGHDALVRAKLALTDDSGVTMQLTVRSSDPNVSEILASAIA  876



>ref|XP_008496567.1| PREDICTED: coatomer subunit gamma-2, partial [Calypte anna]
Length=368

 Score =   183 bits (464),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KHIF +H+VFQ++CTNT+ +Q LE VTV ++ S+  +       P  +LP
Sbjct  136  AETEYFVRCIKHIFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDGYDVICCIPAP--TLP  193

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ P   +   + P+  P      FS T++F V++ DP+TG  E+DG +DEY LEDLEV 
Sbjct  194  YNQPAMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEDDGYDDEYVLEDLEVT  253

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  254  VSDHIQKVLKPNFAAAWEEVGEDFEKEETFALSSIKTLDEAVNNIITFLGMQPCERSDKV  313

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VL+R    + DG   V M++ VRS++ +  D I
Sbjct  314  PENKNSHTLYLAGVYRGGCDVLLRSRLALGDG---VTMQVTVRSKEETPGDVI  363



>ref|XP_002600091.1| hypothetical protein BRAFLDRAFT_265302 [Branchiostoma floridae]
 gb|EEN56103.1| hypothetical protein BRAFLDRAFT_265302 [Branchiostoma floridae]
Length=564

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 146/239 (61%), Gaps = 13/239 (5%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQ-------YNCTNTIPEQQLENVTVIVDaseaeefseaaS  783
            +ETEY V  +KH F +H+VFQ       ++CTNT+ +Q LENVTV ++ +E  E      
Sbjct  325  SETEYVVRCIKHTFTNHIVFQASSCCLFFDCTNTLNDQILENVTVQMEPTEGFEVLSYV-  383

Query  782  KPLKSLPYDTPGQTFVAFEKPEGVPA--IGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQ  609
             P  SLPY  PG T+     PE  P   IG FSNTL+F+VK+ DP+TGE +E+G EDEY 
Sbjct  384  -PAASLPYGQPGITYTCVTLPEDDPTSVIGTFSNTLKFLVKDCDPNTGEPDEEGYEDEYV  442

Query  608  LEDLEVVAADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQP  429
            LED+EV  AD++ KV   NF  +W+ +G D +  D Y L    +L +AV  +++ +GMQP
Sbjct  443  LEDVEVTIADHIQKVLKPNFAASWDEVGEDYQMEDTYALSTVKTLEDAVKNIVDHMGMQP  502

Query  428  CEGTEVVPNNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAI  252
            CE ++ VP +  +HT  L+GVY G   VLVR    +D    V M++ VRS D + ++ I
Sbjct  503  CERSDKVPADKSAHTLFLAGVYRGGHDVLVRARLAVDDG--VTMQITVRSTDETAAEVI  559



>ref|XP_001632631.1| predicted protein [Nematostella vectensis]
 gb|EDO40568.1| predicted protein [Nematostella vectensis]
Length=881

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 149/231 (65%), Gaps = 4/231 (2%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEY VN VKH+F+ H+VFQ++CTNT+ +Q LENV V +D S+ E       +   SLP
Sbjct  649  SETEYVVNCVKHVFNDHIVFQFDCTNTLNDQVLENVKVEMDPSDGEFEVVCQIE-CPSLP  707

Query  761  YDTPGQTFVAFEKPEGVPAIG-KFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVA  585
            Y+ PG T+   + PE   ++   FSNTL+F+VK+ DPSTGEA+EDG EDEY LED++VV 
Sbjct  708  YNQPGTTYTLIKLPEDHSSVTCTFSNTLKFLVKDCDPSTGEADEDGYEDEYVLEDVDVVV  767

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
            AD++ +V   NF  +WE +G +CE  D Y L    SL EAV  +I  LGMQPCE ++ VP
Sbjct  768  ADHVQQVHRPNFLASWEEIGDECELEDTYALTSMSSLEEAVKQIIEYLGMQPCERSDRVP  827

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAI  252
                SH  LL+GVY G   VLV+     D  + V M + VRS D ++S+ I
Sbjct  828  EGKSSHALLLAGVYRGGHDVLVKTRLAFD--QGVTMNITVRSRDSTVSEVI  876



>ref|XP_009095725.1| PREDICTED: coatomer subunit gamma-2 [Serinus canaria]
Length=872

 Score =   189 bits (481),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 142/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+  +       P  SL 
Sbjct  640  AETEYFVRCIKHVFPAHIVFQFDCTNTLNDQLLERVTVQMEPSDGYDVICCIPAP--SLA  697

Query  761  YDTPGQTFVAFEKPEGVPA--IGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T++F V++ DPSTG  EEDG EDEY LEDLEV 
Sbjct  698  YNQPGMCYTLVRIPQDDPTAVTCTFSCTMKFTVRDCDPSTGVPEEDGYEDEYVLEDLEVT  757

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  758  VSDHLQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  817

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS+D +  D I
Sbjct  818  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKDETSVDVI  867



>gb|KFP52544.1| Coatomer subunit gamma-2, partial [Cathartes aura]
Length=678

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F  H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SLP
Sbjct  446  AETEYFVRCIKHVFTKHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLP  503

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  504  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  563

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  564  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  623

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  624  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  673



>ref|XP_005533148.1| PREDICTED: coatomer subunit gamma-2 [Pseudopodoces humilis]
Length=871

 Score =   189 bits (480),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 142/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KHIF +H+VFQ++CTNT+ +Q LE VTV V+ S+A +       P  SL 
Sbjct  639  AETEYFVRCIKHIFPNHIVFQFDCTNTLNDQLLERVTVQVEPSDAYDVVCCIPAP--SLA  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T+RF V++ DP TG  EE+G EDEY LEDLEV 
Sbjct  697  YNQPGMCYTLVSIPQDDPTAVACTFSCTMRFTVRDCDPGTGLPEEEGYEDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHLQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS+D +  D I
Sbjct  817  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKDETSVDVI  866



>ref|XP_005100396.1| PREDICTED: coatomer subunit gamma-2-like [Aplysia californica]
Length=818

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 146/236 (62%), Gaps = 4/236 (2%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEY +  VKH F +++VFQ++CTNT+ +Q LENVTV  D   AE F  + S P  +LP
Sbjct  586  SETEYYIQCVKHTFSNYIVFQFDCTNTLNDQLLENVTV--DMEPAEGFEVSKSIPCVNLP  643

Query  761  YDTPGQTFVAFEKP-EGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVA  585
            Y+ PG T+     P E     G F+ TL+F+VK+ DP TGE +++G +DEY LED+EV  
Sbjct  644  YNKPGSTYTLVRLPSEPTQVTGTFACTLKFLVKDCDPQTGEPDDEGYDDEYVLEDVEVTV  703

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
            AD++ +V   NF  +WE +GP+ E  D Y L   ++L EA+  +I  +G+QPCE ++ VP
Sbjct  704  ADHVQRVMKPNFAASWEEVGPENELEDTYSLSTMNTLEEAIKNIIQYIGLQPCERSDKVP  763

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVA  237
                SHT  L+GV+ G    LVR    +D    V M+L VRS D ++S+ +   VA
Sbjct  764  EGKSSHTLYLAGVFRGGHDALVRAKLALDSSG-VTMQLTVRSTDPNVSEVLATAVA  818



>ref|XP_005039038.1| PREDICTED: coatomer subunit gamma-2 [Ficedula albicollis]
Length=871

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KHIF +H+VFQ++CTNT+ +Q LE VTV ++ ++A +       P  SL 
Sbjct  639  AETEYFVCCIKHIFPNHIVFQFDCTNTLNDQLLERVTVQMEPADAYDVICCIPAP--SLA  696

Query  761  YDTPGQTFVAFEKPEGVPA--IGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T++F V++ DP+TG  EEDG EDEY LEDLEV 
Sbjct  697  YNQPGMCYTLVRIPQDDPTAVTCTFSCTMKFTVRDCDPNTGVPEEDGYEDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHLQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G + VLVR    + DG   V M++ VRS+D +  D I
Sbjct  817  PENKNSHTLYLAGVYRGGSDVLVRSRLALGDG---VTMQVTVRSKDETSVDVI  866



>ref|XP_005793201.1| coatomer protein gamma 2 subunit [Emiliania huxleyi CCMP1516]
 gb|EOD40772.1| coatomer protein gamma 2 subunit [Emiliania huxleyi CCMP1516]
Length=873

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 143/234 (61%), Gaps = 3/234 (1%)
 Frame = -1

Query  935  TEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPYD  756
            TEY V   KH++ SH++  +   NT+ +Q L +VTV +D +     +     P  SLP+ 
Sbjct  642  TEYEVVCTKHLYASHLILAFQLNNTLEDQLLSSVTVALDLAAVPGLALETHVPCASLPFG  701

Query  755  TPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAE-EDGVEDEYQLEDLEVVAAD  579
             PG  +    + EGVP +G    TL+F+VK+VDP+TG  + E G EDEYQLE+LEV AAD
Sbjct  702  QPGTAYACLRRLEGVP-VGTIPCTLKFVVKDVDPATGPTDDEPGYEDEYQLEELEVCAAD  760

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            +M +V V +FR AWE++G  CE V+ + L   +S+ +A+ AVI+ LGM PCE +   P++
Sbjct  761  FMKRVAVLDFRAAWESVGNGCEVVETFSLS-YNSIRQAMEAVIDFLGMSPCENSAAAPDD  819

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVA  237
                T LLSGV++G  +V   ++   D  + V M+L VRS D+++S  +   VA
Sbjct  820  VTKLTVLLSGVFLGGMQVFAIVNLRADSNRAVGMRLTVRSSDMTVSQFVASSVA  873



>gb|AAF05718.1|AF191562_1 coatomer protein gamma2-COP [Danio rerio]
Length=410

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 142/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH F +H++FQ++CTNT+ +Q L+ V  +V    +E +      P  +LP
Sbjct  178  AETEYVVRFIKHTFANHMIFQFDCTNTLNDQLLQKV--LVQMEPSESYEVLHYVPAANLP  235

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y  PG  +     PE  P      FS T++++V++ DP+TGE ++DG +DEY LEDLEV 
Sbjct  236  YSQPGSCYSLVRLPEDDPTAVSCTFSCTMKYLVRDCDPNTGEPDDDGYDDEYVLEDLEVT  295

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             AD++ KV   NF  AW+ +G +CE+ + + L    +L EAVN +++ LGMQPCE ++ V
Sbjct  296  VADHIQKVLKPNFAAAWDEVGDECEKEETFALATVRTLDEAVNNIVSFLGMQPCERSDKV  355

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH   L+GV+ G   VLVR    + DG   V M++ VRS D ++ D I
Sbjct  356  PENKNSHVLFLAGVFRGGHDVLVRARLALADG---VTMQVTVRSTDDNVVDVI  405



>ref|XP_005793200.1| COPG1, gamma subunit of the coatomer [Emiliania huxleyi CCMP1516]
 gb|EOD40771.1| COPG1, gamma subunit of the coatomer [Emiliania huxleyi CCMP1516]
Length=916

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 143/234 (61%), Gaps = 3/234 (1%)
 Frame = -1

Query  935  TEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLPYD  756
            TEY V   KH++ SH++  +   NT+ +Q L +VTV +D +     +     P  SLP+ 
Sbjct  685  TEYEVVCTKHLYASHLILAFQLNNTLEDQLLSSVTVALDLAAVPGLALETHVPCASLPFG  744

Query  755  TPGQTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAE-EDGVEDEYQLEDLEVVAAD  579
             PG  +    + EGVP +G    TL+F+VK+VDP+TG  + E G EDEYQLE+LEV AAD
Sbjct  745  QPGTAYACLRRLEGVP-VGTIPCTLKFVVKDVDPATGPTDDEPGYEDEYQLEELEVCAAD  803

Query  578  YMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVPNN  399
            +M +V V +FR AWE++G  CE V+ + L   +S+ +A+ AVI+ LGM PCE +   P++
Sbjct  804  FMKRVAVLDFRAAWESVGNGCEVVETFSLS-YNSIRQAMEAVIDFLGMSPCENSAAAPDD  862

Query  398  SRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIVA  237
                T LLSGV++G  +V   ++   D  + V M+L VRS D+++S  +   VA
Sbjct  863  VTKLTVLLSGVFLGGMQVFAIVNLRADSNRAVGMRLTVRSSDMTVSQFVASSVA  916



>ref|XP_008047553.1| PREDICTED: coatomer subunit gamma-2, partial [Tarsius syrichta]
Length=495

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  263  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLCCVPAP--SLP  320

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  321  YNQPGTCYTLVRLPDDDPTAVAGTFSCTMKFTVRDCDPNTGAPDEDGYDDEYVLEDLEVT  380

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN V+  LGMQPCE ++ V
Sbjct  381  VSDHIQKVLKPNFAAAWEEVGDIFEKEETFALSSTKTLEEAVNNVVTFLGMQPCERSDKV  440

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS + +  D I
Sbjct  441  PENKNSHSLYLAGVYRGGCDLLVRSRLALADG---VTMQVTVRSRERTPVDVI  490



>ref|XP_010196175.1| PREDICTED: coatomer subunit gamma-2-like, partial [Colius striatus]
Length=356

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  124  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  181

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  E+DG +DEY LEDLEV 
Sbjct  182  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEDDGYDDEYVLEDLEVT  241

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  242  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  301

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
              N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  302  AENKNSHTLYLAGVYRGGCDVLVRSRLALADG---VTMQVTVRSKEETPGDVI  351



>ref|XP_009962331.1| PREDICTED: coatomer subunit gamma-2, partial [Tyto alba]
Length=858

 Score =   187 bits (476),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SLP
Sbjct  626  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLP  683

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P   P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  684  YNQPGMCYTLVQIPRDDPTAVACTFSCTMKFSVRDCDPNTGVPEEDGYDDEYVLEDLEVT  743

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  744  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  803

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  804  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPGDVI  853



>ref|XP_010706784.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Meleagris gallopavo]
Length=785

 Score =   187 bits (475),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 142/226 (63%), Gaps = 8/226 (4%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  553  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  610

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  611  YNQPGMCYTLVQMPQADPTAVACTFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  670

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + LG   +L EAVN +I  LGMQPCE ++ V
Sbjct  671  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALGSIKTLDEAVNNIIKFLGMQPCERSDKV  730

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSED  273
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++
Sbjct  731  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKE  773



>gb|KFV47491.1| Coatomer subunit gamma-2, partial [Tyto alba]
Length=860

 Score =   187 bits (476),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SLP
Sbjct  628  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLP  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P   P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPRDDPTAVACTFSCTMKFSVRDCDPNTGVPEEDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPGDVI  855



>ref|XP_414981.2| PREDICTED: coatomer subunit gamma-2 isoform X2 [Gallus gallus]
Length=871

 Score =   187 bits (476),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 142/226 (63%), Gaps = 8/226 (4%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  639  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  697  YNQPGMCYTLVQMPQDDPTAVACTFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + LG   +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALGSIKTLDEAVNNIIKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSED  273
            P N  SHT  LSGVY G   VLVR    + DG   V M++ VRS++
Sbjct  817  PENKNSHTLYLSGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKE  859



>ref|XP_005679647.1| PREDICTED: coatomer subunit gamma-2 [Capra hircus]
Length=872

 Score =   187 bits (475),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  VKH+F +H+VFQ++CTNT+ +Q LE VTV V+ SE+ E       P  SLP
Sbjct  640  AETEYFVRCVKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPSESHEVLCCIPAP--SLP  697

Query  761  YDTPGQTFVAFEKPE--GVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     PE   V A G FS T+RF V++ DP TG   E+G +DEY LEDLEV 
Sbjct  698  YNQPGVCYTLVRLPEDDSVAATGTFSCTMRFTVRDCDPDTGVPAEEGYDDEYVLEDLEVT  757

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  758  VSDHIQKVMKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  817

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  818  PENKNSHSLYLAGVYRGGYDLLVRSRLALADG---VTMQVTVRSKEGTPVDVI  867



>ref|XP_010281384.1| PREDICTED: coatomer subunit gamma-2 [Phaethon lepturus]
Length=863

 Score =   187 bits (475),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 145/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY +  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  631  AETEYFIRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  688

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  689  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  748

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  749  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  808

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY GS  VLVR    + DG   V M++ VRS++ +  D I
Sbjct  809  PENKNSHTLCLAGVYRGSCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  858



>gb|KFQ66228.1| Coatomer subunit gamma-2, partial [Phaethon lepturus]
Length=860

 Score =   187 bits (475),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 145/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY +  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  628  AETEYFIRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY GS  VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLCLAGVYRGSCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  855



>ref|XP_005427027.1| PREDICTED: coatomer subunit gamma-2 [Geospiza fortis]
Length=975

 Score =   188 bits (477),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 142/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ SE  +       P  SL 
Sbjct  743  AETEYFVRCIKHVFPAHIVFQFDCTNTLNDQLLERVTVQMEPSEGYDVICCIPAP--SLA  800

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T++F V++ DPSTG  EEDG EDEY LEDLEV 
Sbjct  801  YNQPGMCYTLVRIPQDDPTAVACTFSCTMKFTVRDCDPSTGVPEEDGYEDEYVLEDLEVT  860

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  861  VSDHLQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  920

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VL+R    + DG   V M++ VRS+D +  D I
Sbjct  921  PENKNSHTLYLAGVYRGGCDVLLRSRLALGDG---VTMQVTVRSKDETSVDVI  970



>ref|XP_008627077.1| PREDICTED: coatomer subunit gamma-2 [Corvus brachyrhynchos]
 gb|KFO55409.1| Coatomer subunit gamma-2 [Corvus brachyrhynchos]
Length=871

 Score =   187 bits (475),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  639  AETEYFVRCIKHVFPNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  696

Query  761  YDTPGQTFVAFEKPEGVPA--IGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T++F V++ DP+TG  +EDG EDEY LEDLEV 
Sbjct  697  YNQPGMCYTLVRIPQDDPTAVTCTFSCTMKFTVRDCDPNTGVPDEDGYEDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHLQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS+D +  D I
Sbjct  817  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKDETSVDVI  866



>ref|XP_004008118.1| PREDICTED: coatomer subunit gamma-2 [Ovis aries]
Length=799

 Score =   186 bits (473),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  VKH+F +H+VFQ++CTNT+ +Q LE VTV V+ SE+ E       P  SLP
Sbjct  567  AETEYFVRCVKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPSESYEVLCCIPAP--SLP  624

Query  761  YDTPGQTFVAFEKPE--GVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     PE   + A G FS T+RF V++ DP TG   E+G +DEY LEDLEV 
Sbjct  625  YNQPGVCYTLVRLPEDDSIAAAGTFSCTMRFTVRDCDPDTGVPAEEGYDDEYVLEDLEVT  684

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  685  VSDHIQKVMKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  744

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  745  PENKNSHSLYLAGVYRGGYDLLVRSRLALADG---VTMQVTVRSKEGTPVDVI  794



>ref|XP_003201845.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Meleagris gallopavo]
Length=871

 Score =   187 bits (475),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 142/226 (63%), Gaps = 8/226 (4%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  639  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  697  YNQPGMCYTLVQMPQADPTAVACTFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + LG   +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALGSIKTLDEAVNNIIKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSED  273
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++
Sbjct  817  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKE  859



>ref|XP_009812764.1| PREDICTED: coatomer subunit gamma-2, partial [Gavia stellata]
Length=858

 Score =   187 bits (474),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 145/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  626  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  683

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  684  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGLPEEDGYDDEYVLEDLEVT  743

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + LG   +L EAVN +I  LGMQPCE ++ V
Sbjct  744  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALGSIKTLDEAVNNIIKFLGMQPCERSDKV  803

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  804  PENKNSHTLYLAGVYRGGYDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  853



>gb|KFV55437.1| Coatomer subunit gamma-2, partial [Gavia stellata]
Length=860

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 145/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  628  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGLPEEDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + LG   +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALGSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLYLAGVYRGGYDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  855



>ref|XP_005504385.1| PREDICTED: coatomer subunit gamma-2 [Columba livia]
Length=871

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  639  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLT  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T+RF V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  697  YNQPGMCYTLVQIPQDDPTAVACTFSCTMRFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  866



>ref|XP_002187860.1| PREDICTED: coatomer subunit gamma-2 isoform 1 [Taeniopygia guttata]
Length=871

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 142/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE V+V ++ S+  +       P  SL 
Sbjct  639  AETEYFVRCIKHVFPTHIVFQFDCTNTLNDQLLERVSVQMEPSDGYDVICCIPAP--SLA  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T++F V++ DPSTG  EEDG EDEY LEDLEV 
Sbjct  697  YNQPGMCYTLVRIPQDDPTAVACTFSCTMKFTVRDCDPSTGVPEEDGYEDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ +V   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQRVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS+D +  D I
Sbjct  817  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKDETSVDVI  866



>ref|XP_010408344.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit gamma-2 [Corvus 
cornix cornix]
Length=882

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  650  AETEYFVRCIKHVFPNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  707

Query  761  YDTPGQTFVAFEKPEGVPA--IGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T++F V++ DP+TG  +EDG EDEY LEDLEV 
Sbjct  708  YNQPGMCYTLVRIPQDDPTAVTCTFSCTMKFTVRDCDPNTGVPDEDGYEDEYVLEDLEVT  767

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  768  VSDHLQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  827

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS+D +  D I
Sbjct  828  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKDETSVDVI  877



>gb|KFV93281.1| Coatomer subunit gamma-2, partial [Fulmarus glacialis]
Length=860

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 145/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  628  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ + +D I
Sbjct  806  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPADVI  855



>ref|XP_010579362.1| PREDICTED: coatomer subunit gamma-2 isoform X4 [Haliaeetus leucocephalus]
Length=706

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  474  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  531

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  532  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  591

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  592  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  651

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  652  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  701



>ref|XP_009578347.1| PREDICTED: coatomer subunit gamma-2, partial [Fulmarus glacialis]
Length=858

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 145/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  626  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  683

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  684  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  743

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  744  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  803

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ + +D I
Sbjct  804  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPADVI  853



>ref|XP_010579360.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Haliaeetus leucocephalus]
Length=765

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  533  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  590

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  591  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  650

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  651  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  710

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  711  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  760



>ref|XP_007122862.1| PREDICTED: coatomer subunit gamma-2-like [Physeter catodon]
Length=504

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV V+ S++ E       P+ SLP
Sbjct  272  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPSDSYEVLCCI--PVPSLP  329

Query  761  YDTPG--QTFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG   T V     +   A G FS T++F V++ DP TG   E+G +DEY LEDLEV 
Sbjct  330  YNQPGICYTLVRLPDDDSTAAAGTFSCTMKFTVRDCDPDTGVPAEEGYDDEYVLEDLEVT  389

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  390  VSDHIQKVTKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  449

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  450  PENKNSHSLYLAGVYRGGYDLLVRSRLALADG---VTMQVTVRSKEGTPVDVI  499



>ref|XP_010802777.1| PREDICTED: coatomer subunit gamma-2 isoform X3 [Bos taurus]
 ref|XP_010829968.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Bison bison bison]
Length=759

 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  VKH+F +H+VFQ++CTNT+ +Q LE VTV V+ SEA E       P  SLP
Sbjct  527  AETEYFVRCVKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPSEAYEVLCCVPAP--SLP  584

Query  761  YDTPGQTFVAFEKPE--GVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     PE   + A G FS T++F V++ DP TG   E+G +DEY LEDLEV 
Sbjct  585  YNQPGVCYTLVRLPEDDSIAAAGTFSCTMKFTVRDCDPDTGVPTEEGYDDEYVLEDLEVT  644

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  645  VSDHIQKVMKPNFAAAWEEVGNTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  704

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  705  PENKNSHSLYLAGVYRGGYDLLVRSRLALADG---VTMQVTVRSKEGTPVDVI  754



>ref|XP_010829969.1| PREDICTED: coatomer subunit gamma-2 isoform X3 [Bison bison bison]
Length=733

 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  VKH+F +H+VFQ++CTNT+ +Q LE VTV V+ SEA E       P  SLP
Sbjct  501  AETEYFVRCVKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPSEAYEVLCCVPAP--SLP  558

Query  761  YDTPGQTFVAFEKPE--GVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     PE   + A G FS T++F V++ DP TG   E+G +DEY LEDLEV 
Sbjct  559  YNQPGVCYTLVRLPEDDSIAAAGTFSCTMKFTVRDCDPDTGVPTEEGYDDEYVLEDLEVT  618

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  619  VSDHIQKVMKPNFAAAWEEVGNTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  678

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  679  PENKNSHSLYLAGVYRGGYDLLVRSRLALADG---VTMQVTVRSKEGTPVDVI  728



>gb|KFW72045.1| Coatomer subunit gamma-2, partial [Pygoscelis adeliae]
Length=860

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  628  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  855



>ref|XP_005435505.1| PREDICTED: coatomer subunit gamma-2 [Falco cherrug]
Length=871

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  639  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DPSTG  E+DG +DEY LEDLEV 
Sbjct  697  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPSTGVPEDDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHTLCLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  866



>ref|XP_010802775.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Bos taurus]
Length=799

 Score =   185 bits (469),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  VKH+F +H+VFQ++CTNT+ +Q LE VTV V+ SEA E       P  SLP
Sbjct  567  AETEYFVRCVKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPSEAYEVLCCVPAP--SLP  624

Query  761  YDTPGQTFVAFEKPE--GVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     PE   + A G FS T++F V++ DP TG   E+G +DEY LEDLEV 
Sbjct  625  YNQPGVCYTLVRLPEDDSIAAAGTFSCTMKFTVRDCDPDTGVPTEEGYDDEYVLEDLEVT  684

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  685  VSDHIQKVMKPNFAAAWEEVGNTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  744

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  745  PENKNSHSLYLAGVYRGGYDLLVRSRLALADG---VTMQVTVRSKEGTPVDVI  794



>gb|KFQ03848.1| Coatomer subunit gamma-2, partial [Haliaeetus albicilla]
Length=860

 Score =   185 bits (470),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  628  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  855



>ref|XP_010579358.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Haliaeetus leucocephalus]
Length=871

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  639  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  697  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  866



>ref|XP_005235387.1| PREDICTED: coatomer subunit gamma-2 [Falco peregrinus]
Length=871

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  639  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DPSTG  E+DG +DEY LEDLEV 
Sbjct  697  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPSTGVPEDDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  866



>ref|XP_009917069.1| PREDICTED: coatomer subunit gamma-2, partial [Haliaeetus albicilla]
Length=858

 Score =   185 bits (470),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  626  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  683

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  684  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  743

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  744  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  803

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  804  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  853



>ref|XP_009646680.1| PREDICTED: coatomer subunit gamma-2 [Egretta garzetta]
Length=866

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  634  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  691

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  692  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  751

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  752  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  811

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  812  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  861



>gb|KFP10731.1| Coatomer subunit gamma-2, partial [Egretta garzetta]
Length=860

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  628  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  855



>gb|EKC27123.1| Coatomer subunit gamma-2 [Crassostrea gigas]
Length=873

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 139/231 (60%), Gaps = 4/231 (2%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEY V  VKH F  ++VFQ++CTNT+ +Q LE VTV +D +E  +  +    P  SLP
Sbjct  641  SETEYVVQCVKHTFGRYMVFQFDCTNTLNDQVLERVTVQMDPAEGFDVLKTI--PCPSLP  698

Query  761  YDTPGQTFVAFEKPEGVPAI-GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVA  585
            Y+ PG T+     PE    + G FS TL+FIVK+ DP+TGE +++G EDEY LED+EV  
Sbjct  699  YNKPGTTYTLVRLPEDAQLVTGTFSCTLKFIVKDCDPNTGEPDDEGYEDEYVLEDVEVTV  758

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
            AD++ +V   NF  +WE +GP+ E  D Y L    +L +AV  +I  +GMQPCE ++ + 
Sbjct  759  ADHVQRVMKPNFSASWEEVGPENELEDTYALSTMKTLEDAVKQIIQFMGMQPCERSDKIA  818

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAI  252
                SHT  L+GVY G    LVR    +     V M+L VRS D   S+ +
Sbjct  819  EGKSSHTLYLAGVYRGGHDALVRAKLALSD-NGVTMQLTVRSSDPDASEVL  868



>gb|KFZ69269.1| Coatomer subunit gamma-2, partial [Podiceps cristatus]
Length=792

 Score =   184 bits (468),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  560  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  617

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  618  YNQPGMCYTLVRIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  677

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L +AVN ++  LGMQPCE ++ V
Sbjct  678  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDDAVNNIVKFLGMQPCERSDKV  737

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS+D +  D I
Sbjct  738  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKDETPVDVI  787



>ref|XP_011439759.1| PREDICTED: coatomer subunit gamma-2-like [Crassostrea gigas]
Length=876

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 139/231 (60%), Gaps = 4/231 (2%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEY V  VKH F  ++VFQ++CTNT+ +Q LE VTV +D +E  +  +    P  SLP
Sbjct  644  SETEYVVQCVKHTFGRYMVFQFDCTNTLNDQVLERVTVQMDPAEGFDVLKTI--PCPSLP  701

Query  761  YDTPGQTFVAFEKPEGVPAI-GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVA  585
            Y+ PG T+     PE    + G FS TL+FIVK+ DP+TGE +++G EDEY LED+EV  
Sbjct  702  YNKPGTTYTLVRLPEDAQLVTGTFSCTLKFIVKDCDPNTGEPDDEGYEDEYVLEDVEVTV  761

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
            AD++ +V   NF  +WE +GP+ E  D Y L    +L +AV  +I  +GMQPCE ++ + 
Sbjct  762  ADHVQRVMKPNFSASWEEVGPENELEDTYALSTMKTLEDAVKQIIQFMGMQPCERSDKIA  821

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAI  252
                SHT  L+GVY G    LVR    +     V M+L VRS D   S+ +
Sbjct  822  EGKSSHTLYLAGVYRGGHDALVRAKLALSD-NGVTMQLTVRSSDPDASEVL  871



>ref|NP_001075917.1| coatomer subunit gamma-2 [Bos taurus]
 ref|XP_010829967.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Bison bison bison]
 sp|A2VE21.1|COPG2_BOVIN RecName: Full=Coatomer subunit gamma-2; AltName: Full=Gamma-2-coat 
protein; Short=Gamma-2-COP [Bos taurus]
 gb|AAI33530.1| COPG2 protein [Bos taurus]
 tpg|DAA30379.1| TPA: coatomer subunit gamma-2 [Bos taurus]
Length=871

 Score =   185 bits (470),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  VKH+F +H+VFQ++CTNT+ +Q LE VTV V+ SEA E       P  SLP
Sbjct  639  AETEYFVRCVKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPSEAYEVLCCVPAP--SLP  696

Query  761  YDTPGQTFVAFEKPE--GVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     PE   + A G FS T++F V++ DP TG   E+G +DEY LEDLEV 
Sbjct  697  YNQPGVCYTLVRLPEDDSIAAAGTFSCTMKFTVRDCDPDTGVPTEEGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKVMKPNFAAAWEEVGNTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHSLYLAGVYRGGYDLLVRSRLALADG---VTMQVTVRSKEGTPVDVI  866



>ref|XP_784737.3| PREDICTED: coatomer subunit gamma-2-like [Strongylocentrotus 
purpuratus]
Length=872

 Score =   185 bits (469),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 142/231 (61%), Gaps = 6/231 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEY V  +KH F  H+VFQ++CTNT+ +QQLENVTV ++++E  E       P+  L 
Sbjct  642  SETEYMVRCIKHTFPEHIVFQFDCTNTLNDQQLENVTVQMESAEGFEVQHYIPAPV--LK  699

Query  761  YDTPGQTFVAFEKPEGVPAIGK-FSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVA  585
            Y+ PG T+   + PE    +   FSNTL+F VK+ DP+TGE ++DG EDEY LED+E+  
Sbjct  700  YNQPGITYTVVQMPEDTSDVSSAFSNTLKFTVKDCDPNTGEPDDDGYEDEYVLEDIEIAL  759

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
            +D+M +V   NF  +WE +G + E  + YGL  + SL EA+  +++ LGMQPCE ++ V 
Sbjct  760  SDHMQRVLKPNFMASWEEVGDENETEETYGLASK-SLEEAIKDIVSFLGMQPCERSDKVS  818

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAI  252
                SHT  L+GV+ G    LVR    +     + M + VRS D  +S+ I
Sbjct  819  EGKSSHTLYLAGVFRGGHDTLVRARLALQDT--ITMHITVRSSDSGVSELI  867



>ref|XP_009460872.1| PREDICTED: coatomer subunit gamma-2 [Nipponia nippon]
 gb|KFQ95069.1| Coatomer subunit gamma-2 [Nipponia nippon]
Length=871

 Score =   185 bits (469),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  639  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  697  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN ++  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIVKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  866



>ref|XP_009478462.1| PREDICTED: coatomer subunit gamma-2, partial [Pelecanus crispus]
Length=858

 Score =   184 bits (468),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+  +       P  SL 
Sbjct  626  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDTYDVICCIPAP--SLA  683

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  684  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  743

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN ++  LGMQPCE ++ V
Sbjct  744  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIVKFLGMQPCERSDKV  803

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  804  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  853



>gb|KFQ50320.1| Coatomer subunit gamma-2, partial [Pelecanus crispus]
Length=860

 Score =   184 bits (468),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+  +       P  SL 
Sbjct  628  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDTYDVICCIPAP--SLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN ++  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIVKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  855



>gb|KFP87683.1| Coatomer subunit gamma-2, partial [Acanthisitta chloris]
Length=815

 Score =   184 bits (467),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 140/226 (62%), Gaps = 8/226 (4%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  583  AETEYFVRCIKHMFPNHLVFQFDCTNTLNDQLLERVTVQMEPSDAYDVLCCIPAP--SLA  640

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  641  YNQPGMCYTLVRIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  700

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  701  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  760

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSED  273
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS+D
Sbjct  761  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKD  803



>ref|XP_001511377.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Ornithorhynchus 
anatinus]
Length=871

 Score =   184 bits (468),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 141/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  VKH F  H+VFQ++CTNT+ +Q LE VTV ++ SEA +       P  SLP
Sbjct  639  AETEYFVRCVKHTFTDHIVFQFDCTNTLNDQLLEKVTVQMEPSEAYDVLCCIPAP--SLP  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     PE  P      FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  697  YNQPGTCYTLVSLPEDDPTAVACTFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN ++  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSTKTLEEAVNNIVTFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH   L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHALYLAGVYRGGVDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  866



>ref|XP_010297179.1| PREDICTED: coatomer subunit gamma-2, partial [Balearica regulorum 
gibbericeps]
Length=858

 Score =   184 bits (467),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +HVVFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  626  AETEYFVRCIKHVFTNHVVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  683

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  E+DG +DEY LEDLEV 
Sbjct  684  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEDDGYDDEYVLEDLEVT  743

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  744  VSDHIQKVLKPNFAAAWEEVGGDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  803

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  804  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  853



>ref|XP_007669172.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Ornithorhynchus 
anatinus]
Length=869

 Score =   184 bits (467),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 141/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  VKH F  H+VFQ++CTNT+ +Q LE VTV ++ SEA +       P  SLP
Sbjct  637  AETEYFVRCVKHTFTDHIVFQFDCTNTLNDQLLEKVTVQMEPSEAYDVLCCIPAP--SLP  694

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     PE  P      FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  695  YNQPGTCYTLVSLPEDDPTAVACTFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  754

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN ++  LGMQPCE ++ V
Sbjct  755  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSTKTLEEAVNNIVTFLGMQPCERSDKV  814

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH   L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  815  PENKNSHALYLAGVYRGGVDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  864



>gb|KFO04278.1| Coatomer subunit gamma-2, partial [Balearica regulorum gibbericeps]
Length=860

 Score =   184 bits (467),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +HVVFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  628  AETEYFVRCIKHVFTNHVVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  E+DG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEDDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGGDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  855



>gb|KFM09800.1| Coatomer subunit gamma-2, partial [Aptenodytes forsteri]
Length=860

 Score =   184 bits (467),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  628  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  E+DG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEDDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  855



>ref|XP_009935875.1| PREDICTED: coatomer subunit gamma-2, partial [Opisthocomus hoazin]
Length=858

 Score =   184 bits (467),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  626  AETEYFVRCIKHVFPNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPSP--SLA  683

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  684  YNQPGMCYTLVRIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  743

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  744  VSDHVQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  803

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  804  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  853



>ref|XP_005009582.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit gamma-2 [Anas 
platyrhynchos]
Length=924

 Score =   185 bits (469),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 145/236 (61%), Gaps = 11/236 (5%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SLP
Sbjct  689  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLP  746

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  747  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  806

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             AD++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  807  VADHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  866

Query  407  PNNSRSHTCLLSGVYIG---SAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G      VLVR    + DG   V M++ VRS++ +  D I
Sbjct  867  PENKNSHTLYLAGVYRGXXXXCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  919



>ref|XP_010076907.1| PREDICTED: coatomer subunit gamma-2, partial [Pterocles gutturalis]
 gb|KFV11309.1| Coatomer subunit gamma-2, partial [Pterocles gutturalis]
Length=738

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  506  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  563

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  564  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  623

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  624  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  683

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P +  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  684  PESKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  733



>gb|KFR13110.1| Coatomer subunit gamma-2, partial [Opisthocomus hoazin]
Length=860

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  628  AETEYFVRCIKHVFPNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPSP--SLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVRIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHVQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  855



>ref|XP_009329295.1| PREDICTED: coatomer subunit gamma-2 [Pygoscelis adeliae]
Length=927

 Score =   184 bits (468),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  695  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  752

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  753  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  812

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  813  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  872

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  873  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  922



>ref|XP_009881282.1| PREDICTED: coatomer subunit gamma-2 [Charadrius vociferus]
 gb|KGL91663.1| Coatomer subunit gamma-2 [Charadrius vociferus]
Length=871

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  +L 
Sbjct  639  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--NLA  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P   P      FS T++FIV++ DP+TG  E+DG +DEY LEDLEV 
Sbjct  697  YNQPGMCYTLVQIPRDDPTAVACTFSCTMKFIVRDCDPNTGVPEDDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  866



>ref|XP_009080090.1| PREDICTED: coatomer subunit gamma-2, partial [Acanthisitta chloris]
Length=847

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/226 (46%), Positives = 140/226 (62%), Gaps = 8/226 (4%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  615  AETEYFVRCIKHMFPNHLVFQFDCTNTLNDQLLERVTVQMEPSDAYDVLCCIPAP--SLA  672

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  673  YNQPGMCYTLVRIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  732

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  733  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  792

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSED  273
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS+D
Sbjct  793  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKD  835



>ref|NP_571069.1| coatomer subunit gamma-2 [Danio rerio]
 gb|AAF05717.1|AF191561_1 coatomer protein gamma2-COP [Danio rerio]
Length=873

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 142/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH F +H++FQ++CTNT+ +Q L+ V  +V    +E +      P  +LP
Sbjct  641  AETEYVVRCIKHTFANHMIFQFDCTNTLNDQLLQKV--LVQMEPSESYEVLHYVPAANLP  698

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y  PG  +     PE  P      FS T++++V++ DP+TGE ++DG +DEY LEDLEV 
Sbjct  699  YSQPGSCYSLVRLPEDDPTAVSCTFSCTMKYLVRDCDPNTGEPDDDGYDDEYVLEDLEVT  758

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             AD++ KV   NF  AW+ +G +CE+ + + L    +L EAVN +++ LGMQPCE ++ V
Sbjct  759  VADHIQKVLKPNFAAAWDEVGDECEKEETFALATVRTLDEAVNNIVSFLGMQPCERSDKV  818

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH   L+GV+ G   VLVR    + DG   V M++ VRS D ++ D I
Sbjct  819  PENKNSHVLFLAGVFRGGHDVLVRARLALADG---VTMQVTVRSTDDNVVDVI  868



>ref|XP_007259089.1| PREDICTED: coatomer subunit gamma-2 [Astyanax mexicanus]
Length=629

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 141/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH F +H+VFQ++CTNT+ +Q L+ V  +V    +E +      P ++LP
Sbjct  397  AETEYVVRCIKHTFAAHLVFQFDCTNTLNDQLLQRV--LVQMEPSESYEVVHHVPAQNLP  454

Query  761  YDTPGQTFVAFEKPEGVPA--IGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y  PG  +     P+  P      FS T++++V++ DP+TGE ++DG +DEY LEDLEV 
Sbjct  455  YSQPGSCYTLVRLPDDDPTAVTCTFSCTMKYLVRDCDPNTGEPDDDGYDDEYVLEDLEVT  514

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             AD++ KV   NF  AWE +G + E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  515  VADHIQKVLKPNFGAAWEEVGDEFEKEETFALASVRTLEEAVNNIITFLGMQPCERSDKV  574

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH   L+GV+ G   VLVR    + DG   V M++ VRS D ++ D I
Sbjct  575  PENKNSHVLFLAGVFRGGYDVLVRARLALADG---VTMQVTVRSSDENVVDVI  624



>ref|XP_004608312.1| PREDICTED: coatomer subunit gamma-2 [Sorex araneus]
Length=871

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 142/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY+V  VKH+F +H+VFQ++CTNT+ +Q LE VTV V+ SE  E       P  SL 
Sbjct  639  AETEYSVRCVKHMFTNHIVFQFDCTNTLNDQLLERVTVQVEPSEPYEVLCYVPAP--SLA  696

Query  761  YDTPGQTFVAFEKPE--GVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     PE         FS T++F V++ DP TG   EDG EDEY LEDLEV 
Sbjct  697  YNQPGICYTLLRLPEDDSAAVAATFSCTMKFAVRDCDPDTGVPAEDGYEDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I+ LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDAFEKEETFALSSTKTLEEAVNNIISFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G + +LVR    + DG   V M++AVRS++ +  D I
Sbjct  817  PENKNSHSLYLAGVYRGGSDLLVRSRLALADG---VTMQVAVRSQEGTPVDVI  866



>gb|AAH96860.1| Copg2 protein [Danio rerio]
 gb|AAI65205.1| Copg2 protein [Danio rerio]
Length=873

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 142/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH F +H++FQ++CTNT+ +Q L+ V  +V    +E +      P  +LP
Sbjct  641  AETEYVVRCIKHTFANHMIFQFDCTNTLNDQLLQKV--LVQMEPSESYEVLHYVPAANLP  698

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y  PG  +     PE  P      FS T++++V++ DP+TGE ++DG +DEY LEDLEV 
Sbjct  699  YSQPGSCYSLVRLPEDDPTAVSCTFSCTMKYLVRDCDPNTGEPDDDGYDDEYVLEDLEVT  758

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             AD++ KV   NF  AW+ +G +CE+ + + L    +L EAVN +++ LGMQPCE ++ V
Sbjct  759  VADHIQKVLKPNFAAAWDEVGDECEKEETFALATVRTLDEAVNNIVSFLGMQPCERSDKV  818

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH   L+GV+ G   VLVR    + DG   V M++ VRS D ++ D I
Sbjct  819  PENKNSHVLFLAGVFRGGHDVLVRARLALADG---VTMQVTVRSTDDNVVDVI  868



>ref|XP_008256344.1| PREDICTED: coatomer subunit gamma-2-like [Oryctolagus cuniculus]
Length=759

 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 142/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KHIF  H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SL 
Sbjct  527  AETEYFVRCIKHIFTHHIVFQFDCTNTLNDQLLEKVTVQMEPSDSCEVLCCI--PAASLT  584

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T+RF V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  585  YNQPGICYTLVRLPDDDPTAVAGTFSCTMRFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  644

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  645  VSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  704

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+G+Y G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  705  PENKNSHSLYLAGIYRGGYDLLVRSRLALADG---VTMQVTVRSQERTPVDVI  754



>ref|XP_009280965.1| PREDICTED: coatomer subunit gamma-2 [Aptenodytes forsteri]
Length=886

 Score =   184 bits (467),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  654  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  711

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  E+DG +DEY LEDLEV 
Sbjct  712  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEDDGYDDEYVLEDLEVT  771

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  772  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  831

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  832  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  881



>dbj|BAG51296.1| unnamed protein product [Homo sapiens]
Length=681

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  449  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAP--SLP  506

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  507  YNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  566

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  567  VSDHIQKVLKPNFAAAWEEVGDAFEKEETFALSSTKTLVEAVNNIITFLGMQPCERSDKV  626

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+G++ G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  627  PENKNSHSLYLAGIFRGGYDLLVRSRLALADG---VTMQVTVRSKERTPVDVI  676



>ref|XP_002413239.1| coatomer gamma subunit, putative [Ixodes scapularis]
 gb|EEC16547.1| coatomer gamma subunit, putative, partial [Ixodes scapularis]
Length=874

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 140/234 (60%), Gaps = 6/234 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEY V  VKH+F  HVV Q++CTNT+ +Q LE+V V V+ +E  +       P + L 
Sbjct  638  SETEYVVKCVKHVFARHVVLQFDCTNTLNDQILEHVRVAVEPAEGFQLVAEV--PCRKLV  695

Query  761  YDTPGQTFVAF--EKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEED-GVEDEYQLEDLEV  591
            Y+ PG  +V F  E  + +   G FSNTL+++VK+ DP++GE +ED G EDEY LEDLEV
Sbjct  696  YNVPGTAYVCFFLELEDPLMVAGTFSNTLKYLVKDCDPNSGEPDEDEGYEDEYVLEDLEV  755

Query  590  VAADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEV  411
              AD++ KV  +NF  AW+ +GP+ E  D Y L    +L EAV  +   +GMQ CE ++ 
Sbjct  756  AVADHVQKVLKANFSVAWDELGPENEVEDTYVLSTMKTLPEAVQKITQFMGMQACERSDK  815

Query  410  VPNNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKE-VAMKLAVRSEDLSISDAI  252
            VP    SHT LL+GVY G    LVR      G  E V M LAVRS +  +   I
Sbjct  816  VPEGKSSHTLLLAGVYRGGHDTLVRARLATTGVAEGVTMNLAVRSREPDVCQVI  869



>ref|XP_010127718.1| PREDICTED: coatomer subunit gamma-2, partial [Chlamydotis macqueenii]
Length=865

 Score =   184 bits (466),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P+ SL 
Sbjct  633  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCI--PVPSLA  690

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  691  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  750

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  751  VSDHIQKVLKPNFAAAWEEVGDHFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  810

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  811  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  860



>gb|KFP34936.1| Coatomer subunit gamma-2, partial [Chlamydotis macqueenii]
Length=860

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P+ SL 
Sbjct  628  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCI--PVPSLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDHFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLYLAGVYRGGCDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  855



>ref|XP_008964273.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Pan paniscus]
Length=799

 Score =   183 bits (464),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  567  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAP--SLP  624

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  625  YNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  684

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  685  VSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  744

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+G++ G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  745  PENKNSHSLYLAGIFRGGYDLLVRSRLALADG---VTMQVTVRSKERTPVDVI  794



>dbj|BAB14315.1| unnamed protein product [Homo sapiens]
Length=799

 Score =   183 bits (464),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  567  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAP--SLP  624

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  625  YNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  684

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  685  VSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  744

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+G++ G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  745  PENKNSHSLYLAGIFRGGYDLLVRSRLALADG---VTMQVTVRSKERTPVDVI  794



>pdb|1R4X|A Chain A, Crystal Structure Analys Of The Gamma-Copi Appendage 
Domain
Length=275

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 137/223 (61%), Gaps = 6/223 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEY +   KH F +H+VFQ++CTNT+ +Q LENVTV ++ +EA E       P +SLP
Sbjct  43   SETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEPTEAYEVLXYV--PARSLP  100

Query  761  YDTPGQ--TFVAFEKPEGVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG   T VA  K +       FS  ++F VK+ DP+TGE +++G EDEY LEDLEV 
Sbjct  101  YNQPGTCYTLVALPKEDPTAVACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVT  160

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             AD++ KV   NF  AW+ +G + E+ + + L    +L EAV  ++  LGM PCE ++ V
Sbjct  161  VADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKV  220

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRS  279
            P+N  +HT LL+GV+ G   +LVR    +     V M++  RS
Sbjct  221  PDNKNTHTLLLAGVFRGGHDILVRSRLLL--LDTVTMQVTARS  261



>ref|XP_008256411.1| PREDICTED: coatomer subunit gamma-2 [Oryctolagus cuniculus]
Length=871

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 142/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KHIF  H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SL 
Sbjct  639  AETEYFVRCIKHIFTHHIVFQFDCTNTLNDQLLEKVTVQMEPSDSCEVLCCI--PAASLT  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T+RF V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  697  YNQPGICYTLVRLPDDDPTAVAGTFSCTMRFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+G+Y G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHSLYLAGIYRGGYDLLVRSRLALADG---VTMQVTVRSQERTPVDVI  866



>ref|XP_002111874.1| hypothetical protein TRIADDRAFT_55337 [Trichoplax adhaerens]
 gb|EDV25841.1| hypothetical protein TRIADDRAFT_55337 [Trichoplax adhaerens]
Length=846

 Score =   183 bits (464),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/235 (42%), Positives = 144/235 (61%), Gaps = 4/235 (2%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            +ETEY V  VKHIF  H+VFQ++CTNT+ +Q LEN  V ++ S+  E       P+ +L 
Sbjct  614  SETEYVVRCVKHIFQKHIVFQFDCTNTLEDQLLENAYVEIEPSDEFEVESTV--PVATLA  671

Query  761  YDTPGQTFVAFEKPEGVPAI-GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVVA  585
            ++ PG T+     PE +  + G F NTL+F+VK+ D +TGEA+E+G EDEY LED+EV  
Sbjct  672  FNVPGTTYTCVSVPEDMDLMTGSFVNTLKFVVKDCDVNTGEADEEGYEDEYVLEDVEVYP  731

Query  584  ADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVVP  405
            ADYM +V  SNF  +WE +  + +  + Y L    ++ +AV  V +LLGMQPCE ++ V 
Sbjct  732  ADYMQRVLKSNFAASWEELDSEHQSEETYVLSSISTIEDAVKEVTDLLGMQPCERSDKVA  791

Query  404  NNSRSHTCLLSGVYIGSAKVLVRLSFGIDGPKEVAMKLAVRSEDLSISDAIHEIV  240
             +  SHT LL+GVY+    VL R  F +    ++ M L  RS++ +    +H+ V
Sbjct  792  RDKNSHTLLLAGVYVSGDDVLARARFAM-AQGQITMLLTARSQNETPLALVHKAV  845



>gb|EHH52515.1| hypothetical protein EGM_12967, partial [Macaca fascicularis]
Length=859

 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  627  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLCCIPAP--SLP  684

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  685  YNQPGICYTLVRLPDDDPTAVAGTFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  744

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  745  VSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  804

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+G++ G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  805  PENKNSHSLYLAGIFRGGCDLLVRSRLALADG---VTMQVTVRSKERTPVDVI  854



>ref|NP_059506.1| coatomer subunit gamma-2 [Mus musculus]
 sp|Q9QXK3.1|COPG2_MOUSE RecName: Full=Coatomer subunit gamma-2; AltName: Full=Gamma-2-coat 
protein; Short=Gamma-2-COP [Mus musculus]
 gb|AAF17607.1|AF205065_1 coatomer protein gamma2-COP [Mus musculus]
 emb|CAB96146.1| coatomer protein gamma 2-subunit [Mus musculus]
 gb|AAH49178.1| Coatomer protein complex, subunit gamma 2 [Mus musculus]
 gb|AAI45901.1| Coatomer protein complex, subunit gamma 2 [Mus musculus]
 gb|AAI45899.1| Coatomer protein complex, subunit gamma 2 [Mus musculus]
Length=871

 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  VKH+F  H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  639  AETEYFVRCVKHMFTDHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLCCIPAP--SLP  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  697  YNQPGICYTLVRLPDEDPTAVAGTFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ K+   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKILKPNFAAAWEEVGDAFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHSLYLAGVYRGGYDLLVRSRLALADG---VTMQVTVRSKERTPVDVI  866



>ref|XP_007177339.1| PREDICTED: coatomer subunit gamma-2 [Balaenoptera acutorostrata 
scammoni]
Length=808

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV V+ S++ E       P+ SLP
Sbjct  576  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPSDSYEVLCCI--PVPSLP  633

Query  761  YDTPGQTFVAFEKPE--GVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+     A G FS T++F V++ DP TG   E+G +DEY LEDLEV 
Sbjct  634  YNQPGICYTLVRLPDDDSTAAAGTFSCTMKFTVRDCDPDTGVPAEEGYDDEYVLEDLEVT  693

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  694  VSDHIQKVMKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  753

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  754  PENKNSHSLYLAGVYRGGYDLLVRSRLALADG---VTMQVTVRSKEGTPVDVI  803



>gb|KFV83597.1| Coatomer subunit gamma-2, partial [Struthio camelus australis]
Length=860

 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  628  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCI--PASSLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  EEDG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQLPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEEDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAV+ +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVSNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++ +  D I
Sbjct  806  PENKNSHTLYLAGVYRGGYDVLVRSRLALGDG---VTMQVTVRSKEETPVDVI  855



>ref|XP_007981130.1| PREDICTED: coatomer subunit gamma-2 isoform X3 [Chlorocebus sabaeus]
Length=799

 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  567  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLCCIPAP--SLP  624

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  625  YNQPGICYTLVRLPDDDPTAVAGTFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  684

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  685  VSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  744

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+G++ G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  745  PENKNSHSLYLAGIFRGGYDLLVRSRLALADG---VTMQVTVRSKERTPVDVI  794



>ref|XP_010377104.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Rhinopithecus 
roxellana]
Length=871

 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  639  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLCCIPAP--SLP  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  697  YNQPGICYTLVRLPDDDPTAVAGTFSCTMKFTVRDCDPNTGAPDEDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+G++ G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHSLYLAGIFRGGYDLLVRSRLALADG---VTMQVTVRSKERTPVDVI  866



>gb|EHH17684.1| hypothetical protein EGK_14141, partial [Macaca mulatta]
Length=859

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  627  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLCCIPAP--SLP  684

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  685  YNQPGICYTLVRLPDDDPTAVAGTFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  744

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  745  VSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  804

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+G++ G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  805  PENKNSHSLYLAGIFRGGCDLLVRSRLALADG---VTMQVTVRSKERTPVDVI  854



>gb|AAH17443.2| COPG2 protein, partial [Homo sapiens]
Length=865

 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  633  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAP--SLP  690

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  691  YNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  750

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  751  VSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  810

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+G++ G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  811  PENKNSHSLYLAGIFRGGYDLLVRSRLALADG---VTMQVTVRSKERTPVDVI  860



>gb|EDL13724.1| coatomer protein complex, subunit gamma 2 [Mus musculus]
Length=859

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  VKH+F  H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  627  AETEYFVRCVKHMFTDHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLCCIPAP--SLP  684

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  685  YNQPGICYTLVRLPDEDPTAVAGTFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  744

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ K+   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  745  VSDHIQKILKPNFAAAWEEVGDAFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  804

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  805  PENKNSHSLYLAGVYRGGYDLLVRSRLALADG---VTMQVTVRSKERTPVDVI  854



>ref|XP_009500374.1| PREDICTED: coatomer subunit gamma-2, partial [Phalacrocorax carbo]
Length=864

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 141/226 (62%), Gaps = 8/226 (4%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  632  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  689

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  E+DG +DEY LEDLEV 
Sbjct  690  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEDDGYDDEYVLEDLEVT  749

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  750  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  809

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSED  273
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++
Sbjct  810  PENKNSHTLYLAGVYRGGHDVLVRSRLALGDG---VTMQVTVRSKE  852



>gb|KFW89615.1| Coatomer subunit gamma-2, partial [Phalacrocorax carbo]
Length=860

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/226 (45%), Positives = 141/226 (62%), Gaps = 8/226 (4%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S+A +       P  SL 
Sbjct  628  AETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEPSDAYDVICCIPAP--SLA  685

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +   + P+  P      FS T++F V++ DP+TG  E+DG +DEY LEDLEV 
Sbjct  686  YNQPGMCYTLVQIPQDDPTAVACTFSCTMKFTVRDCDPNTGVPEDDGYDDEYVLEDLEVT  745

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G D E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  746  VSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDEAVNNIIKFLGMQPCERSDKV  805

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSED  273
            P N  SHT  L+GVY G   VLVR    + DG   V M++ VRS++
Sbjct  806  PENKNSHTLYLAGVYRGGHDVLVRSRLALGDG---VTMQVTVRSKE  848



>ref|XP_007469781.1| PREDICTED: coatomer subunit gamma-2 [Lipotes vexillifer]
Length=870

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/233 (44%), Positives = 143/233 (61%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV V+ S++ E       P+ SLP
Sbjct  638  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPSDSYEVLCCI--PVPSLP  695

Query  761  YDTPGQTFVAFEKPE--GVPAIGKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+     A G FS T++F V++ DP TG   E+G +DEY LEDLEV 
Sbjct  696  YNQPGICYTLVRLPDDDSTAAAGTFSCTMKFTVRDCDPDTGVPAEEGYDDEYVLEDLEVT  755

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  756  VSDHIQKVMKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  815

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+GVY G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  816  PENKNSHSLYLAGVYRGGYDLLVRSRLALADG---VTMQVTVRSKEGTPVDVI  865



>ref|XP_005550843.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Macaca fascicularis]
Length=871

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 144/233 (62%), Gaps = 8/233 (3%)
 Frame = -1

Query  941  AETEYAVNVVKHIFDSHVVFQYNCTNTIPEQQLENVTVIVDaseaeefseaaSKPLKSLP  762
            AETEY V  +KH+F +H+VFQ++CTNT+ +Q LE VTV ++ S++ E       P  SLP
Sbjct  639  AETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLCCIPAP--SLP  696

Query  761  YDTPGQTFVAFEKPEGVPAI--GKFSNTLRFIVKEVDPSTGEAEEDGVEDEYQLEDLEVV  588
            Y+ PG  +     P+  P    G FS T++F V++ DP+TG  +EDG +DEY LEDLEV 
Sbjct  697  YNQPGICYTLVRLPDDDPTAVAGTFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVT  756

Query  587  AADYMLKVGVSNFRNAWETMGPDCERVDEYGLGPRDSLAEAVNAVINLLGMQPCEGTEVV  408
             +D++ KV   NF  AWE +G   E+ + + L    +L EAVN +I  LGMQPCE ++ V
Sbjct  757  VSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKV  816

Query  407  PNNSRSHTCLLSGVYIGSAKVLVRLSFGI-DGPKEVAMKLAVRSEDLSISDAI  252
            P N  SH+  L+G++ G   +LVR    + DG   V M++ VRS++ +  D I
Sbjct  817  PENKNSHSLYLAGIFRGGCDLLVRSRLALADG---VTMQVTVRSKERTPVDVI  866



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2157100166380