BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038J07

Length=875
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACJ06186.1|  peptidylprolyl isomerase                                349   5e-117   Ipomoea batatas [batate]
ref|XP_004228428.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    303   3e-99    Solanum lycopersicum
ref|XP_010090669.1|  Peptidyl-prolyl cis-trans isomerase CYP20-2        301   2e-98    Morus notabilis
gb|AGH32899.1|  cyclophilin b                                           301   3e-98    Camellia oleifera [abura-tsubaki]
gb|AHI54562.1|  cyclophilin                                             300   1e-97    Camellia japonica [common camellia]
ref|XP_009792707.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    299   2e-97    Nicotiana sylvestris
ref|XP_009616511.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    298   6e-97    Nicotiana tomentosiformis
ref|XP_011086840.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    297   1e-96    Sesamum indicum [beniseed]
ref|XP_007043900.1|  Peptidyl-prolyl cis-trans isomerase isoform 1      296   2e-96    Theobroma cacao [chocolate]
ref|XP_006363774.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    295   5e-96    Solanum tuberosum [potatoes]
ref|XP_002514874.1|  peptidyl-prolyl cis-trans isomerase, putative      295   6e-96    Ricinus communis
gb|KDP26847.1|  hypothetical protein JCGZ_18005                         295   1e-95    Jatropha curcas
ref|XP_010556115.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    294   1e-95    Tarenaya hassleriana [spider flower]
ref|XP_006484168.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    295   1e-95    Citrus sinensis [apfelsine]
gb|KHG17795.1|  Peptidyl-prolyl cis-trans isomerase CYP20-2, chlo...    294   1e-95    Gossypium arboreum [tree cotton]
ref|XP_011036120.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    294   2e-95    Populus euphratica
ref|XP_010250635.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    294   2e-95    Nelumbo nucifera [Indian lotus]
ref|XP_008778781.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    294   2e-95    
gb|KJB12528.1|  hypothetical protein B456_002G023000                    293   4e-95    Gossypium raimondii
gb|EYU37403.1|  hypothetical protein MIMGU_mgv1a012269mg                293   4e-95    Erythranthe guttata [common monkey flower]
gb|KJB12529.1|  hypothetical protein B456_002G023000                    293   5e-95    Gossypium raimondii
ref|XP_002265030.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    293   6e-95    Vitis vinifera
ref|XP_007223392.1|  hypothetical protein PRUPE_ppa010146mg             293   6e-95    Prunus persica
ref|XP_008340246.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    292   8e-95    
ref|XP_010912997.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    292   1e-94    Elaeis guineensis
ref|XP_002439092.1|  hypothetical protein SORBIDRAFT_09g000350          291   1e-94    Sorghum bicolor [broomcorn]
ref|XP_009372242.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    292   2e-94    Pyrus x bretschneideri [bai li]
ref|XP_002299326.2|  hypothetical protein POPTR_0001s13480g             291   2e-94    Populus trichocarpa [western balsam poplar]
ref|XP_006437971.1|  hypothetical protein CICLE_v10032474mg             291   3e-94    Citrus clementina [clementine]
ref|XP_008222210.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    291   3e-94    Prunus mume [ume]
gb|AFW75093.1|  putative peptidyl-prolyl cis-trans isomerase fami...    290   5e-94    
ref|XP_009343126.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    290   1e-93    Pyrus x bretschneideri [bai li]
ref|NP_001054392.1|  Os05g0103200                                       289   1e-93    
ref|NP_001149265.1|  peptidyl-prolyl cis-trans isomerase                289   2e-93    Zea mays [maize]
ref|XP_011020813.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    289   3e-93    Populus euphratica
ref|XP_002303772.1|  peptidyl-prolyl cis-trans isomerase cyclophi...    288   4e-93    Populus trichocarpa [western balsam poplar]
ref|XP_004960938.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    288   4e-93    Setaria italica
ref|XP_009390393.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    287   6e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008648685.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    289   8e-93    
ref|XP_010025286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   2e-92    Eucalyptus grandis [rose gum]
ref|XP_006653937.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    286   2e-92    Oryza brachyantha
dbj|BAJ90691.1|  predicted protein                                      285   6e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003569145.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    284   8e-92    Brachypodium distachyon [annual false brome]
emb|CAN82436.1|  hypothetical protein VITISV_040459                     281   1e-91    Vitis vinifera
gb|ABO37960.1|  peptidylprolyl isomerase                                283   2e-91    Triticum aestivum [Canadian hard winter wheat]
gb|AAP44537.1|  cyclophilin-like protein                                281   9e-91    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008459881.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    282   9e-91    Cucumis melo [Oriental melon]
gb|AAP44535.1|  cyclophilin-like protein                                281   1e-90    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009131319.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    281   1e-90    Brassica rapa
emb|CDP13378.1|  unnamed protein product                                281   2e-90    Coffea canephora [robusta coffee]
emb|CDX78508.1|  BnaA03g04200D                                          281   2e-90    
emb|CDX70495.1|  BnaC03g05790D                                          281   3e-90    
ref|XP_003556583.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    280   4e-90    
ref|NP_001190299.1|  peptidyl-prolyl cis-trans isomerase CYP20-2        280   4e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAM65904.1|  peptidylprolyl isomerase-like protein                   280   5e-90    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196816.1|  peptidyl-prolyl cis-trans isomerase CYP20-2           280   6e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682710.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    280   6e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006399800.1|  hypothetical protein EUTSA_v10014434mg             280   7e-90    Eutrema salsugineum [saltwater cress]
ref|XP_010492057.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    280   8e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010453368.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    279   1e-89    Camelina sativa [gold-of-pleasure]
dbj|BAJ87839.1|  predicted protein                                      280   1e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACU19042.1|  unknown                                                 279   1e-89    Glycine max [soybeans]
ref|XP_010419878.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    279   2e-89    Camelina sativa [gold-of-pleasure]
ref|XP_006288490.1|  hypothetical protein CARUB_v10001755mg             279   2e-89    Capsella rubella
ref|XP_010929720.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    276   3e-89    
emb|CAC05440.1|  peptidylprolyl isomerase-like protein                  278   3e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497425.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    278   4e-89    Cicer arietinum [garbanzo]
gb|KHN37252.1|  Peptidyl-prolyl cis-trans isomerase CYP20-2, chlo...    278   4e-89    Glycine soja [wild soybean]
gb|KFK25546.1|  hypothetical protein AALP_AA8G128900                    276   1e-88    Arabis alpina [alpine rockcress]
ref|XP_003536816.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    276   2e-88    
ref|XP_004310109.1|  PREDICTED: photosynthetic NDH subunit of lum...    276   3e-88    Fragaria vesca subsp. vesca
ref|XP_004140542.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    274   8e-88    Cucumis sativus [cucumbers]
gb|AGV54525.1|  peptidyl-prolyl cis-trans isomerase                     272   7e-87    Phaseolus vulgaris [French bean]
ref|XP_007142599.1|  hypothetical protein PHAVU_007G001100g             272   1e-86    Phaseolus vulgaris [French bean]
gb|AFK36387.1|  unknown                                                 270   2e-86    Medicago truncatula
ref|XP_006844622.1|  hypothetical protein AMTR_s00016p00225920          269   1e-85    Amborella trichopoda
gb|ACJ85448.1|  unknown                                                 268   3e-85    Medicago truncatula
ref|XP_004960937.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    269   5e-85    
ref|XP_009628829.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    265   7e-85    Nicotiana tomentosiformis
ref|XP_009404751.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    265   3e-84    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB12530.1|  hypothetical protein B456_002G023000                    251   5e-79    Gossypium raimondii
gb|EMT15783.1|  Peptidyl-prolyl cis-trans isomerase CYP20-2, chlo...    256   4e-78    
ref|XP_002873599.1|  hypothetical protein ARALYDRAFT_488128             245   6e-76    
gb|ABK21441.1|  unknown                                                 244   7e-76    Picea sitchensis
emb|CCI55395.1|  NDH subunit PnsL5                                      243   2e-75    Marchantia polymorpha
ref|XP_008776537.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    243   3e-75    Phoenix dactylifera
gb|ABC41015.1|  chloroplast-localized cyclophilin                       237   1e-74    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008390136.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    238   8e-74    
gb|ABC41017.1|  chloroplast-localized cyclophilin                       233   5e-73    Triticum aestivum [Canadian hard winter wheat]
gb|ABC41018.1|  chloroplast-localized cyclophilin                       231   2e-72    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006290277.1|  hypothetical protein CARUB_v10017856mg             233   1e-71    Capsella rubella
ref|XP_007163259.1|  hypothetical protein PHAVU_001G219400g             233   1e-71    Phaseolus vulgaris [French bean]
ref|XP_010523872.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    233   2e-71    Tarenaya hassleriana [spider flower]
emb|CDX76611.1|  BnaC08g31970D                                          232   3e-71    
ref|XP_002876654.1|  hypothetical protein ARALYDRAFT_486711             231   4e-71    
ref|XP_002515157.1|  peptidyl-prolyl cis-trans isomerase, putative      231   6e-71    
ref|XP_010045506.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     231   8e-71    Eucalyptus grandis [rose gum]
ref|NP_001190159.1|  peptidyl-prolyl cis-trans isomerase CYP20-3        230   2e-70    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288530.1|  uncharacterized protein LOC103634647               228   2e-70    Zea mays [maize]
gb|AAM63944.1|  peptidylprolyl isomerase ROC4                           230   2e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008655470.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    229   3e-70    
ref|XP_002990069.1|  hypothetical protein SELMODRAFT_229509             228   4e-70    
ref|NP_191762.1|  peptidyl-prolyl cis-trans isomerase CYP20-3           229   4e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002986930.1|  hypothetical protein SELMODRAFT_229229             228   5e-70    
ref|NP_001240987.1|  uncharacterized protein LOC100785805               229   5e-70    Glycine max [soybeans]
ref|NP_001150495.1|  peptidyl-prolyl cis-trans isomerase                228   6e-70    
ref|XP_004494484.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   6e-70    
ref|XP_004494482.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   8e-70    Cicer arietinum [garbanzo]
ref|XP_010413313.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    229   8e-70    Camelina sativa [gold-of-pleasure]
gb|AFK38232.1|  unknown                                                 228   9e-70    Lotus japonicus
emb|CAN69876.1|  hypothetical protein VITISV_015631                     228   1e-69    Vitis vinifera
ref|XP_002273421.2|  PREDICTED: peptidyl-prolyl cis-trans isomerase     228   1e-69    Vitis vinifera
gb|AAG40378.1|AF325026_1  AT3g62030                                     228   2e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010468991.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   2e-69    Camelina sativa [gold-of-pleasure]
emb|CDY58761.1|  BnaA04g27460D                                          227   2e-69    Brassica napus [oilseed rape]
emb|CDX93994.1|  BnaC04g21530D                                          227   3e-69    
ref|NP_001154684.1|  peptidyl-prolyl cis-trans isomerase CYP20-3        228   4e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002455482.1|  hypothetical protein SORBIDRAFT_03g011610          226   5e-69    Sorghum bicolor [broomcorn]
ref|XP_008466218.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    226   8e-69    Cucumis melo [Oriental melon]
ref|XP_010512589.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    226   9e-69    Camelina sativa [gold-of-pleasure]
gb|KJB24499.1|  hypothetical protein B456_004G147800                    226   9e-69    Gossypium raimondii
ref|XP_006402419.1|  hypothetical protein EUTSA_v10006185mg             226   9e-69    Eutrema salsugineum [saltwater cress]
ref|XP_003567459.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     225   1e-68    Brachypodium distachyon [annual false brome]
ref|XP_006444641.1|  hypothetical protein CICLE_v10021681mg             224   1e-68    
gb|KDO86743.1|  hypothetical protein CISIN_1g024387mg                   225   1e-68    Citrus sinensis [apfelsine]
ref|XP_006444642.1|  hypothetical protein CICLE_v10021681mg             225   2e-68    Citrus clementina [clementine]
ref|XP_009116878.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    225   2e-68    Brassica rapa
ref|XP_003626095.1|  Peptidyl-prolyl cis-trans isomerase                223   6e-68    
emb|CDY11395.1|  BnaA09g39610D                                          223   7e-68    Brassica napus [oilseed rape]
gb|AFK43472.1|  unknown                                                 223   8e-68    Medicago truncatula
gb|EEC70431.1|  hypothetical protein OsI_01440                          223   9e-68    Oryza sativa Indica Group [Indian rice]
gb|KGN49788.1|  Peptidyl-prolyl cis-trans isomerase                     223   9e-68    Cucumis sativus [cucumbers]
ref|XP_009767431.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    222   1e-67    Nicotiana sylvestris
gb|EEE54351.1|  hypothetical protein OsJ_01342                          221   3e-67    Oryza sativa Japonica Group [Japonica rice]
dbj|BAB39968.1|  putative peptidyl-prolyl cis-trans isomerase, ch...    220   4e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010240836.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    220   8e-67    Nelumbo nucifera [Indian lotus]
ref|XP_004164092.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    220   9e-67    
ref|XP_004149480.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    220   9e-67    
gb|KDP28363.1|  hypothetical protein JCGZ_14134                         220   1e-66    Jatropha curcas
ref|XP_010240835.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    221   1e-66    Nelumbo nucifera [Indian lotus]
ref|XP_006444643.1|  hypothetical protein CICLE_v10021681mg             221   1e-66    Citrus clementina [clementine]
ref|XP_004967648.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    220   1e-66    Setaria italica
ref|XP_003536011.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    220   1e-66    
ref|XP_001775768.1|  predicted protein                                  216   2e-66    
ref|XP_007051330.1|  Peptidyl-prolyl cis-trans isomerase                219   2e-66    
gb|ABC41016.1|  chloroplast-localized cyclophilin                       215   3e-66    Triticum aestivum [Canadian hard winter wheat]
ref|XP_009138740.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   5e-66    Brassica rapa
ref|XP_002301464.2|  cyclophilin family protein                         219   6e-66    
gb|KEH43161.1|  peptidyl-prolyl cis-trans isomerase                     218   6e-66    Medicago truncatula
ref|XP_006840420.1|  hypothetical protein AMTR_s00045p00158000          218   8e-66    Amborella trichopoda
ref|XP_008227760.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    218   1e-65    Prunus mume [ume]
ref|XP_008227759.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    218   1e-65    Prunus mume [ume]
ref|XP_007221498.1|  hypothetical protein PRUPE_ppa010357mg             218   1e-65    Prunus persica
ref|XP_004288662.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     217   2e-65    Fragaria vesca subsp. vesca
ref|XP_002951189.1|  hypothetical protein VOLCADRAFT_81413              215   2e-65    Volvox carteri f. nagariensis
gb|AFK42902.1|  unknown                                                 214   3e-65    Lotus japonicus
emb|CDJ93250.1|  Peptidyl-prolyl cis-trans isomerase domain conta...    215   3e-65    Haemonchus contortus [red stomach worm]
ref|XP_011025284.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     216   4e-65    Populus euphratica
ref|XP_010907913.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    215   1e-64    
sp|Q41651.1|CYPB_VICFA  RecName: Full=Peptidyl-prolyl cis-trans i...    214   1e-64    Vicia faba [broad bean]
ref|XP_010672482.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    215   1e-64    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001700546.1|  peptidyl-prolyl cis-trans isomerase, cycloph...    211   5e-64    Chlamydomonas reinhardtii
gb|ABA01141.1|  peptidylprolyl isomerase/cyclophilin-like protein       211   1e-63    Chlamydomonas incerta
gb|EYB84042.1|  hypothetical protein Y032_0323g2468                     210   2e-63    Ancylostoma ceylanicum
gb|KFK35389.1|  hypothetical protein AALP_AA5G278800                    221   2e-63    Arabis alpina [alpine rockcress]
emb|CBQ70421.1|  probable cyclophilin b                                 210   3e-63    Sporisorium reilianum SRZ2
sp|Q01490.1|PPIB_ORPSP  RecName: Full=Peptidyl-prolyl cis-trans i...    209   4e-63    Orpinomyces sp. PC-2
gb|ABC47329.1|  cyclophilin B precursor                                 209   4e-63    Orpinomyces sp. PC-2
ref|XP_001771085.1|  predicted protein                                  211   5e-63    
ref|XP_008343225.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    210   9e-63    
ref|XP_008343228.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    210   1e-62    
ref|XP_008343226.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    210   1e-62    
ref|XP_008343227.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    210   1e-62    
ref|XP_001766197.1|  predicted protein                                  207   2e-62    
ref|XP_009341536.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    208   6e-62    Pyrus x bretschneideri [bai li]
gb|KHG11065.1|  Peptidyl-prolyl cis-trans isomerase, chloroplastic      208   6e-62    Gossypium arboreum [tree cotton]
ref|XP_009341538.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    207   7e-62    Pyrus x bretschneideri [bai li]
ref|XP_009341537.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    208   7e-62    Pyrus x bretschneideri [bai li]
ref|XP_004337460.1|  peptidylprolyl cis-trans isomerase                 205   7e-62    Acanthamoeba castellanii str. Neff
emb|CDS10860.1|  hypothetical protein LRAMOSA11346                      206   8e-62    Lichtheimia ramosa
gb|AHK24889.1|  peptidyl-prolyl cis-trans isomerase                     205   8e-62    Lilium lancifolium [true tiger lily]
ref|XP_004495847.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    207   2e-61    Cicer arietinum [garbanzo]
ref|XP_002110986.1|  expressed hypothetical protein                     205   2e-61    Trichoplax adhaerens
dbj|GAC97260.1|  peptidyl-prolyl cis-trans isomerase                    204   2e-61    Pseudozyma hubeiensis SY62
gb|KIH69528.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    205   3e-61    Ancylostoma duodenale
gb|EJW80238.1|  cyclophilin-type peptidyl-prolyl cis-trans isomer...    204   4e-61    Wuchereria bancrofti [agent of lymphatic filariasis]
gb|KHN43398.1|  Peptidyl-prolyl cis-trans isomerase, chloroplastic      205   1e-60    Glycine soja [wild soybean]
gb|ERG83631.1|  peptidyl-prolyl cis-trans isomerase b                   202   1e-60    
emb|CDI51937.1|  probable cyclophilin b                                 205   3e-60    Melanopsichium pennsylvanicum 4
gb|ETS61121.1|  hypothetical protein PaG_05069                          204   5e-60    Moesziomyces aphidis DSM 70725
ref|XP_007876711.1|  hypothetical protein PFL1_01020                    204   7e-60    Anthracocystis flocculosa PF-1
emb|CCF54768.1|  probable cyclophilin b                                 201   1e-59    Ustilago hordei
emb|CDP90818.1|  Protein Bm13780                                        200   1e-59    Brugia malayi [agent of lymphatic filariasis]
ref|XP_001896264.1|  cyclophilin-type peptidyl-prolyl cis-trans i...    200   1e-59    Brugia malayi [agent of lymphatic filariasis]
ref|XP_011398089.1|  Peptidyl-prolyl cis-trans isomerase B              200   2e-59    Auxenochlorella protothecoides
ref|XP_008777294.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   3e-59    Phoenix dactylifera
ref|XP_001693941.1|  peptidyl-prolyl cis-trans isomerase, cycloph...    200   4e-59    Chlamydomonas reinhardtii
gb|KHN95402.1|  peptidyl-prolyl cis-trans isomerase B precursor         201   5e-59    Metarhizium album ARSEF 1941
ref|XP_003058664.1|  predicted protein                                  199   7e-59    Micromonas pusilla CCMP1545
ref|XP_007510149.1|  peptidyl-prolyl cis-trans isomerase B              199   7e-59    Bathycoccus prasinos
gb|KEI40562.1|  hypothetical protein L969DRAFT_338716                   199   7e-59    Mixia osmundae IAM 14324
ref|XP_010556114.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   8e-59    
ref|XP_006260964.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   8e-59    Alligator mississippiensis
gb|ETN71295.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    199   1e-58    Necator americanus
gb|EST06371.1|  cyclophilin                                             198   1e-58    Kalmanozyma brasiliensis GHG001
gb|EXX53905.1|  peptidylprolyl isomerase family protein CPR5            198   1e-58    Rhizophagus irregularis DAOM 197198w
ref|XP_005829570.1|  cyclophilin B                                      197   1e-58    Guillardia theta CCMP2712
ref|XP_006628998.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   1e-58    Lepisosteus oculatus
gb|KDB12004.1|  peptidyl-prolyl cis-trans isomerase B precursor         200   1e-58    Ustilaginoidea virens
dbj|GAK62917.1|  peptidyl-prolyl cis-trans isomerase B                  201   2e-58    Moesziomyces antarcticus
ref|XP_009829338.1|  peptidyl-prolyl cis-trans isomerase                197   2e-58    Aphanomyces astaci
ref|XP_011386997.1|  putative cyclophilin b                             197   2e-58    Ustilago maydis 521
ref|XP_005142557.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   2e-58    Melopsittacus undulatus
ref|XP_004716344.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   2e-58    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_007235156.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   2e-58    
ref|XP_004500254.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   2e-58    Cicer arietinum [garbanzo]
ref|XP_001626713.1|  predicted protein                                  197   2e-58    Nematostella vectensis
gb|EFO27785.2|  cyclophilin-type peptidyl-prolyl cis-trans isomer...    197   2e-58    Loa loa
ref|XP_002508058.1|  peptidylprolyl isomerase, precursor                197   3e-58    Micromonas commoda
ref|XP_007166051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   3e-58    Balaenoptera acutorostrata scammoni
ref|XP_006899681.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   3e-58    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_571865.1|  cyclophilin                                           197   3e-58    
gb|ACU15989.1|  unknown                                                 198   4e-58    Glycine max [soybeans]
ref|NP_001236075.1|  uncharacterized protein LOC100305485 precursor     196   4e-58    Glycine max [soybeans]
gb|KGB76290.1|  peptidyl-prolyl cis-trans isomerase B                   197   4e-58    Cryptococcus gattii VGII R265
ref|XP_001366685.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   4e-58    Monodelphis domestica
gb|AIG55930.1|  secreted protein                                        196   5e-58    Achlya hypogyna
ref|XP_780268.2|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    197   5e-58    Strongylocentrotus purpuratus [purple urchin]
ref|XP_002597710.1|  hypothetical protein BRAFLDRAFT_279769             196   5e-58    Branchiostoma floridae
gb|AFK44786.1|  unknown                                                 196   5e-58    Lotus japonicus
ref|XP_006920335.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   6e-58    Pteropus alecto
ref|XP_005347803.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   6e-58    Microtus ochrogaster [prairie voles]
ref|XP_001782168.1|  predicted protein                                  196   7e-58    
emb|CEP19173.1|  hypothetical protein                                   196   7e-58    Parasitella parasitica
ref|XP_004315275.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   8e-58    
ref|XP_005281008.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   8e-58    Chrysemys picta bellii
emb|CDR39798.1|  RHTO0S04e09670g2_1                                     196   8e-58    Rhodotorula toruloides
gb|ETN78289.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    194   9e-58    Necator americanus
ref|XP_007450762.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   9e-58    Lipotes vexillifer [baiji]
gb|KDN44958.1|  hypothetical protein K437DRAFT_256824                   196   9e-58    Tilletiaria anomala UBC 951
ref|XP_007120755.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   1e-57    Physeter catodon
gb|EMS19251.1|  peptidyl-prolyl cis-trans isomerase B (cyclophili...    196   1e-57    Rhodotorula toruloides NP11
emb|CDJ82690.1|  Peptidyl-prolyl cis-trans isomerase domain conta...    194   1e-57    Haemonchus contortus [red stomach worm]
gb|KHJ92301.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    195   1e-57    Oesophagostomum dentatum [nodule worm]
ref|XP_006093465.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   1e-57    Myotis lucifugus
ref|XP_008604422.1|  peptidyl-prolyl cis-trans isomerase B (cyclo...    195   1e-57    Saprolegnia diclina VS20
ref|XP_003418399.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   1e-57    Loxodonta africana [African bush elephant]
gb|ESA04457.1|  hypothetical protein GLOINDRAFT_66613                   194   1e-57    
ref|XP_003055075.1|  predicted protein                                  195   1e-57    Micromonas pusilla CCMP1545
ref|XP_008797942.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   1e-57    Phoenix dactylifera
ref|XP_852389.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    195   1e-57    Canis lupus familiaris [dogs]
ref|NP_001265776.1|  peptidyl-prolyl cis-trans isomerase B              195   1e-57    Felis catus [cat]
ref|XP_003480239.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   1e-57    Cavia porcellus [guinea pig]
ref|XP_004409478.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   1e-57    Odobenus rosmarus divergens
ref|XP_008878745.1|  peptidyl-prolyl cis-trans isomerase                195   1e-57    Aphanomyces invadans
ref|XP_004758782.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   2e-57    Mustela putorius furo [black ferret]
ref|XP_002914286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   2e-57    Ailuropoda melanoleuca
gb|KDE05685.1|  peptidyl-prolyl cis-trans isomerase B                   195   2e-57    Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_006831608.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   2e-57    Chrysochloris asiatica
ref|XP_007956090.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   2e-57    Orycteropus afer afer
ref|XP_004795805.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   2e-57    
gb|KIR88901.1|  peptidyl-prolyl cis-trans isomerase B                   195   2e-57    Cryptococcus gattii VGIV IND107
gb|KIR54723.1|  peptidyl-prolyl cis-trans isomerase B                   195   2e-57    Cryptococcus gattii Ru294
gb|KIR49400.1|  peptidyl-prolyl cis-trans isomerase B                   195   2e-57    Cryptococcus gattii CA1280
ref|NP_001088413.1|  uncharacterized protein LOC495270                  195   2e-57    Xenopus laevis [clawed frog]
tpg|DAA25310.1|  TPA: peptidyl-prolyl cis-trans isomerase B             194   2e-57    Bos taurus [bovine]
ref|XP_005685724.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   2e-57    Capra hircus [domestic goat]
ref|XP_005894594.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   2e-57    Bos mutus
ref|XP_003784462.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   3e-57    Otolemur garnettii
ref|XP_004010585.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   3e-57    Ovis aries [domestic sheep]
ref|XP_004421741.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   3e-57    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005521397.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   3e-57    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_007540865.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   3e-57    Poecilia formosa
ref|XP_002126830.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   3e-57    Ciona intestinalis [sea vase]
ref|XP_004662593.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   3e-57    Jaculus jaculus
gb|AIG55642.1|  secreted protein                                        194   3e-57    Thraustotheca clavata
ref|NP_001017063.1|  peptidyl-prolyl cis-trans isomerase B precursor    194   3e-57    Xenopus tropicalis [western clawed frog]
ref|NP_180557.1|  peptidyl-prolyl cis-trans isomerase CYP19-4           194   4e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002979746.1|  hypothetical protein SELMODRAFT_111263             194   4e-57    Selaginella moellendorffii
ref|XP_002953624.1|  hypothetical protein VOLCADRAFT_109223             195   4e-57    
gb|AFR96711.2|  peptidyl-prolyl cis-trans isomerase B                   195   4e-57    
ref|XP_001420044.1|  predicted protein                                  194   4e-57    
dbj|BAM18284.1|  peptidyl-prolyl cis-trans isomerase f, ppif            193   4e-57    
ref|NP_001040172.1|  peptidyl-prolyl cis-trans isomerase                194   4e-57    
ref|XP_003293545.1|  hypothetical protein DICPUDRAFT_90286              194   4e-57    
gb|ABI18377.1|  cyclophilin                                             192   4e-57    
ref|XP_001508975.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   4e-57    
ref|XP_003115457.1|  CRE-CYN-7 protein                                  192   4e-57    
ref|NP_998184.1|  peptidyl-prolyl cis-trans isomerase B                 194   5e-57    
gb|AAB71401.1|  cyclophilin                                             193   6e-57    
gb|AFK34845.1|  unknown                                                 193   6e-57    
ref|NP_001187168.1|  cyclophilin B                                      194   6e-57    
ref|NP_001093231.1|  peptidyl-prolyl cis-trans isomerase B              194   6e-57    
ref|XP_004578052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   6e-57    
ref|NP_990792.1|  peptidyl-prolyl cis-trans isomerase B precursor       193   6e-57    
ref|XP_002753266.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   7e-57    
ref|XP_004628880.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   7e-57    
ref|XP_008577127.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   7e-57    
ref|XP_005393817.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   7e-57    
gb|AAA52150.1|  cyclophilin B                                           193   8e-57    
gb|AAA35733.1|  cyclophilin                                             193   8e-57    
ref|XP_008309852.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   8e-57    
ref|XP_006209641.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   8e-57    
ref|XP_005958079.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   8e-57    
gb|ADC80506.1|  peptidyl prolyl cis-trans isomerase B                   193   9e-57    
gb|AFK38976.1|  unknown                                                 193   9e-57    
ref|XP_005316736.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   9e-57    
ref|XP_002988391.1|  hypothetical protein SELMODRAFT_447339             193   1e-56    
gb|KFK24386.1|  hypothetical protein AALP_AAs72209U000300               192   1e-56    
gb|KJB34587.1|  hypothetical protein B456_006G106600                    193   1e-56    
ref|XP_003827997.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   1e-56    
gb|AIC54932.1|  PPIB                                                    193   1e-56    
gb|AAX29333.1|  peptidylprolyl isomerase B                              193   1e-56    
emb|CEF99496.1|  Cyclophilin-type peptidyl-prolyl cis-trans isome...    194   1e-56    
ref|XP_008797941.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   1e-56    
emb|CAG33110.1|  PPIB                                                   193   1e-56    
ref|NP_000933.1|  peptidyl-prolyl cis-trans isomerase B precursor       193   1e-56    
gb|EHJ71137.1|  peptidyl-prolyl cis-trans isomerase                     192   1e-56    
ref|XP_009427599.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   1e-56    
ref|XP_005104908.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   1e-56    
ref|XP_002881077.1|  cyclophilin                                        192   1e-56    
ref|XP_008706838.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   1e-56    
ref|XP_008777293.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   1e-56    
ref|XP_009409921.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   2e-56    
gb|KFR11693.1|  Peptidyl-prolyl cis-trans isomerase B                   191   2e-56    
ref|XP_005770377.1|  peptidyl-prolyl isomerase                          192   2e-56    
gb|KIM29689.1|  hypothetical protein M408DRAFT_67518                    193   2e-56    
ref|XP_004374710.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   2e-56    
ref|XP_006184053.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   2e-56    
ref|XP_004611760.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   2e-56    
ref|XP_009893863.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   2e-56    
ref|XP_002630997.1|  C. briggsae CBR-CYN-2 protein                      191   2e-56    
gb|AAM63088.1|  cyclophilin                                             192   2e-56    
ref|XP_002796880.1|  peptidyl-prolyl cis-trans isomerase B              192   2e-56    
ref|NP_776577.1|  peptidyl-prolyl cis-trans isomerase B precursor       192   2e-56    
emb|CAA41736.1|  cyclophilin CyP-S1                                     192   2e-56    
ref|XP_009088339.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   2e-56    
ref|XP_009409920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   2e-56    
gb|KEP48438.1|  peptidyl-prolyl cis-trans isomerase                     192   2e-56    
ref|XP_004687748.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   2e-56    
emb|CDH58818.1|  cyclophilin b precursor                                202   2e-56    
ref|XP_004564614.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   2e-56    
pdb|1CYN|A  Chain A, Cyclophilin B Complexed With [d-(Cholinylest...    191   2e-56    
emb|CEL60807.1|  peptidyl-prolyl cis-trans isomerase B (cyclophil...    195   3e-56    
pdb|3ICH|A  Chain A, Crystal Structure Of Cyclophilin B At 1.2 A ...    191   3e-56    
gb|KGL88399.1|  Peptidyl-prolyl cis-trans isomerase B                   191   3e-56    
dbj|GAN11742.1|  cyclophilin B                                          192   3e-56    
ref|XP_008834513.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   3e-56    
emb|CAF94597.1|  unnamed protein product                                190   3e-56    
ref|XP_007349169.1|  hypothetical protein AURDEDRAFT_114926             192   3e-56    
ref|XP_003117181.1|  CRE-CYN-2 protein                                  191   3e-56    
ref|XP_009934188.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   3e-56    
ref|XP_002718189.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    192   3e-56    
ref|NP_035279.2|  peptidyl-prolyl cis-trans isomerase B precursor       192   3e-56    
gb|EUC64143.1|  peptidyl-prolyl cis-trans isomerase                     192   3e-56    
gb|KFP40471.1|  Peptidyl-prolyl cis-trans isomerase B                   190   3e-56    
emb|CEF71065.1|  Peptidyl-prolyl cis-trans isomerase B                  192   3e-56    
gb|EPB87761.1|  peptidyl-prolyl cis-trans isomerase B1                  191   3e-56    
ref|XP_003499394.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   3e-56    
gb|KHG08655.1|  Peptidyl-prolyl cis-trans isomerase CYP20-1 -like...    192   3e-56    
ref|XP_005075579.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   3e-56    
emb|CBK24925.2|  unnamed protein product                                191   4e-56    
ref|XP_006979381.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   4e-56    
pdb|4FRU|A  Chain A, Crystal Structure Of Horse Wild-type Cycloph...    191   4e-56    
gb|KFP20031.1|  Peptidyl-prolyl cis-trans isomerase B                   190   4e-56    
ref|XP_003447562.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   4e-56    
ref|XP_007987371.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   4e-56    
gb|KID98291.1|  peptidyl-prolyl cis-trans isomerase B precursor         191   5e-56    
pdb|4FRV|A  Chain A, Crystal Structure Of Mutated Cyclophilin B T...    191   5e-56    
ref|XP_010085243.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   5e-56    
ref|XP_009773253.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   5e-56    
ref|XP_009490651.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   5e-56    
ref|XP_010197934.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   5e-56    
ref|XP_002638374.1|  Hypothetical protein CBG18578                      190   5e-56    
ref|XP_007512170.1|  predicted protein                                  195   5e-56    
gb|KEY67381.1|  hypothetical protein S7711_07591                        193   5e-56    
gb|KFZ48550.1|  Peptidyl-prolyl cis-trans isomerase B                   190   5e-56    
gb|EGT45232.1|  CBN-CYN-7 protein                                       190   6e-56    
ref|XP_001769405.1|  predicted protein                                  191   6e-56    
gb|KFQ48411.1|  Peptidyl-prolyl cis-trans isomerase B                   189   6e-56    
gb|EKD01773.1|  cyclophilin                                             194   6e-56    
gb|KFA62631.1|  hypothetical protein S40285_05192                       192   6e-56    
ref|XP_010933260.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   6e-56    
gb|ABB45384.1|  cyclophilin B                                           190   6e-56    
ref|XP_007532404.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   6e-56    
ref|XP_010115581.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   6e-56    
ref|XP_010510426.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   6e-56    
ref|XP_006782487.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   6e-56    
ref|XP_010043430.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   7e-56    
gb|KFZ47955.1|  Peptidyl-prolyl cis-trans isomerase B                   189   7e-56    
ref|XP_005490392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   7e-56    
ref|XP_007056529.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   7e-56    
ref|XP_004344975.1|  peptidylprolyl isomerase B                         191   7e-56    
gb|KFH46236.1|  Peptidyl-prolyl cis-trans isomerase B-like protein      191   7e-56    
ref|XP_010253899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   8e-56    
ref|XP_010715528.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   8e-56    
ref|XP_008464041.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   8e-56    
gb|KFP30815.1|  Peptidyl-prolyl cis-trans isomerase B                   189   8e-56    
ref|XP_003538292.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   9e-56    
ref|XP_007426835.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   9e-56    
ref|XP_010410703.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   9e-56    
gb|EJT50612.1|  cyclophilin                                             194   9e-56    
gb|KEZ39713.1|  Peptidyl-prolyl cis-trans isomerase B                   191   9e-56    
ref|XP_007016102.1|  Cyclophilin 5                                      190   9e-56    
gb|KID77583.1|  peptidyl-prolyl cis-trans isomerase B precursor         192   1e-55    
gb|EHK27517.1|  hypothetical protein TRIVIDRAFT_110996                  190   1e-55    
ref|XP_007823009.1|  hypothetical protein MAA_06820                     190   1e-55    
ref|XP_002638373.1|  C. briggsae CBR-CYN-3 protein                      189   1e-55    
ref|XP_010639481.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   1e-55    
ref|XP_009642182.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   1e-55    
gb|EYU45977.1|  hypothetical protein MIMGU_mgv1a013993mg                190   1e-55    
gb|EHK27516.1|  hypothetical protein TRIVIDRAFT_110996                  192   1e-55    
gb|KIJ04542.1|  hypothetical protein PAXINDRAFT_94591                   191   1e-55    
ref|XP_010933259.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   1e-55    
ref|XP_007146769.1|  hypothetical protein PHAVU_006G068200g             190   1e-55    
ref|NP_071981.1|  peptidyl-prolyl cis-trans isomerase B precursor       190   1e-55    
ref|NP_001290690.1|  peptidylprolyl isomerase B (cyclophilin B)         191   1e-55    
gb|KFO80854.1|  Peptidyl-prolyl cis-trans isomerase B                   189   1e-55    
gb|KFV77054.1|  Peptidyl-prolyl cis-trans isomerase B                   189   1e-55    
ref|NP_001080505.1|  peptidyl-prolyl cis-trans isomerase B              190   1e-55    
ref|XP_656494.1|  peptidyl-prolyl cis-trans isomerase                   189   1e-55    
ref|XP_010253898.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   1e-55    
ref|XP_002121490.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   1e-55    
ref|XP_001741259.1|  cyclophilin                                        189   1e-55    
emb|CCA66388.1|  probable cyclophilin                                   190   1e-55    
ref|XP_004365566.1|  peptidylprolyl isomerase                           188   1e-55    
emb|CDY55458.1|  BnaC04g54560D                                          190   2e-55    
ref|XP_009144343.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   2e-55    
sp|P24368.3|PPIB_RAT  RecName: Full=Peptidyl-prolyl cis-trans iso...    190   2e-55    
gb|ABM92916.1|  cyclophilin A                                           188   2e-55    
ref|XP_004069507.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   2e-55    
ref|XP_001748242.1|  hypothetical protein                               189   2e-55    
ref|XP_010170692.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   2e-55    
ref|XP_009467990.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   2e-55    
ref|XP_009953324.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   2e-55    
gb|KFP87566.1|  Peptidyl-prolyl cis-trans isomerase B                   188   2e-55    
ref|XP_009112393.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     188   2e-55    
ref|XP_010685556.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   2e-55    
gb|ADG69466.1|  Peptidylprolyl isomerase                                189   2e-55    
ref|XP_008358961.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   2e-55    
gb|KFO04623.1|  Peptidyl-prolyl cis-trans isomerase B                   188   2e-55    
ref|XP_008384800.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   2e-55    
gb|KJB34588.1|  hypothetical protein B456_006G106600                    191   2e-55    
ref|XP_010531511.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   2e-55    
gb|KJA20695.1|  hypothetical protein HYPSUDRAFT_141819                  190   2e-55    
ref|XP_001911375.1|  hypothetical protein                               189   2e-55    
ref|XP_002597453.1|  hypothetical protein BRAFLDRAFT_122621             188   2e-55    
gb|KFQ03414.1|  Peptidyl-prolyl cis-trans isomerase B                   188   2e-55    
ref|XP_010570530.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   2e-55    
ref|XP_002958739.1|  hypothetical protein VOLCADRAFT_84601              189   2e-55    
emb|CDY26779.1|  BnaC09g09060D                                          188   2e-55    
ref|XP_010299166.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   2e-55    
ref|XP_005814684.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   2e-55    
gb|KFO95248.1|  Peptidyl-prolyl cis-trans isomerase B                   188   2e-55    
gb|KDN62476.1|  putative cyclophilin type peptidyl-prolyl cis-tra...    189   3e-55    
ref|XP_010253897.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   3e-55    
gb|KFU95839.1|  Peptidyl-prolyl cis-trans isomerase B                   188   3e-55    
ref|XP_008058909.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   3e-55    
ref|XP_001561947.1|  cyclophilin 2                                      189   3e-55    
gb|ACO11548.1|  Peptidyl-prolyl cis-trans isomerase                     189   3e-55    
ref|XP_009648598.1|  peptidyl-prolyl cis-trans isomerase B              189   3e-55    
gb|ABO87313.1|  cyclophilin                                             187   3e-55    
gb|ACO10947.1|  Peptidyl-prolyl cis-trans isomerase                     189   3e-55    
ref|XP_002503623.1|  predicted protein                                  189   3e-55    
ref|XP_009347261.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   3e-55    
gb|KFO57267.1|  Peptidyl-prolyl cis-trans isomerase B                   188   3e-55    
ref|XP_006488528.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   3e-55    
ref|XP_010004243.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   3e-55    
emb|CCM01136.1|  predicted protein                                      189   3e-55    
ref|XP_010469913.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   3e-55    
gb|EMF10215.1|  peptidyl-prolyl cis-trans isomerase B precursor         189   3e-55    
ref|XP_008355066.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   3e-55    
ref|XP_007317544.1|  hypothetical protein SERLADRAFT_387331             189   4e-55    
gb|KFR02030.1|  Peptidyl-prolyl cis-trans isomerase B                   188   4e-55    
ref|XP_010414329.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   4e-55    
gb|ADC80504.1|  peptidyl prolyl cis-trans isomerase A (I)               187   4e-55    
gb|EFW19740.1|  cyclophilin type peptidyl-prolyl cis-trans isomerase    189   4e-55    
ref|XP_006425067.1|  hypothetical protein CICLE_v10029291mg             189   4e-55    
ref|XP_010406512.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   4e-55    
ref|WP_041403899.1|  peptidylprolyl isomerase                           187   4e-55    
ref|XP_010177555.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   4e-55    
ref|XP_008488557.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   4e-55    
ref|XP_008629519.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    187   4e-55    
ref|XP_007573553.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   4e-55    
gb|ACO10021.1|  Peptidyl-prolyl cis-trans isomerase B precursor         189   4e-55    
gb|ABY55262.1|  peptidylprolyl isomerase B                              189   5e-55    
ref|XP_003067447.1|  cyclophilin B, putative                            189   5e-55    
ref|XP_010742397.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   5e-55    
ref|XP_007791043.1|  putative peptidyl-prolyl cis-trans isomerase...    191   5e-55    
gb|KDO68980.1|  hypothetical protein CISIN_1g027222mg                   188   5e-55    
dbj|GAC72753.1|  peptidyl-prolyl cis-trans isomerase                    189   5e-55    
gb|ACO10380.1|  Peptidyl-prolyl cis-trans isomerase                     188   5e-55    
gb|KIJ49449.1|  hypothetical protein M422DRAFT_27815                    189   5e-55    
ref|NP_506751.1|  Protein CYN-3                                         187   5e-55    
gb|ACI69995.1|  Peptidyl-prolyl cis-trans isomerase B precursor         189   5e-55    
gb|EPS28743.1|  hypothetical protein PDE_03689                          189   6e-55    
gb|KFW81144.1|  Peptidyl-prolyl cis-trans isomerase B                   187   6e-55    
gb|KDO66887.1|  hypothetical protein CISIN_1g028574mg                   188   6e-55    
gb|ACQ58180.1|  Peptidyl-prolyl cis-trans isomerase                     187   6e-55    
gb|KDO68979.1|  hypothetical protein CISIN_1g027222mg                   189   6e-55    



>gb|ACJ06186.1| peptidylprolyl isomerase [Ipomoea batatas]
Length=260

 Score =   349 bits (895),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 210/234 (90%), Positives = 213/234 (91%), Gaps = 4/234 (2%)
 Frame = -2

Query  874  SYSKLPRSNSAEDTTsslssfsssaffsgslrLQKFSSCSVQVKSGRPLAPVRATAQVAE  695
            SYSKLPRS+SA   +S  SS   S         QKF SCSVQVKS RPLAPV+ATAQVAE
Sbjct  31   SYSKLPRSSSASSQSSFSSSAFISGSLRL----QKFPSCSVQVKSVRPLAPVQATAQVAE  86

Query  694  PQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFH  515
            PQSKVTSQVYFDISIGNPVGKA GRIVIGLYGDEVPQTAENFRALCTGEKGFGFKGSSFH
Sbjct  87   PQSKVTSQVYFDISIGNPVGKAVGRIVIGLYGDEVPQTAENFRALCTGEKGFGFKGSSFH  146

Query  514  RVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI  335
            RVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI
Sbjct  147  RVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI  206

Query  334  CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPIV  173
            CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPK RVVISDCGELPIV
Sbjct  207  CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKNRVVISDCGELPIV  260



>ref|XP_004228428.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Solanum lycopersicum]
Length=248

 Score =   303 bits (777),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = -2

Query  766  SSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVP  587
            S+ SV  K+G     ++A  +VA+ QSKVT++VYFDISIGNPVGK AGRIVIGLYGD+VP
Sbjct  51   SNRSVHKKTGGSSGSIQAAVEVADLQSKVTNKVYFDISIGNPVGKLAGRIVIGLYGDDVP  110

Query  586  QTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKL  407
            QTAENFRALCTGEKGFGFK S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL
Sbjct  111  QTAENFRALCTGEKGFGFKDSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL  170

Query  406  VHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRG  227
            VH GPG+VSMANAGPNTNGSQFFICTVKTPWLD +HVVFGQV+EGMD+VKLIESQETDRG
Sbjct  171  VHTGPGIVSMANAGPNTNGSQFFICTVKTPWLDQKHVVFGQVLEGMDIVKLIESQETDRG  230

Query  226  DRPKKRVVISDCGELPIV  173
            DRP+KRVVISDCGELPIV
Sbjct  231  DRPRKRVVISDCGELPIV  248



>ref|XP_010090669.1| Peptidyl-prolyl cis-trans isomerase CYP20-2 [Morus notabilis]
 gb|EXB40333.1| Peptidyl-prolyl cis-trans isomerase CYP20-2 [Morus notabilis]
Length=261

 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 164/187 (88%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            RP + +RATA+VA  QSKVT++VYFDISIGNPVGK AGRIVIGLYGD+VPQTAENFRALC
Sbjct  74   RPFSSIRATAEVAPLQSKVTNKVYFDISIGNPVGKLAGRIVIGLYGDDVPQTAENFRALC  133

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GPG +SM
Sbjct  134  TGEKGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGALSM  193

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMDVV+LIESQETDRGDRP+K+V IS
Sbjct  194  ANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDVVRLIESQETDRGDRPRKKVTIS  253

Query  196  DCGELPI  176
            DCGELP+
Sbjct  254  DCGELPV  260



>gb|AGH32899.1| cyclophilin b [Camellia oleifera]
Length=264

 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = -2

Query  766  SSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVP  587
            S  S Q K+G P + VRA A+VAE QSKVT +VYFD+SIGNPVGK AGRIVIGLYGD+VP
Sbjct  68   SGTSFQRKTGNP-SSVRAIAEVAELQSKVTQKVYFDVSIGNPVGKLAGRIVIGLYGDDVP  126

Query  586  QTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKL  407
            QTAENFRALCTGEKGFGFKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL
Sbjct  127  QTAENFRALCTGEKGFGFKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL  186

Query  406  VHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRG  227
             H GPGV+SMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQETDRG
Sbjct  187  SHIGPGVLSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQETDRG  246

Query  226  DRPKKRVVISDCGELPIV  173
            DRP+K+VVIS+CGELP+V
Sbjct  247  DRPRKKVVISECGELPVV  264



>gb|AHI54562.1| cyclophilin [Camellia japonica]
Length=262

 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 182/199 (91%), Gaps = 3/199 (2%)
 Frame = -2

Query  760  CSVQVKSGRP---LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEV  590
            CS    S R    L+ VRA+A+VAE QSKVT +VYFD+SIGNPVGK  GRIVIGLYGD+V
Sbjct  64   CSSNTSSHRKTGILSSVRASAEVAELQSKVTQKVYFDVSIGNPVGKLVGRIVIGLYGDDV  123

Query  589  PQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFK  410
            PQTAENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK
Sbjct  124  PQTAENFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK  183

Query  409  LVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDR  230
            L H GPGVVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQETDR
Sbjct  184  LTHVGPGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQETDR  243

Query  229  GDRPKKRVVISDCGELPIV  173
            GDRP+K+VVIS+CGELP+V
Sbjct  244  GDRPRKKVVISECGELPMV  262



>ref|XP_009792707.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Nicotiana sylvestris]
Length=248

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -2

Query  757  SVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTA  578
            SV  K+G     ++A  Q AE QSKVT +VYFDISIGNPVGK AGRIVIGLYGD+VPQTA
Sbjct  54   SVLRKTGALSGSIQAAVQAAEVQSKVTHKVYFDISIGNPVGKLAGRIVIGLYGDDVPQTA  113

Query  577  ENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHA  398
            ENFRALCTGEKGFG+K S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H 
Sbjct  114  ENFRALCTGEKGFGYKDSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLTHT  173

Query  397  GPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRP  218
            GPGVVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+E MD+VKLIESQETDRGDRP
Sbjct  174  GPGVVSMANAGPNTNGSQFFICTVKTPWLDERHVVFGQVLESMDIVKLIESQETDRGDRP  233

Query  217  KKRVVISDCGELPI  176
            +KRVVISDCGELP+
Sbjct  234  RKRVVISDCGELPV  247



>ref|XP_009616511.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=248

 Score =   298 bits (762),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  721  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  542
            ++A  Q AE QSKVT +VYFDISIGNPVGK AGRIVIGLYGD+VPQTAENFRALCTGEKG
Sbjct  66   IQAAVQAAEVQSKVTHKVYFDISIGNPVGKLAGRIVIGLYGDDVPQTAENFRALCTGEKG  125

Query  541  fgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGP  362
            FG+K S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSMANAGP
Sbjct  126  FGYKDSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLTHTGPGVVSMANAGP  185

Query  361  NTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            NTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQETDRGDRP KRVVISDCGEL
Sbjct  186  NTNGSQFFICTVKTPWLDERHVVFGQVLEGMDIVKLIESQETDRGDRPTKRVVISDCGEL  245

Query  181  PI  176
            P+
Sbjct  246  PV  247



>ref|XP_011086840.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Sesamum indicum]
Length=256

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  754  VQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAE  575
            V+ ++G     VRA A+ A  QSKVT +VYFDISIGNPVGK AGRIVIGLYGD+VPQTAE
Sbjct  63   VRSRAGPMSFSVRAMAEEATLQSKVTHKVYFDISIGNPVGKLAGRIVIGLYGDDVPQTAE  122

Query  574  NFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAG  395
            NFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL+H G
Sbjct  123  NFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLIHTG  182

Query  394  PGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPK  215
            PGVVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMDVV+LIESQETDRGDRP 
Sbjct  183  PGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDVVRLIESQETDRGDRPT  242

Query  214  KRVVISDCGELPI  176
            KRVVISDCGELP+
Sbjct  243  KRVVISDCGELPV  255



>ref|XP_007043900.1| Peptidyl-prolyl cis-trans isomerase isoform 1 [Theobroma cacao]
 ref|XP_007043901.1| Peptidyl-prolyl cis-trans isomerase isoform 1 [Theobroma cacao]
 gb|EOX99731.1| Peptidyl-prolyl cis-trans isomerase isoform 1 [Theobroma cacao]
 gb|EOX99732.1| Peptidyl-prolyl cis-trans isomerase isoform 1 [Theobroma cacao]
Length=258

 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -2

Query  745  KSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFR  566
            ++ R L PVRA+A+VA  QSKVT +VY DISIGNP GK AGRIVIGLYGD+VPQTAENFR
Sbjct  66   RNSRVLRPVRASAEVATLQSKVTHKVYLDISIGNPAGKVAGRIVIGLYGDDVPQTAENFR  125

Query  565  ALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGV  386
            ALCTGE+GFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPG+
Sbjct  126  ALCTGERGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHTGPGI  185

Query  385  VSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRV  206
            VSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EG DVVKLIESQETDRGDRP+K+V
Sbjct  186  VSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGFDVVKLIESQETDRGDRPRKKV  245

Query  205  VISDCGELPI  176
            V+SDCGELP+
Sbjct  246  VVSDCGELPV  255



>ref|XP_006363774.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Solanum tuberosum]
Length=248

 Score =   295 bits (755),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -2

Query  766  SSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVP  587
            S+ SV  K+G     ++A  +  + QSKVT +VYFDISIGNPVGK AGRIVIGLYGD+VP
Sbjct  51   SNRSVHRKTGGSSGSIQAAVEAVDLQSKVTHKVYFDISIGNPVGKLAGRIVIGLYGDDVP  110

Query  586  QTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKL  407
            QTAENFRALCTGEKGFGFK S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL
Sbjct  111  QTAENFRALCTGEKGFGFKDSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL  170

Query  406  VHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRG  227
            VH GPG+VSMANAGPNTNGSQFFICTVKTPWLD +HVVFGQV+EGMD+VKLIE QETDRG
Sbjct  171  VHTGPGIVSMANAGPNTNGSQFFICTVKTPWLDQKHVVFGQVLEGMDIVKLIECQETDRG  230

Query  226  DRPKKRVVISDCGELPI  176
            DRP+KRVVISDCGELPI
Sbjct  231  DRPRKRVVISDCGELPI  247



>ref|XP_002514874.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
 gb|EEF47428.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
Length=256

 Score =   295 bits (755),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 178/187 (95%), Gaps = 0/187 (0%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R ++ +RAT++VA+ QSKVT++VYFDISIGNPV K AGRIVIGLYGD+VPQTAENFRALC
Sbjct  67   RFISSIRATSEVADLQSKVTNKVYFDISIGNPVPKLAGRIVIGLYGDDVPQTAENFRALC  126

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H G GVVSM
Sbjct  127  TGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLAHTGAGVVSM  186

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQETDRGDRP+KRVVIS
Sbjct  187  ANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQETDRGDRPRKRVVIS  246

Query  196  DCGELPI  176
            +CGELPI
Sbjct  247  ECGELPI  253



>gb|KDP26847.1| hypothetical protein JCGZ_18005 [Jatropha curcas]
Length=260

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L+ +RA+++VA+ QSKVT++VYFDIS+GNPV K  GRIVIGLYGD+VPQTAENFRALCTG
Sbjct  73   LSSIRASSEVADLQSKVTNKVYFDISVGNPVPKLVGRIVIGLYGDDVPQTAENFRALCTG  132

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSMAN
Sbjct  133  EKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLAHVGPGVVSMAN  192

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQETDRGDRP+KRVVISDC
Sbjct  193  AGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQETDRGDRPRKRVVISDC  252

Query  190  GELPI  176
            GELPI
Sbjct  253  GELPI  257



>ref|XP_010556115.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=254

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = -2

Query  766  SSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVP  587
            SSC V  ++ R  + V+A+++VA+ QSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VP
Sbjct  56   SSCLVTSRTNRYFS-VQASSEVADVQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVP  114

Query  586  QTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKL  407
            QTAENFRALCTG+KGFG+KGS+FHRVIKDFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL
Sbjct  115  QTAENFRALCTGDKGFGYKGSTFHRVIKDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKL  174

Query  406  VHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRG  227
             H+GPGVVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGM+VVKLIESQETDRG
Sbjct  175  SHSGPGVVSMANAGPNTNGSQFFICTVKTPWLDGRHVVFGQVVEGMEVVKLIESQETDRG  234

Query  226  DRPKKRVVISDCGELPI  176
            DRP+K+VVI+DCG+LP+
Sbjct  235  DRPRKKVVIADCGQLPM  251



>ref|XP_006484168.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Citrus sinensis]
 gb|KDO81813.1| hypothetical protein CISIN_1g024818mg [Citrus sinensis]
Length=262

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  721  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  542
            VRA+A+VA+ QSKVT++VYFD+SIGNPVGK AGRIVIGLYGD+VPQTAENFRALCTGEKG
Sbjct  78   VRASAEVADLQSKVTNKVYFDVSIGNPVGKLAGRIVIGLYGDDVPQTAENFRALCTGEKG  137

Query  541  fgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGP  362
            FG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSMANAGP
Sbjct  138  FGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHIGPGVVSMANAGP  197

Query  361  NTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            NTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQETDRGDRP K+VVISDCGEL
Sbjct  198  NTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQETDRGDRPGKKVVISDCGEL  257

Query  181  PI  176
            P+
Sbjct  258  PM  259



>gb|KHG17795.1| Peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic -like 
protein [Gossypium arboreum]
Length=259

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  757  SVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTA  578
            S Q  + R    VRATA+VA  QSK+T++V+FDISIGNPVGK AG+IVIGLYGD+VPQT 
Sbjct  63   SPQTNNHRVRRSVRATAEVAPIQSKITNKVFFDISIGNPVGKLAGKIVIGLYGDDVPQTT  122

Query  577  ENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHA  398
            ENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL HA
Sbjct  123  ENFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHA  182

Query  397  GPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRP  218
            GPGVVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD VKLIESQETDRGDRP
Sbjct  183  GPGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDTVKLIESQETDRGDRP  242

Query  217  KKRVVISDCGELPI  176
            +K+VVISDCGELP+
Sbjct  243  RKKVVISDCGELPM  256



>ref|XP_011036120.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Populus euphratica]
Length=263

 Score =   294 bits (753),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -2

Query  772  KFSSCSVQV-KSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGD  596
            +F+S +    K  R L+ VRA+A+VAE QSKVT++VYFDI IGNPVGK  GRIVIGLYGD
Sbjct  61   RFASLTTSSPKKSRVLSSVRASAEVAELQSKVTNKVYFDIGIGNPVGKLVGRIVIGLYGD  120

Query  595  EVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDEN  416
            +VPQTAENFRALCTGEKGFG+K S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDEN
Sbjct  121  DVPQTAENFRALCTGEKGFGYKNSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDEN  180

Query  415  FKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQET  236
            FKL H GPGV+SMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQET
Sbjct  181  FKLSHIGPGVLSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQET  240

Query  235  DRGDRPKKRVVISDCGELPI  176
            DRGDRP KRVVI + GELP+
Sbjct  241  DRGDRPTKRVVILESGELPM  260



>ref|XP_010250635.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Nelumbo nucifera]
Length=261

 Score =   294 bits (753),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
             +  RA+AQ A  QSKVT++VYFDISIGNPVGK AGRIVIGL+GD+VPQTAENFRALCTG
Sbjct  76   FSSTRASAQEAPLQSKVTNKVYFDISIGNPVGKLAGRIVIGLFGDDVPQTAENFRALCTG  135

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSMAN
Sbjct  136  EKGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHIGPGVVSMAN  195

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMDVVKLIESQETDRGDRPKK+V ISDC
Sbjct  196  AGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDVVKLIESQETDRGDRPKKKVAISDC  255

Query  190  GELPIV  173
            GELP+V
Sbjct  256  GELPMV  261



>ref|XP_008778781.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like, partial 
[Phoenix dactylifera]
Length=264

 Score =   294 bits (753),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 179/201 (89%), Gaps = 2/201 (1%)
 Frame = -2

Query  769  FSSCSVQV--KSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGD  596
             SS SV    +S R     RA  + AE QSKVT++V+FDISIGNPVGK  GRIVIGLYGD
Sbjct  61   LSSLSVSSFRRSARYTTSARAELKEAELQSKVTNKVFFDISIGNPVGKLVGRIVIGLYGD  120

Query  595  EVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDEN  416
            +VPQTAENFRALCTGEKGFG+KGS FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDEN
Sbjct  121  DVPQTAENFRALCTGEKGFGYKGSMFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDEN  180

Query  415  FKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQET  236
            F+L H GPGVVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMDVV+LIESQET
Sbjct  181  FRLSHVGPGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDVVRLIESQET  240

Query  235  DRGDRPKKRVVISDCGELPIV  173
            DRGDRPKK+VVISDCGELP+V
Sbjct  241  DRGDRPKKKVVISDCGELPVV  261



>gb|KJB12528.1| hypothetical protein B456_002G023000 [Gossypium raimondii]
Length=259

 Score =   293 bits (751),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  757  SVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTA  578
            S Q  + R    VRATA+VA  QSK+T++V+FD+SIGNPVGK AG+IVIGLYGD+VPQT 
Sbjct  63   SPQTNNHRVRRSVRATAEVAPIQSKITNKVFFDVSIGNPVGKLAGKIVIGLYGDDVPQTT  122

Query  577  ENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHA  398
            ENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL HA
Sbjct  123  ENFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHA  182

Query  397  GPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRP  218
            GPGVVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD VKLIESQETDRGDRP
Sbjct  183  GPGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDTVKLIESQETDRGDRP  242

Query  217  KKRVVISDCGELPI  176
            +K+VVISDCGELP+
Sbjct  243  RKKVVISDCGELPM  256



>gb|EYU37403.1| hypothetical protein MIMGU_mgv1a012269mg [Erythranthe guttata]
Length=256

 Score =   293 bits (750),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  721  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  542
            VRA A+ A  QSKVT++VYFDISIGNPVGK AGRIVIGLYGD+VPQTAENFRALCTGEKG
Sbjct  74   VRAMAEEATLQSKVTNKVYFDISIGNPVGKLAGRIVIGLYGDDVPQTAENFRALCTGEKG  133

Query  541  fgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGP  362
            FG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+LVH GPG+VSMANAGP
Sbjct  134  FGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLVHTGPGIVSMANAGP  193

Query  361  NTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            NTNGSQFFICTVKTPWLD RHVVFGQV+EG+D+V+LIESQETDRGDRP+ RVVISDCGEL
Sbjct  194  NTNGSQFFICTVKTPWLDQRHVVFGQVLEGLDIVRLIESQETDRGDRPRMRVVISDCGEL  253

Query  181  PI  176
            P+
Sbjct  254  PV  255



>gb|KJB12529.1| hypothetical protein B456_002G023000 [Gossypium raimondii]
Length=263

 Score =   293 bits (750),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -2

Query  757  SVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTA  578
            S Q  + R    VRATA+VA  QSK+T++V+FD+SIGNPVGK AG+IVIGLYGD+VPQT 
Sbjct  67   SPQTNNHRVRRSVRATAEVAPIQSKITNKVFFDVSIGNPVGKLAGKIVIGLYGDDVPQTT  126

Query  577  ENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHA  398
            ENFRALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL HA
Sbjct  127  ENFRALCTGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHA  186

Query  397  GPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRP  218
            GPGVVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD VKLIESQETDRGDRP
Sbjct  187  GPGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDTVKLIESQETDRGDRP  246

Query  217  KKRVVISDCGELPI  176
            +K+VVISDCGELP+
Sbjct  247  RKKVVISDCGELPM  260



>ref|XP_002265030.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Vitis vinifera]
 emb|CBI38153.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   293 bits (750),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L+ +RA+AQ A  QSKVT +VYFDISIGNPVGK  GRIVIGL+GD+VPQTAENFRALCTG
Sbjct  77   LSSLRASAQEAPLQSKVTQKVYFDISIGNPVGKVVGRIVIGLFGDDVPQTAENFRALCTG  136

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSMAN
Sbjct  137  EKGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLAHVGPGVVSMAN  196

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKL+ESQETDRGDRP+K+VVIS+C
Sbjct  197  AGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLVESQETDRGDRPRKKVVISEC  256

Query  190  GELPIV  173
            GELP+V
Sbjct  257  GELPMV  262



>ref|XP_007223392.1| hypothetical protein PRUPE_ppa010146mg [Prunus persica]
 gb|EMJ24591.1| hypothetical protein PRUPE_ppa010146mg [Prunus persica]
Length=262

 Score =   293 bits (750),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = -2

Query  769  FSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEV  590
            FSS     K    ++ VRA+A+ A  QSKVT +VYFDISIGNPVGK AGRIVIGL+GD+V
Sbjct  64   FSSNPNSQKRASLVSSVRASAEEATLQSKVTHKVYFDISIGNPVGKLAGRIVIGLFGDDV  123

Query  589  PQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFK  410
            PQTAENFRALCTG+KGFGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK
Sbjct  124  PQTAENFRALCTGDKGFGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK  183

Query  409  LVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDR  230
            L H GPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQV+EG+DVV+LIESQETDR
Sbjct  184  LSHTGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVLEGLDVVRLIESQETDR  243

Query  229  GDRPKKRVVISDCGELPI  176
            GDRP K+VVI+DCGELP+
Sbjct  244  GDRPTKKVVIADCGELPV  261



>ref|XP_008340246.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Malus domestica]
Length=259

 Score =   292 bits (748),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -2

Query  769  FSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEV  590
            FSS     K       VRA+A+ A  QSKVT +VYFDISIGNPVGK AGRIVIGLYGD+V
Sbjct  61   FSSNPSSRKRTSLAGSVRASAEEATLQSKVTHKVYFDISIGNPVGKLAGRIVIGLYGDDV  120

Query  589  PQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFK  410
            PQT ENFRALCTG+KGFGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK
Sbjct  121  PQTVENFRALCTGDKGFGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK  180

Query  409  LVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDR  230
            L H GPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQV+EG+DVVKLIESQETDR
Sbjct  181  LSHTGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVVEGLDVVKLIESQETDR  240

Query  229  GDRPKKRVVISDCGELPI  176
            GDRP K+VVI+DCGELP+
Sbjct  241  GDRPTKKVVIADCGELPV  258



>ref|XP_010912997.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Elaeis guineensis]
Length=258

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R     RA  + AE QSKVT++V+FDISIGNPVG   GRIVIGLYGD+VPQTAENFRALC
Sbjct  71   RYATSARAELKEAELQSKVTNKVFFDISIGNPVGNLVGRIVIGLYGDDVPQTAENFRALC  130

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKGFG+KGS+FHRVIK+FMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSM
Sbjct  131  TGEKGFGYKGSAFHRVIKEFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHLGPGVVSM  190

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMDVVKLIESQETDRGDRPKK+VVIS
Sbjct  191  ANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDVVKLIESQETDRGDRPKKKVVIS  250

Query  196  DCGELPIV  173
            DCGELP+V
Sbjct  251  DCGELPVV  258



>ref|XP_002439092.1| hypothetical protein SORBIDRAFT_09g000350 [Sorghum bicolor]
 gb|EES17522.1| hypothetical protein SORBIDRAFT_09g000350 [Sorghum bicolor]
Length=249

 Score =   291 bits (746),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 174/186 (94%), Gaps = 5/186 (3%)
 Frame = -2

Query  715  ATAQVAEP-----QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            AT+  AEP     QSK+T++VYFDISIGNPVGK  GRIVIGLYGD+VPQTAENFRALCTG
Sbjct  64   ATSASAEPKEADLQSKITNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTAENFRALCTG  123

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+KGSSFHRVI DFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GPGVVSMAN
Sbjct  124  EKGFGYKGSSFHRVISDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVVSMAN  183

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQETDRGDRPKK+VVIS+C
Sbjct  184  AGPNTNGSQFFICTVKTPWLDGRHVVFGQVLEGMDIVKLIESQETDRGDRPKKKVVISEC  243

Query  190  GELPIV  173
            GELP+V
Sbjct  244  GELPVV  249



>ref|XP_009372242.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Pyrus x bretschneideri]
Length=259

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 166/198 (84%), Positives = 177/198 (89%), Gaps = 0/198 (0%)
 Frame = -2

Query  769  FSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEV  590
            FSS     K       VRA+A+ A  QSKVT +VYFDISIGNPVGK AGRIVIGLYGD+V
Sbjct  61   FSSNPSSRKRTSLAGSVRASAEEATLQSKVTHKVYFDISIGNPVGKLAGRIVIGLYGDDV  120

Query  589  PQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFK  410
            PQT ENFRALCTG+KGFGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK
Sbjct  121  PQTVENFRALCTGDKGFGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK  180

Query  409  LVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDR  230
            L H GPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQV+EG+DVVKLIESQETDR
Sbjct  181  LSHTGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVVEGLDVVKLIESQETDR  240

Query  229  GDRPKKRVVISDCGELPI  176
            GDRP K+VVI+DCGELP+
Sbjct  241  GDRPTKKVVIADCGELPV  258



>ref|XP_002299326.2| hypothetical protein POPTR_0001s13480g [Populus trichocarpa]
 gb|EEE84131.2| hypothetical protein POPTR_0001s13480g [Populus trichocarpa]
Length=263

 Score =   291 bits (746),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  745  KSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFR  566
            K  R L+ VRA+A+VAE QSKVT++VYFDI IGNPVGK  GRIVIGL+GD+VPQTAENFR
Sbjct  71   KKSRVLSSVRASAEVAELQSKVTNKVYFDIGIGNPVGKLVGRIVIGLFGDDVPQTAENFR  130

Query  565  ALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGV  386
            ALCTGEKGFGFK S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGV
Sbjct  131  ALCTGEKGFGFKNSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHIGPGV  190

Query  385  VSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRV  206
            +SMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQETDRGDRP KRV
Sbjct  191  LSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQETDRGDRPTKRV  250

Query  205  VISDCGELPI  176
            VI + GELP+
Sbjct  251  VILESGELPM  260



>ref|XP_006437971.1| hypothetical protein CICLE_v10032474mg [Citrus clementina]
 gb|ESR51211.1| hypothetical protein CICLE_v10032474mg [Citrus clementina]
Length=262

 Score =   291 bits (745),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  721  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  542
            V A+A+VA+ QSKVT++VYFD+SIGNPVGK AGRIVIGLYGD+VPQTAENFRALCTGEKG
Sbjct  78   VWASAEVADLQSKVTNKVYFDVSIGNPVGKLAGRIVIGLYGDDVPQTAENFRALCTGEKG  137

Query  541  fgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGP  362
            FG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSMANAGP
Sbjct  138  FGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHIGPGVVSMANAGP  197

Query  361  NTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            NTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQETDRGDRP K+VVISDCGEL
Sbjct  198  NTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQETDRGDRPGKKVVISDCGEL  257

Query  181  PI  176
            P+
Sbjct  258  PM  259



>ref|XP_008222210.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Prunus mume]
Length=262

 Score =   291 bits (745),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            ++ VRA+A+ A  QSKVT +VYFDISIGNPVGK AGRIVIGL+GD+VPQTAENFRALCTG
Sbjct  77   VSSVRASAEEATLQSKVTHKVYFDISIGNPVGKLAGRIVIGLFGDDVPQTAENFRALCTG  136

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            +KGFGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSMAN
Sbjct  137  DKGFGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHTGPGVVSMAN  196

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGPNTNGSQFFICTVKTPWLDNRHVVFGQV+EG+DVV+LIESQETDRGDRP K+VVI+DC
Sbjct  197  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVLEGLDVVRLIESQETDRGDRPTKKVVIADC  256

Query  190  GELPI  176
            GELP+
Sbjct  257  GELPV  261



>gb|AFW75093.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea 
mays]
Length=251

 Score =   290 bits (743),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 5/186 (3%)
 Frame = -2

Query  715  ATAQVAEP-----QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            AT+  AEP     QSK+T++VYFDISIGNPVGK  GRIVIGLYGD+VPQTAENFRALCTG
Sbjct  66   ATSASAEPKEADLQSKITNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTAENFRALCTG  125

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+KGSSFHRVI DFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GPGVVSMAN
Sbjct  126  EKGFGYKGSSFHRVISDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVVSMAN  185

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V+LIESQETDRGDRPKK+VVIS+C
Sbjct  186  AGPNTNGSQFFICTVKTPWLDGRHVVFGQVVEGMDIVRLIESQETDRGDRPKKKVVISEC  245

Query  190  GELPIV  173
            GELP+V
Sbjct  246  GELPVV  251



>ref|XP_009343126.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=259

 Score =   290 bits (741),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  721  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  542
            VRA+A+    QSKVT +VYFDISIGNPVGK AGRIVIGLYGD+VPQT ENFRALCTG+KG
Sbjct  77   VRASAEEVTLQSKVTHKVYFDISIGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGDKG  136

Query  541  fgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGP  362
            FGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSMANAGP
Sbjct  137  FGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHTGPGVVSMANAGP  196

Query  361  NTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            NTNGSQFFICTVKTPWLDNRHVVFGQV+EG+DVVKLIESQETDRGDRP K+VVI+DCGEL
Sbjct  197  NTNGSQFFICTVKTPWLDNRHVVFGQVVEGLDVVKLIESQETDRGDRPTKKVVIADCGEL  256

Query  181  PI  176
            P+
Sbjct  257  PV  258



>ref|NP_001054392.1| Os05g0103200 [Oryza sativa Japonica Group]
 gb|AAS88825.1| putative peptidylprolyl isomerase [Oryza sativa Japonica Group]
 dbj|BAF16306.1| Os05g0103200 [Oryza sativa Japonica Group]
 gb|EAY96206.1| hypothetical protein OsI_18093 [Oryza sativa Indica Group]
 dbj|BAG96494.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG88005.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96717.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62007.1| hypothetical protein OsJ_16789 [Oryza sativa Japonica Group]
Length=250

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 158/173 (91%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            QSK+T++VYFDISIGNPVGK  GR+VIGLYGD+VPQTAENFRALCTGEKGFG+KGSSFHR
Sbjct  78   QSKITNKVYFDISIGNPVGKNVGRVVIGLYGDDVPQTAENFRALCTGEKGFGYKGSSFHR  137

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GPGVVSMANAGPNTNGSQFFIC
Sbjct  138  VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVVSMANAGPNTNGSQFFIC  197

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPIV  173
            TVKTPWLD RHVVFGQVIEGMD+VK+IESQETDRGDRPKK+VVIS+CGELP+V
Sbjct  198  TVKTPWLDGRHVVFGQVIEGMDIVKMIESQETDRGDRPKKKVVISECGELPVV  250



>ref|NP_001149265.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
 gb|ACG34782.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
 gb|AFW82939.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea 
mays]
Length=248

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 172/186 (92%), Gaps = 5/186 (3%)
 Frame = -2

Query  715  ATAQVAEP-----QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            AT+  AEP     QSK+T++VYFDISIGNPVGK  GRIVIGLYGD+VPQT ENFRALCTG
Sbjct  63   ATSASAEPKEAELQSKITNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTTENFRALCTG  122

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+KGSSFHRVI DFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GPGVVSMAN
Sbjct  123  EKGFGYKGSSFHRVISDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVVSMAN  182

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMDVV LIESQETDRGDRPKK+VVIS+C
Sbjct  183  AGPNTNGSQFFICTVKTPWLDGRHVVFGQVLEGMDVVSLIESQETDRGDRPKKKVVISEC  242

Query  190  GELPIV  173
            GELP+V
Sbjct  243  GELPVV  248



>ref|XP_011020813.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Populus euphratica]
Length=263

 Score =   289 bits (739),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 179/200 (90%), Gaps = 1/200 (1%)
 Frame = -2

Query  772  KFSSCSVQV-KSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGD  596
            +F+S S    K  R L+ VRA+ +VAE QSKVT++VYFDI IGNPVG+  GR+VIGL+GD
Sbjct  61   RFASLSTSSPKKSRVLSSVRASTEVAELQSKVTNKVYFDIGIGNPVGRLVGRVVIGLFGD  120

Query  595  EVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDEN  416
            +VPQT ENFRALCTGEKGFG+K S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDEN
Sbjct  121  DVPQTVENFRALCTGEKGFGYKNSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDEN  180

Query  415  FKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQET  236
            FKL H+GPG+VSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQET
Sbjct  181  FKLSHSGPGIVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQET  240

Query  235  DRGDRPKKRVVISDCGELPI  176
            DRGDRP KRVVI + GELP+
Sbjct  241  DRGDRPTKRVVILESGELPM  260



>ref|XP_002303772.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein 
[Populus trichocarpa]
 gb|EEE78751.1| peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein 
[Populus trichocarpa]
Length=263

 Score =   288 bits (737),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  745  KSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFR  566
            K  R L+ VRA+A+VAE QSKVT++VYFDI IGNPVG+  GR+VIGLYGD+VPQT ENFR
Sbjct  71   KKSRVLSSVRASAEVAELQSKVTNKVYFDIGIGNPVGRLVGRVVIGLYGDDVPQTVENFR  130

Query  565  ALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGV  386
            ALCTGEKGFG+K S+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPG+
Sbjct  131  ALCTGEKGFGYKNSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHIGPGI  190

Query  385  VSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRV  206
            +SMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+VKLIESQETDRGDRP KRV
Sbjct  191  LSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVKLIESQETDRGDRPTKRV  250

Query  205  VISDCGELPI  176
            V+ + GELP+
Sbjct  251  VVLESGELPM  260



>ref|XP_004960938.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
isoform X2 [Setaria italica]
Length=253

 Score =   288 bits (736),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 173/185 (94%), Gaps = 5/185 (3%)
 Frame = -2

Query  712  TAQVAEP-----QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGE  548
            T+  AEP     QSKVT++VYFDISIGNPVGK  GRIVIGL+GD+VPQTAENFRALCTGE
Sbjct  69   TSASAEPKEADIQSKVTNKVYFDISIGNPVGKNVGRIVIGLFGDDVPQTAENFRALCTGE  128

Query  547  kgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANA  368
            KGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GPGVVSMANA
Sbjct  129  KGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVVSMANA  188

Query  367  GPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCG  188
            GPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V+LIES ETDRGDRPKK+VVIS+CG
Sbjct  189  GPNTNGSQFFICTVKTPWLDGRHVVFGQVLEGMDIVRLIESSETDRGDRPKKKVVISECG  248

Query  187  ELPIV  173
            ELP+V
Sbjct  249  ELPVV  253



>ref|XP_009390393.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=249

 Score =   287 bits (735),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  RATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  539
            RA  + AE QSKVT++VYFDISIGNPVGK  GRIVIGL+GD+ PQTAENFRALCTGEKGF
Sbjct  68   RAELKEAEVQSKVTTKVYFDISIGNPVGKDVGRIVIGLFGDDCPQTAENFRALCTGEKGF  127

Query  538  gfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPN  359
            G+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSMANAGPN
Sbjct  128  GYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHLGPGVVSMANAGPN  187

Query  358  TNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            TNGSQFFICTVKTPWLD RHVVFGQV+EGMDVV+LIESQETDRGDRPKKRVVI DCGELP
Sbjct  188  TNGSQFFICTVKTPWLDQRHVVFGQVLEGMDVVRLIESQETDRGDRPKKRVVIGDCGELP  247

Query  178  IV  173
            +V
Sbjct  248  MV  249



>ref|XP_008648685.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Zea mays]
Length=301

 Score =   289 bits (739),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 174/186 (94%), Gaps = 5/186 (3%)
 Frame = -2

Query  715  ATAQVAEP-----QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            AT+  AEP     QSK+T++VYFDISIGNPVGK  GRIVIGLYGD+VPQTAENFRALCTG
Sbjct  116  ATSASAEPKEADLQSKITNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTAENFRALCTG  175

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+KGSSFHRVI DFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GPGVVSMAN
Sbjct  176  EKGFGYKGSSFHRVISDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVVSMAN  235

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V+LIESQETDRGDRPKK+VVIS+C
Sbjct  236  AGPNTNGSQFFICTVKTPWLDGRHVVFGQVVEGMDIVRLIESQETDRGDRPKKKVVISEC  295

Query  190  GELPIV  173
            GELP+V
Sbjct  296  GELPVV  301



>ref|XP_010025286.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Eucalyptus grandis]
 gb|KCW61909.1| hypothetical protein EUGRSUZ_H04606 [Eucalyptus grandis]
Length=257

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 181/197 (92%), Gaps = 2/197 (1%)
 Frame = -2

Query  763  SCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQ  584
            S S Q KS RP + VRA+A+ A  QSKVT++VY DISIGNPVGK  GRIVIGLYGD+VPQ
Sbjct  63   SSSPQRKS-RPCS-VRASAEAAAAQSKVTNKVYLDISIGNPVGKLVGRIVIGLYGDDVPQ  120

Query  583  TAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLV  404
            TAENFRALCTGEKGFG+KGS+ HRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL 
Sbjct  121  TAENFRALCTGEKGFGYKGSTVHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLS  180

Query  403  HAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGD  224
            H GPGVVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V+LIESQETDRGD
Sbjct  181  HVGPGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVRLIESQETDRGD  240

Query  223  RPKKRVVISDCGELPIV  173
            RP+KRVV+SDCGELP+V
Sbjct  241  RPRKRVVVSDCGELPVV  257



>ref|XP_006653937.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Oryza brachyantha]
Length=246

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 173/181 (96%), Gaps = 0/181 (0%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            A  + A+ QSK+T++VYFDISIGNPVG+  GR+VIGLYGD+VPQTAENFRALCTGEKGFG
Sbjct  66   ADPKEADLQSKITNKVYFDISIGNPVGRNVGRVVIGLYGDDVPQTAENFRALCTGEKGFG  125

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            +KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GPGVVSMANAGPNT
Sbjct  126  YKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVVSMANAGPNT  185

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            NGSQFFICTVKTPWLD RHVVFGQV+EGMD+V++IESQETDRGDRPKK+VVIS+CGELP+
Sbjct  186  NGSQFFICTVKTPWLDGRHVVFGQVVEGMDIVRIIESQETDRGDRPKKKVVISECGELPV  245

Query  175  V  173
            V
Sbjct  246  V  246



>dbj|BAJ90691.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86108.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=243

 Score =   285 bits (728),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 178/197 (90%), Gaps = 1/197 (1%)
 Frame = -2

Query  763  SCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQ  584
            S S+Q ++ R +A   A     E QSKVT++VYFDI+IGNPVGK  GRIVIGLYGD+VPQ
Sbjct  48   SVSLQTRA-RFVASASAEPYAPELQSKVTNKVYFDINIGNPVGKNVGRIVIGLYGDDVPQ  106

Query  583  TAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLV  404
            T ENFRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+LV
Sbjct  107  TVENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLV  166

Query  403  HAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGD  224
            H GPGV+SMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V++IES ETDRGD
Sbjct  167  HTGPGVLSMANAGPNTNGSQFFICTVKTPWLDGRHVVFGQVLEGMDIVRMIESSETDRGD  226

Query  223  RPKKRVVISDCGELPIV  173
            RPKK+VVIS+CGELP+V
Sbjct  227  RPKKKVVISECGELPVV  243



>ref|XP_003569145.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Brachypodium distachyon]
Length=242

 Score =   284 bits (727),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +    A  + AE QSKVT++VYFDISIGNPVGK  GRIVIGLYGD+VPQT ENFRALC
Sbjct  55   RFVTSASAEPKAAELQSKVTNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTVENFRALC  114

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GPGV+SM
Sbjct  115  TGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVLSM  174

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EG+D+V +IES ETDRGDRPKK+VVIS
Sbjct  175  ANAGPNTNGSQFFICTVKTPWLDGRHVVFGQVLEGLDIVSMIESSETDRGDRPKKKVVIS  234

Query  196  DCGELPIV  173
            +CGELP+V
Sbjct  235  ECGELPVV  242



>emb|CAN82436.1| hypothetical protein VITISV_040459 [Vitis vinifera]
Length=180

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  700  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  521
            A  QSKVT +VYFDISIGNPVGK  GRIVIGL+GD+VPQTAENFRALCTGEKGFG+KGS+
Sbjct  5    APLQSKVTQKVYFDISIGNPVGKVVGRIVIGLFGDDVPQTAENFRALCTGEKGFGYKGST  64

Query  520  FHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF  341
            FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSMANAGPNTNGSQF
Sbjct  65   FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLAHVGPGVVSMANAGPNTNGSQF  124

Query  340  FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPIV  173
            FICTVKTPWLD RHVVFGQV+EGMD+VKL+ESQETDRGDRP+K+VVIS+CGELP+V
Sbjct  125  FICTVKTPWLDQRHVVFGQVLEGMDIVKLVESQETDRGDRPRKKVVISECGELPMV  180



>gb|ABO37960.1| peptidylprolyl isomerase [Triticum aestivum]
Length=245

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  751  QVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAEN  572
            Q    R +A   A     E QSKVT++VYFDISIGNPVGK  GRIVIGLYGD+VPQT EN
Sbjct  53   QQSRARFVASASAEPYAPELQSKVTNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTVEN  112

Query  571  FRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGP  392
            FRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+LVH GP
Sbjct  113  FRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLVHTGP  172

Query  391  GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK  212
            GV+SMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V+ IES ETDRGDRPKK
Sbjct  173  GVLSMANAGPNTNGSQFFICTVKTPWLDGRHVVFGQVLEGMDIVRTIESSETDRGDRPKK  232

Query  211  RVVISDCGELPIV  173
            +VVIS+CGELP+V
Sbjct  233  KVVISECGELPVV  245



>gb|AAP44537.1| cyclophilin-like protein [Triticum aestivum]
Length=245

 Score =   281 bits (720),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +A   A     E QSKVT++VYFDISIGNPVGK  GRIVIGLYGD+VPQT ENFRALC
Sbjct  58   RFVASASAEPYAPELQSKVTNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTVENFRALC  117

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+LVH GPGV+SM
Sbjct  118  TGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLVHTGPGVLSM  177

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V++IES ETDRGDRPKK+VVIS
Sbjct  178  ANAGPNTNGSQFFICTVKTPWLDGRHVVFGQVLEGMDIVRMIESSETDRGDRPKKKVVIS  237

Query  196  DCGELPIV  173
            + GELP+V
Sbjct  238  ESGELPVV  245



>ref|XP_008459881.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Cucumis melo]
Length=250

 Score =   282 bits (721),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  721  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  542
            VRA+A+V   Q+KVT++VYFD+SIGNPVGK AGRIVIGL+GD+VP+TAENFRALCTGEKG
Sbjct  68   VRASAEVPPLQAKVTNKVYFDVSIGNPVGKLAGRIVIGLFGDDVPKTAENFRALCTGEKG  127

Query  541  fgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGP  362
            FGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GPGVVSMANAGP
Sbjct  128  FGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGPGVVSMANAGP  187

Query  361  NTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            NTNGSQFFICTVKTPWLD RHVVFGQV+EG + VKLIESQETDRGDRP K+VVISDCGEL
Sbjct  188  NTNGSQFFICTVKTPWLDQRHVVFGQVLEGFETVKLIESQETDRGDRPLKKVVISDCGEL  247

Query  181  PI  176
            P+
Sbjct  248  PV  249



>gb|AAP44535.1| cyclophilin-like protein [Triticum aestivum]
Length=245

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 181/215 (84%), Gaps = 15/215 (7%)
 Frame = -2

Query  772  KFSSCSVQVKSGRPLAPVRATAQ----------VAEP-----QSKVTSQVYFDISIGNPV  638
            K  S ++ ++ GR  +P  + +Q           AEP     QSKVT++VYFDISIGNPV
Sbjct  31   KVPSSALSLRGGRVASPALSVSQQSRARFVASASAEPYAPELQSKVTNKVYFDISIGNPV  90

Query  637  GKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngt  458
            GK  GRIVIGLYGD+VPQT ENFRALC GEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGT
Sbjct  91   GKNVGRIVIGLYGDDVPQTVENFRALCAGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGT  150

Query  457  ggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVI  278
            GGKSIYGRTFKDENF+LVH GPGV+SMANAGPNTNGSQFFICT+KTPWLD RHVVFGQV+
Sbjct  151  GGKSIYGRTFKDENFQLVHTGPGVLSMANAGPNTNGSQFFICTMKTPWLDGRHVVFGQVL  210

Query  277  EGMDVVKLIESQETDRGDRPKKRVVISDCGELPIV  173
            EGMD+V+ IES ETDRGDRPKK+VVIS+CGELP+V
Sbjct  211  EGMDIVRTIESSETDRGDRPKKKVVISECGELPVV  245



>ref|XP_009131319.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Brassica rapa]
Length=257

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -2

Query  745  KSGRPLAPVRATAQ-VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  569
            K  R    V+++A+ +AEPQSK+T +VYFDIS+GNPVGK AGRIVIGL+GD+VPQT ENF
Sbjct  64   KRNRRCLSVQSSAEPLAEPQSKITHKVYFDISVGNPVGKLAGRIVIGLFGDDVPQTVENF  123

Query  568  RALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPG  389
            RALCTGEKGFG+KGS+FHRVI+DFMIQGGDFDKGNGTGGKS+YGRTFKDENF L H GPG
Sbjct  124  RALCTGEKGFGYKGSTFHRVIRDFMIQGGDFDKGNGTGGKSVYGRTFKDENFNLSHVGPG  183

Query  388  VVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKR  209
            VVSMANAGPNTNGSQFFICTVKT WLD RHVVFGQVIEGMDVV+LIE QETDRGDRP+K+
Sbjct  184  VVSMANAGPNTNGSQFFICTVKTSWLDGRHVVFGQVIEGMDVVRLIEEQETDRGDRPRKK  243

Query  208  VVISDCGELPI  176
            VVI+DCG+LP+
Sbjct  244  VVIADCGQLPM  254



>emb|CDP13378.1| unnamed protein product [Coffea canephora]
Length=257

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -2

Query  700  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  521
            A  QSKVT +VY DISIGNPVGK AGRIVIGLYGD+VPQTAENFRALCTGEKGFG+KGSS
Sbjct  82   ASLQSKVTHKVYLDISIGNPVGKLAGRIVIGLYGDDVPQTAENFRALCTGEKGFGYKGSS  141

Query  520  FHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF  341
            FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPGVVSMANAGPNTNGSQF
Sbjct  142  FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHTGPGVVSMANAGPNTNGSQF  201

Query  340  FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FICTVKTPWLD RHVVFGQV+EGMD+V+LIESQETDRGDRP+ RVV+SDCGELP+
Sbjct  202  FICTVKTPWLDQRHVVFGQVLEGMDIVRLIESQETDRGDRPRLRVVVSDCGELPV  256



>emb|CDX78508.1| BnaA03g04200D [Brassica napus]
Length=256

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 175/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  748  VKSGRPLAPVRATAQ-VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAEN  572
             K  R    V+++A+ +AEPQSK+T +VYFDIS+GNPVGK AGRIVIGL+GD+VPQT EN
Sbjct  62   TKRNRRCLSVQSSAEPLAEPQSKITHKVYFDISVGNPVGKLAGRIVIGLFGDDVPQTVEN  121

Query  571  FRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGP  392
            FRALCTGEKGFG+KGS+FHRVI+DFMIQGGDFDKGNGTGGKS+YGRTFKDENF L H GP
Sbjct  122  FRALCTGEKGFGYKGSTFHRVIRDFMIQGGDFDKGNGTGGKSVYGRTFKDENFNLSHVGP  181

Query  391  GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK  212
            GVVSMANAGPNTNGSQFFICTVKT WLD RHVVFGQVIEGMDVV+LIE QETDRGDRP+K
Sbjct  182  GVVSMANAGPNTNGSQFFICTVKTSWLDGRHVVFGQVIEGMDVVRLIEEQETDRGDRPRK  241

Query  211  RVVISDCGELPI  176
            +VVI+DCG+LP+
Sbjct  242  KVVIADCGQLPM  253



>emb|CDX70495.1| BnaC03g05790D [Brassica napus]
Length=257

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 174/188 (93%), Gaps = 1/188 (1%)
 Frame = -2

Query  736  RPLAPVRATAQ-VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRAL  560
            R    V+++A+ +AEPQSK+T +VYFDIS+GNPVGK AGRIVIGL+GD+VPQT ENFRAL
Sbjct  67   RSCLSVQSSAEPLAEPQSKITHKVYFDISVGNPVGKLAGRIVIGLFGDDVPQTVENFRAL  126

Query  559  CTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVS  380
            CTGEKGFG+KGS+FHRVI+DFMIQGGDFDKGNGTGGKS+YGRTFKDENF L H GPGVVS
Sbjct  127  CTGEKGFGYKGSTFHRVIRDFMIQGGDFDKGNGTGGKSVYGRTFKDENFNLSHVGPGVVS  186

Query  379  MANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVI  200
            MANAGPNTNGSQFFICTVKT WLD RHVVFGQVIEGMDVV+LIE QETDRGDRP+K+VVI
Sbjct  187  MANAGPNTNGSQFFICTVKTSWLDGRHVVFGQVIEGMDVVRLIEEQETDRGDRPRKKVVI  246

Query  199  SDCGELPI  176
            +DCG+LP+
Sbjct  247  ADCGQLPM  254



>ref|XP_003556583.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
isoform 1 [Glycine max]
Length=253

 Score =   280 bits (717),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  739  GRPLAPVRATAQVAEP---QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  569
            GR    VRA++   E    QSKVT +V+FD+SIGNPVGK  GRIVIGLYGD+VPQTAENF
Sbjct  62   GRVRVRVRASSSSDEAVSAQSKVTQKVFFDVSIGNPVGKLVGRIVIGLYGDDVPQTAENF  121

Query  568  RALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPG  389
            RALCTGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GPG
Sbjct  122  RALCTGEKGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGPG  181

Query  388  VVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKR  209
            VVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V+LIESQETDRGDRP K+
Sbjct  182  VVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVRLIESQETDRGDRPTKK  241

Query  208  VVISDCGELP  179
            V ISDCGELP
Sbjct  242  VTISDCGELP  251



>ref|NP_001190299.1| peptidyl-prolyl cis-trans isomerase CYP20-2 [Arabidopsis thaliana]
 gb|AED91853.1| peptidyl-prolyl cis-trans isomerase CYP20-2 [Arabidopsis thaliana]
Length=255

 Score =   280 bits (717),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  77   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  136

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GPGV+SMANAGPNTNGSQ
Sbjct  137  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQ  196

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICT+KT WLD RHVVFGQVIEGM+VVKLIE QETDRGDRP+K+VVI+DCG+LP+
Sbjct  197  FFICTIKTSWLDGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQLPM  252



>gb|AAM65904.1| peptidylprolyl isomerase-like protein [Arabidopsis thaliana]
Length=259

 Score =   280 bits (716),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GPGV+SMANAGPNTNGSQ
Sbjct  141  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQ  200

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICT+KT WLD RHVVFGQVIEGM+VVKLIE QETDRGDRP+K+VVI+DCG+LP+
Sbjct  201  FFICTIKTSWLDGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQLPM  256



>ref|NP_196816.1| peptidyl-prolyl cis-trans isomerase CYP20-2 [Arabidopsis thaliana]
 sp|Q9ASS6.1|PNSL5_ARATH RecName: Full=Photosynthetic NDH subunit of lumenal location 
5, chloroplastic; AltName: Full=Cyclophilin of 20 kDa 2; AltName: 
Full=Peptidyl-prolyl cis-trans isomerase CYP20-2; Short=PPIase 
CYP20-2; AltName: Full=Rotamase CYP20-2; AltName: Full=Thylakoid 
lumen PPIase of 20 kDa; Short=TLP20; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK32894.1|AF367307_1 AT5g13120/T19L5_80 [Arabidopsis thaliana]
 gb|AAL15377.1| AT5g13120/T19L5_80 [Arabidopsis thaliana]
 gb|AAS75300.1| thylakoid lumen single domain cyclophilin type peptidyl-prolyl 
cis-trans isomerase [Arabidopsis thaliana]
 gb|AED91852.1| peptidyl-prolyl cis-trans isomerase CYP20-2 [Arabidopsis thaliana]
Length=259

 Score =   280 bits (716),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GPGV+SMANAGPNTNGSQ
Sbjct  141  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQ  200

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICT+KT WLD RHVVFGQVIEGM+VVKLIE QETDRGDRP+K+VVI+DCG+LP+
Sbjct  201  FFICTIKTSWLDGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQLPM  256



>ref|XP_010682710.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=257

 Score =   280 bits (716),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 177/211 (84%), Gaps = 13/211 (6%)
 Frame = -2

Query  766  SSCSVQVKSGRP---------LAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAA  626
            S C V  K   P         L  VRA+A    Q    QSKVT++VYFDIS+GNPVGK A
Sbjct  47   SFCCVSFKCSSPSSLHRKPNFLTSVRASAESNLQETPLQSKVTNKVYFDISVGNPVGKLA  106

Query  625  GRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKS  446
            GRIVIGL+GD+VP+T ENFRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKS
Sbjct  107  GRIVIGLFGDDVPRTTENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKS  166

Query  445  IYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMD  266
            IYGRTFKDENF L H G GV+SMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD
Sbjct  167  IYGRTFKDENFNLSHIGAGVLSMANAGPNTNGSQFFICTVKTPWLDKRHVVFGQVLEGMD  226

Query  265  VVKLIESQETDRGDRPKKRVVISDCGELPIV  173
            VV+ IESQETDRGDRP+KRVVISDCGELP+V
Sbjct  227  VVRSIESQETDRGDRPRKRVVISDCGELPMV  257



>ref|XP_006399800.1| hypothetical protein EUTSA_v10014434mg [Eutrema salsugineum]
 gb|ESQ41253.1| hypothetical protein EUTSA_v10014434mg [Eutrema salsugineum]
Length=260

 Score =   280 bits (716),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            + EPQSK+T +VY DIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  82   LTEPQSKITHKVYLDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  141

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GPGV+SMANAGPNTNGSQ
Sbjct  142  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQ  201

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICTVKT WLD RHVVFGQVIEGMDVVKLIE QETDRGDRP+K+VVI+DCG+LPI
Sbjct  202  FFICTVKTSWLDGRHVVFGQVIEGMDVVKLIEEQETDRGDRPRKKVVIADCGQLPI  257



>ref|XP_010492057.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Camelina sativa]
Length=256

 Score =   280 bits (715),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            VAEPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  78   VAEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  137

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            +FHRVIKDFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GPGV+SMANAGPNTNGSQ
Sbjct  138  TFHRVIKDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQ  197

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICTV T WL+ RHVVFGQVIEGM+VVKLIE QETDRGDRP+K+VVI+DCG+LP+
Sbjct  198  FFICTVTTSWLNGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQLPM  253



>ref|XP_010453368.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Camelina sativa]
Length=259

 Score =   279 bits (714),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            +FHRVIKDFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GPGV+SMANAGPNTNGSQ
Sbjct  141  TFHRVIKDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQ  200

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICTV T WL+ RHVVFGQV+EGM+VVKLIE QETDRGDRP+K+VVI+DCG+LP+
Sbjct  201  FFICTVTTSWLNGRHVVFGQVLEGMEVVKLIEEQETDRGDRPRKKVVIADCGQLPM  256



>dbj|BAJ87839.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 177/197 (90%), Gaps = 1/197 (1%)
 Frame = -2

Query  763  SCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQ  584
            S S+Q ++ R +A   A     E QSKVT++VYFDI+IGNPVGK   RIVIGLYGD+VPQ
Sbjct  84   SVSLQTRA-RFVASASAEPYAPELQSKVTNKVYFDINIGNPVGKNVRRIVIGLYGDDVPQ  142

Query  583  TAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLV  404
            T ENFRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+LV
Sbjct  143  TVENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLV  202

Query  403  HAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGD  224
            H GPGV+SMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V++IES ETDRGD
Sbjct  203  HTGPGVLSMANAGPNTNGSQFFICTVKTPWLDGRHVVFGQVLEGMDIVRMIESSETDRGD  262

Query  223  RPKKRVVISDCGELPIV  173
            RPKK+VVIS+CGELP+V
Sbjct  263  RPKKKVVISECGELPVV  279



>gb|ACU19042.1| unknown [Glycine max]
Length=253

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = -2

Query  739  GRPLAPVRATA---QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  569
            GR    VRA++   +    QSKVT +V+FD+SIGNPVGK  GRIVIGLYGD+VPQTAENF
Sbjct  62   GRVRVRVRASSSSDEAVSAQSKVTQKVFFDVSIGNPVGKLVGRIVIGLYGDDVPQTAENF  121

Query  568  RALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPG  389
            RALCTGEKGFG+KGS+FHRVIK+FMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GPG
Sbjct  122  RALCTGEKGFGYKGSTFHRVIKNFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGPG  181

Query  388  VVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKR  209
            VVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V+LIESQETDRGDRP K+
Sbjct  182  VVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVRLIESQETDRGDRPTKK  241

Query  208  VVISDCGELP  179
            V ISDCGELP
Sbjct  242  VTISDCGELP  251



>ref|XP_010419878.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
[Camelina sativa]
Length=259

 Score =   279 bits (713),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            +FHRVIKDFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GPGV+SMANAGPNTNGSQ
Sbjct  141  TFHRVIKDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQ  200

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICTV T WL+ RHVVFGQVIEGM+VVKLIE QETDRGDRP+K+VVI+DCG+LP+
Sbjct  201  FFICTVTTSWLNGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQLPM  256



>ref|XP_006288490.1| hypothetical protein CARUB_v10001755mg [Capsella rubella]
 gb|EOA21388.1| hypothetical protein CARUB_v10001755mg [Capsella rubella]
Length=259

 Score =   279 bits (713),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            VAEPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VAEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YG  FKDENFKL H GPGV+SMANAGPNTNGSQ
Sbjct  141  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGSRFKDENFKLSHVGPGVLSMANAGPNTNGSQ  200

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICTVKT WLD RHVVFGQVIEGM+VVKLIE QETDRGDRP+K+VVI+DCGELP+
Sbjct  201  FFICTVKTSWLDGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGELPM  256



>ref|XP_010929720.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like, 
partial [Elaeis guineensis]
Length=210

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  718  RATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  539
            RA  + AE QSKVT++V+FDISIGNP G   GRIVIGLYGD+VPQTAENFR LCTGEKGF
Sbjct  29   RAELKEAELQSKVTNKVFFDISIGNPEGNVVGRIVIGLYGDDVPQTAENFRVLCTGEKGF  88

Query  538  gfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPN  359
            G+KGS+FHR+I+DFMIQGGDF+KGNGTGGKSIYGRTF+DENFKL H GPGVVSMANAGPN
Sbjct  89   GYKGSAFHRIIQDFMIQGGDFEKGNGTGGKSIYGRTFRDENFKLSHVGPGVVSMANAGPN  148

Query  358  TNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            TNGSQFFICTV+TPWLD RHVVFGQV+EGMDVV++IESQETDRGDRPKK+VVIS+CGELP
Sbjct  149  TNGSQFFICTVETPWLDQRHVVFGQVLEGMDVVRVIESQETDRGDRPKKKVVISECGELP  208

Query  178  IV  173
            +V
Sbjct  209  MV  210



>emb|CAC05440.1| peptidylprolyl isomerase-like protein [Arabidopsis thaliana]
Length=259

 Score =   278 bits (711),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            +FHRVI+DFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL H GPGV+SMANAGPNTNGSQ
Sbjct  141  TFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQ  200

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICT+KT WLD RHVVFGQVIEGM+VVKLIE QETDRGDRP+K+VVI+DCG+LP+
Sbjct  201  FFICTIKTSWLDGRHVVFGQVIEGMEVVKLIEEQETDRGDRPRKKVVIADCGQLPM  256



>ref|XP_004497425.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Cicer arietinum]
Length=253

 Score =   278 bits (710),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 168/191 (88%), Gaps = 4/191 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEP----QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  569
            R    VRA +  +E     QSKVT +VYFDISIGNPVGK  GRIVIGLYGD+VPQT ENF
Sbjct  62   RKTMKVRAGSSSSEEEVIVQSKVTHKVYFDISIGNPVGKLVGRIVIGLYGDDVPQTVENF  121

Query  568  RALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPG  389
            RALCTGEKGFG+K SSFHRVI  FMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPG
Sbjct  122  RALCTGEKGFGYKASSFHRVINQFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHTGPG  181

Query  388  VVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKR  209
            VVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V+LIESQETDRGDRP+K+
Sbjct  182  VVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVRLIESQETDRGDRPRKK  241

Query  208  VVISDCGELPI  176
            VVISD GELPI
Sbjct  242  VVISDSGELPI  252



>gb|KHN37252.1| Peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic [Glycine 
soja]
Length=250

 Score =   278 bits (710),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            QSKVT +VYFD+SIGNPVGK  GRIVIGLYGD+VPQTAENFRALCTGEKGFG+KGS+ HR
Sbjct  78   QSKVTQKVYFDVSIGNPVGKFVGRIVIGLYGDDVPQTAENFRALCTGEKGFGYKGSTVHR  137

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GPGVVSMANAGPNTNGSQFFIC
Sbjct  138  VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGPGVVSMANAGPNTNGSQFFIC  197

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            TVKTPWLD RHVVFGQV+EGM +V+LIESQETDRGDRP+K+V ISDCGELPI
Sbjct  198  TVKTPWLDQRHVVFGQVLEGMAIVRLIESQETDRGDRPRKKVTISDCGELPI  249



>gb|KFK25546.1| hypothetical protein AALP_AA8G128900 [Arabis alpina]
Length=253

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = -2

Query  721  VRATAQVA-EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEk  545
            V++ A+V  EPQSK+T +VY DIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEK
Sbjct  68   VQSNAEVVIEPQSKITHKVYLDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEK  127

Query  544  gfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAG  365
            GFG+KGS+FHRVIKDFMIQGGDF+KGNGTGGKS+YG+TFKDENFKL H GPGV+SMANAG
Sbjct  128  GFGYKGSTFHRVIKDFMIQGGDFEKGNGTGGKSVYGKTFKDENFKLSHVGPGVLSMANAG  187

Query  364  PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE  185
            PNTNGSQFFICTV T WL+ RHVVFGQVIEGMDVVKLIE QETDRGDRP+KRVVI+DCG+
Sbjct  188  PNTNGSQFFICTVTTSWLNGRHVVFGQVIEGMDVVKLIEDQETDRGDRPRKRVVIADCGQ  247

Query  184  LP  179
            LP
Sbjct  248  LP  249



>ref|XP_003536816.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Glycine max]
Length=251

 Score =   276 bits (706),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            QSKVT +VYFD+SIGNPVGK  GRIVIGLYGD+VPQTAENFRALCTGEKGFG+KGS+ HR
Sbjct  79   QSKVTQKVYFDVSIGNPVGKFVGRIVIGLYGDDVPQTAENFRALCTGEKGFGYKGSTVHR  138

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GPGVVSMANAGPNTNGSQFFIC
Sbjct  139  VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGPGVVSMANAGPNTNGSQFFIC  198

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            TVKTPWLD RHVVFGQV+EGM +V+LIESQETDRGDRP+K+V ISDCGELPI
Sbjct  199  TVKTPWLDQRHVVFGQVLEGMAIVRLIESQETDRGDRPRKKVTISDCGELPI  250



>ref|XP_004310109.1| PREDICTED: photosynthetic NDH subunit of lumenal location 5, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=254

 Score =   276 bits (705),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R ++ VRA+A+    Q KVT++VYFDISIGNPVGK AGR+VIGL+GD+VPQT ENFR+LC
Sbjct  67   RTISSVRASAEEPALQGKVTNKVYFDISIGNPVGKLAGRVVIGLFGDDVPQTVENFRSLC  126

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL+H GPGV+SM
Sbjct  127  TGEKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLLHTGPGVLSM  186

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTV+TPWL+ RHVVFGQV+EGM++V++IES ETDRGDRP K+VVI+
Sbjct  187  ANAGPNTNGSQFFICTVQTPWLNGRHVVFGQVLEGMEIVRMIESLETDRGDRPTKKVVIA  246

Query  196  DCGELPI  176
            +CGELP+
Sbjct  247  ECGELPV  253



>ref|XP_004140542.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004170245.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46438.1| hypothetical protein Csa_6G093090 [Cucumis sativus]
Length=250

 Score =   274 bits (701),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  721  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  542
            VRA+A+V   Q+KVT++VYFD+SIGNPVGK AGRIVIGL+GD+VP+TAENFRALCTGEKG
Sbjct  68   VRASAEVPPLQAKVTNKVYFDVSIGNPVGKLAGRIVIGLFGDDVPKTAENFRALCTGEKG  127

Query  541  fgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGP  362
            FGFKGS FHRVI+DFMIQGGDF+KGNGTGGKSIYGRTFKDENF L H GPG+VSMANAGP
Sbjct  128  FGFKGSVFHRVIEDFMIQGGDFEKGNGTGGKSIYGRTFKDENFNLSHTGPGIVSMANAGP  187

Query  361  NTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            NTNGSQFFICTVKT WLD RHVVFGQV+EG ++VKLIESQETDR DRP K+VVISDCGEL
Sbjct  188  NTNGSQFFICTVKTQWLDLRHVVFGQVLEGFEIVKLIESQETDRADRPLKKVVISDCGEL  247

Query  181  PI  176
            P+
Sbjct  248  PV  249



>gb|AGV54525.1| peptidyl-prolyl cis-trans isomerase [Phaseolus vulgaris]
Length=253

 Score =   272 bits (695),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R  A   ++ + A  Q+KVT +V+FDI IGNPVGK  GR+VIGLYGD+VPQTAENFRALC
Sbjct  66   RVRASSSSSGEDAIVQAKVTQKVFFDIGIGNPVGKLVGRVVIGLYGDDVPQTAENFRALC  125

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GPGVVSM
Sbjct  126  TGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFVLSHTGPGVVSM  185

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V+L+ESQETDRGDRPKK V I 
Sbjct  186  ANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVRLVESQETDRGDRPKKNVTII  245

Query  196  DCGELPI  176
            DCGE+PI
Sbjct  246  DCGEIPI  252



>ref|XP_007142599.1| hypothetical protein PHAVU_007G001100g [Phaseolus vulgaris]
 gb|ESW14593.1| hypothetical protein PHAVU_007G001100g [Phaseolus vulgaris]
Length=265

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R  A   ++ + A  Q+KVT +V+FDI IGNPVGK  GR+VIGLYGD+VPQTAENFRALC
Sbjct  78   RVRASSSSSGEDAIVQAKVTQKVFFDIGIGNPVGKLVGRVVIGLYGDDVPQTAENFRALC  137

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GPGVVSM
Sbjct  138  TGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFVLSHTGPGVVSM  197

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD+V+L+ESQETDRGDRPKK V I 
Sbjct  198  ANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDIVRLVESQETDRGDRPKKNVTII  257

Query  196  DCGELPI  176
            DCGE+PI
Sbjct  258  DCGEIPI  264



>gb|AFK36387.1| unknown [Medicago truncatula]
 gb|KEH44554.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
 gb|KEH44555.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=244

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            QSKVT +V+FD+SIGNPVGK  GRIVIGL+GD+VPQT ENFRAL TGEKGFG+K S+FHR
Sbjct  72   QSKVTHKVFFDVSIGNPVGKLVGRIVIGLFGDDVPQTVENFRALSTGEKGFGYKSSTFHR  131

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GPG VSMANAGPNTNGSQFFIC
Sbjct  132  VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGPGAVSMANAGPNTNGSQFFIC  191

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            TVKTPWLD RHVVFGQV+EGMD+V+LIESQETDRGDRP K+V ISDCGELPI
Sbjct  192  TVKTPWLDQRHVVFGQVLEGMDIVRLIESQETDRGDRPLKKVTISDCGELPI  243



>ref|XP_006844622.1| hypothetical protein AMTR_s00016p00225920 [Amborella trichopoda]
 gb|ERN06297.1| hypothetical protein AMTR_s00016p00225920 [Amborella trichopoda]
Length=252

 Score =   269 bits (687),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 167/185 (90%), Gaps = 4/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
             + VRA A   E Q+KVT +VYFDI+IG PVG    RI++GL+GDEVPQT ENF+ALCTG
Sbjct  71   FSSVRAEATSPELQAKVTKKVYFDITIGKPVG----RILMGLFGDEVPQTVENFKALCTG  126

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL H GPG++SMAN
Sbjct  127  EKGFGYKGSTFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLAHLGPGILSMAN  186

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMDVVKLIESQETDRGDRPK +VVIS+C
Sbjct  187  AGPNTNGSQFFICTVKTPWLDKRHVVFGQVLEGMDVVKLIESQETDRGDRPKSKVVISEC  246

Query  190  GELPI  176
            GELP+
Sbjct  247  GELPV  251



>gb|ACJ85448.1| unknown [Medicago truncatula]
Length=244

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/172 (85%), Positives = 158/172 (92%), Gaps = 0/172 (0%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            QSKVT +V+FD+SIGNPVGK  GRIVIGL+GD+VPQT ENFRAL TGEKGFG+K S+FHR
Sbjct  72   QSKVTHKVFFDVSIGNPVGKLVGRIVIGLFGDDVPQTVENFRALSTGEKGFGYKSSTFHR  131

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF L H GPG VSMANAGPNTNGSQFFIC
Sbjct  132  VIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFNLSHTGPGAVSMANAGPNTNGSQFFIC  191

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            TVKTPWLD RHVVFGQV+EGMD+V+LIESQE DRGDRP K+V ISDCGELPI
Sbjct  192  TVKTPWLDQRHVVFGQVLEGMDIVRLIESQEPDRGDRPLKKVTISDCGELPI  243



>ref|XP_004960937.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
isoform X1 [Setaria italica]
Length=294

 Score =   269 bits (687),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 173/226 (77%), Gaps = 46/226 (20%)
 Frame = -2

Query  712  TAQVAEP-----QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGE  548
            T+  AEP     QSKVT++VYFDISIGNPVGK  GRIVIGL+GD+VPQTAENFRALCTGE
Sbjct  69   TSASAEPKEADIQSKVTNKVYFDISIGNPVGKNVGRIVIGLFGDDVPQTAENFRALCTGE  128

Query  547  kgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANA  368
            KGFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVH GPGVVSMANA
Sbjct  129  KGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLVHTGPGVVSMANA  188

Query  367  GPNTNGSQFFICTVK-----------------------------------------TPWL  311
            GPNTNGSQFFICTVK                                         TPWL
Sbjct  189  GPNTNGSQFFICTVKVNLVHTREMTFVFAASATLSIYLCTSAKDNPELVRLVPWMQTPWL  248

Query  310  DNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPIV  173
            D RHVVFGQV+EGMD+V+LIES ETDRGDRPKK+VVIS+CGELP+V
Sbjct  249  DGRHVVFGQVLEGMDIVRLIESSETDRGDRPKKKVVISECGELPVV  294



>ref|XP_009628829.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=185

 Score =   265 bits (676),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            +A   AT  VAE QSKVT +VYFDISIGNP GK AGRIVIGLYGD+VP TA+NFRALCTG
Sbjct  1    MAATFATV-VAEVQSKVTHKVYFDISIGNPDGKLAGRIVIGLYGDDVPVTAKNFRALCTG  59

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            E GFG+K S+FHRVI++FMIQGGDFDKGNG GGKSIYGRTF+DENFKL H GPGVVSMAN
Sbjct  60   ENGFGYKDSAFHRVIRNFMIQGGDFDKGNGIGGKSIYGRTFEDENFKLTHTGPGVVSMAN  119

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
             GP+TNGSQFFICTVKTPW D R+VVFGQV+EGMD+VK IESQETD GDRP+ RVVISDC
Sbjct  120  DGPDTNGSQFFICTVKTPWFDERYVVFGQVLEGMDIVKSIESQETDGGDRPRMRVVISDC  179

Query  190  GELPI  176
            GELP+
Sbjct  180  GELPV  184



>ref|XP_009404751.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   265 bits (678),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 166/182 (91%), Gaps = 4/182 (2%)
 Frame = -2

Query  718  RATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  539
            RA  +V++ QS VT++V+FDISIG  VG    RIVIGLYGD+VPQTAENFRALCTGEKGF
Sbjct  69   RAELKVSDLQSTVTTKVFFDISIGGHVG----RIVIGLYGDDVPQTAENFRALCTGEKGF  124

Query  538  gfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPN  359
            G+KGS+FHRVIKDFMIQGGDFD+GNGTGGKSIYGRTFKDENFKL H GPG+VSMANAGP+
Sbjct  125  GYKGSAFHRVIKDFMIQGGDFDQGNGTGGKSIYGRTFKDENFKLTHLGPGIVSMANAGPD  184

Query  358  TNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            TNGSQFFICTVKTPWLD RHVVFGQV+EGM+VV+ IESQETDRGDRPKK VVISDCGELP
Sbjct  185  TNGSQFFICTVKTPWLDKRHVVFGQVLEGMEVVRQIESQETDRGDRPKKNVVISDCGELP  244

Query  178  IV  173
             V
Sbjct  245  SV  246



>gb|KJB12530.1| hypothetical protein B456_002G023000 [Gossypium raimondii]
Length=243

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 164/194 (85%), Gaps = 16/194 (8%)
 Frame = -2

Query  757  SVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTA  578
            S Q  + R    VRATA+VA  QSK+T++V+FD+SIGNPVGK AG+IVIGLYG       
Sbjct  63   SPQTNNHRVRRSVRATAEVAPIQSKITNKVFFDVSIGNPVGKLAGKIVIGLYG-------  115

Query  577  ENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHA  398
                     EKGFG+KGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKL HA
Sbjct  116  ---------EKGFGYKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFKLSHA  166

Query  397  GPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRP  218
            GPGVVSMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV+EGMD VKLIESQETDRGDRP
Sbjct  167  GPGVVSMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDTVKLIESQETDRGDRP  226

Query  217  KKRVVISDCGELPI  176
            +K+VVISDCGELP+
Sbjct  227  RKKVVISDCGELPM  240



>gb|EMT15783.1| Peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic [Aegilops 
tauschii]
Length=462

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 157/167 (94%), Gaps = 0/167 (0%)
 Frame = -2

Query  709  AQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfk  530
            ++  E QSKVT++VYFDISIGNPVGK  GRIVIGLYGD+VPQT ENFRALCTGEKGFG+K
Sbjct  30   SKAPELQSKVTNKVYFDISIGNPVGKNVGRIVIGLYGDDVPQTVENFRALCTGEKGFGYK  89

Query  529  gssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNG  350
            GSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENF+LVH GPGV+SMANAGPNTNG
Sbjct  90   GSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLVHTGPGVLSMANAGPNTNG  149

Query  349  SQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKR  209
            SQFFICT+KTPWLD RHVVFGQV+EGMD+V+ IES ETDRGDRPKK+
Sbjct  150  SQFFICTMKTPWLDGRHVVFGQVLEGMDIVRTIESSETDRGDRPKKK  196



>ref|XP_002873599.1| hypothetical protein ARALYDRAFT_488128 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49858.1| hypothetical protein ARALYDRAFT_488128 [Arabidopsis lyrata subsp. 
lyrata]
Length=278

 Score =   245 bits (625),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 167/195 (86%), Gaps = 19/195 (10%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V+EPQSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGS
Sbjct  81   VSEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGS  140

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            +FHRVI+DFMIQGGDFDKGNGTGGKS+YGRTFKDENFKL H GPGV+SMANAGPNTNGSQ
Sbjct  141  TFHRVIRDFMIQGGDFDKGNGTGGKSVYGRTFKDENFKLSHVGPGVLSMANAGPNTNGSQ  200

Query  343  FFICTVK-----TPWLDNR----------HVVFGQ----VIEGMDVVKLIESQETDRGDR  221
            FFICTVK     T  L+++          +V+ G+    VIEGM+VVKLIE QETDRGDR
Sbjct  201  FFICTVKARISLTIILEHQQSLRIIPSKLYVMVGRKACGVIEGMEVVKLIEEQETDRGDR  260

Query  220  PKKRVVISDCGELPI  176
            P+K+VVI+DCG+LP+
Sbjct  261  PRKKVVIADCGQLPM  275



>gb|ABK21441.1| unknown [Picea sitchensis]
Length=261

 Score =   244 bits (623),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 157/181 (87%), Gaps = 3/181 (2%)
 Frame = -2

Query  721  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  542
             RA +Q A  QSKVTS+ +FDI IG   G  AGRIV+GL+G++VP+T ENFRALCTGEKG
Sbjct  84   ARAMSQDAAFQSKVTSKCFFDIEIG---GAPAGRIVLGLFGEDVPKTTENFRALCTGEKG  140

Query  541  fgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGP  362
            FG+KGSSFHR+IKDFM+QGGDFD+ +GTGGKSIYGRTF+DENFKL H GPGV+SMANAGP
Sbjct  141  FGYKGSSFHRIIKDFMLQGGDFDREDGTGGKSIYGRTFEDENFKLTHVGPGVLSMANAGP  200

Query  361  NTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            NTNGSQFFICTVKTPWLD RHVVFG VIEG+DVVK +ES+ET+R DRPKK   I DCGEL
Sbjct  201  NTNGSQFFICTVKTPWLDKRHVVFGHVIEGLDVVKKLESEETNRTDRPKKPCRIVDCGEL  260

Query  181  P  179
            P
Sbjct  261  P  261



>emb|CCI55395.1| NDH subunit PnsL5 [Marchantia polymorpha]
Length=252

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 154/180 (86%), Gaps = 3/180 (2%)
 Frame = -2

Query  721  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  542
            VRA A   E Q+KVT++VYFDI IG   GK AG+I++GL+GD VP+TAENFRALCTGEKG
Sbjct  75   VRAMASEKEYQAKVTNKVYFDIEIG---GKPAGKIILGLFGDVVPKTAENFRALCTGEKG  131

Query  541  fgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGP  362
            FGFKGS+FHRVIKDFMIQGGDF  GNGTGGKSIYG  F DENFKL H GPG++SMANAGP
Sbjct  132  FGFKGSAFHRVIKDFMIQGGDFTAGNGTGGKSIYGNKFADENFKLTHTGPGILSMANAGP  191

Query  361  NTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            NTNGSQFFICTVKT WLD RHVVFGQVIEG+D+V  IE+Q TDR DRP K VVI+DCGE+
Sbjct  192  NTNGSQFFICTVKTQWLDGRHVVFGQVIEGLDIVSNIENQPTDRMDRPAKNVVIADCGEV  251



>ref|XP_008776537.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Phoenix dactylifera]
Length=264

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 143/182 (79%), Gaps = 16/182 (9%)
 Frame = -2

Query  718  RATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  539
            RA  + AE Q KVT++V+FDISIGNPVGK  GRIVIGLY D+VPQTAENFRALCTGEKGF
Sbjct  99   RAELKEAELQPKVTNKVFFDISIGNPVGKLVGRIVIGLYEDDVPQTAENFRALCTGEKGF  158

Query  538  gfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPN  359
            G++GS+FHR+IKDFMIQ                G   + E   L H GPGVVSMANAGPN
Sbjct  159  GYRGSTFHRIIKDFMIQ----------------GGDSRREILNLYHVGPGVVSMANAGPN  202

Query  358  TNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            TNGSQFFICTVKTPWLD RHVVFGQV+EGMDV  +IESQE DRGDRPK + VIS+CGELP
Sbjct  203  TNGSQFFICTVKTPWLDQRHVVFGQVLEGMDVASVIESQEADRGDRPKNKAVISECGELP  262

Query  178  IV  173
            +V
Sbjct  263  MV  264



>gb|ABC41015.1| chloroplast-localized cyclophilin, partial [Triticum aestivum]
Length=150

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  640  VGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgng  461
            VGK  GRIVIGLYGD+VPQT ENFRALCTGEKGFG+KGSSFHRVIKDFMIQGGDFDKGNG
Sbjct  1    VGKNVGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNG  60

Query  460  tggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQV  281
            TGGKSIYGRTFKDENF+LVH GPGV+SMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV
Sbjct  61   TGGKSIYGRTFKDENFQLVHTGPGVLSMANAGPNTNGSQFFICTVKTPWLDGRHVVFGQV  120

Query  280  IEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            +EGMD+V++IES ETDRGDRPKK+VVIS+C
Sbjct  121  LEGMDIVRMIESSETDRGDRPKKKVVISEC  150



>ref|XP_008390136.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Malus domestica]
Length=245

 Score =   238 bits (608),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = -2

Query  769  FSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEV  590
            FSS     K     + VRA+A+ A  QSKVT +VYFDISIGNPVGK AGRIVIGLYGD+V
Sbjct  61   FSSNPSSGKRTSLASSVRASAEEATLQSKVTHKVYFDISIGNPVGKLAGRIVIGLYGDDV  120

Query  589  PQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFK  410
            PQT ENFRALCTG+KGFGFKGS+FHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK
Sbjct  121  PQTVENFRALCTGDKGFGFKGSAFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFK  180

Query  409  LVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVK  257
            L H GPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQV+EG+D  K
Sbjct  181  LSHTGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVVEGLDSQK  231



>gb|ABC41017.1| chloroplast-localized cyclophilin, partial [Triticum aestivum]
Length=150

 Score =   233 bits (593),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  640  VGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgng  461
            VGK  GRIVIGLYGD+VPQT ENFRALC GEKGFG+KGSSFHRVIKDFMIQGGDFDKGNG
Sbjct  1    VGKNVGRIVIGLYGDDVPQTVENFRALCAGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNG  60

Query  460  tggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQV  281
            TGGKSIYGRTFKDENF+LVH GPGV+SMANAGPNTNGSQFFICT+KTPWLD RHVVFGQV
Sbjct  61   TGGKSIYGRTFKDENFQLVHTGPGVLSMANAGPNTNGSQFFICTMKTPWLDGRHVVFGQV  120

Query  280  IEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            +EGMD+V+ IES ETDRGDRPKK+VVIS+C
Sbjct  121  LEGMDIVRTIESSETDRGDRPKKKVVISEC  150



>gb|ABC41018.1| chloroplast-localized cyclophilin, partial [Triticum aestivum]
Length=150

 Score =   231 bits (589),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  640  VGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgng  461
            VGK  GRIVIGLYGD+VPQT ENFRALC GEKGFG+KGSSFHRVIK FMIQGGDFDKGNG
Sbjct  1    VGKNVGRIVIGLYGDDVPQTVENFRALCAGEKGFGYKGSSFHRVIKGFMIQGGDFDKGNG  60

Query  460  tggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQV  281
            TGGKSIYGRTFKDENF+LVH GPGV+SMANAGPNTNGSQFFICTVKTPWLD RHVVFGQV
Sbjct  61   TGGKSIYGRTFKDENFQLVHTGPGVLSMANAGPNTNGSQFFICTVKTPWLDGRHVVFGQV  120

Query  280  IEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            +EGMD+V+ IES ETDRGDRPKK+VVIS+C
Sbjct  121  LEGMDIVRTIESSETDRGDRPKKKVVISEC  150



>ref|XP_006290277.1| hypothetical protein CARUB_v10017856mg [Capsella rubella]
 gb|EOA23175.1| hypothetical protein CARUB_v10017856mg [Capsella rubella]
Length=262

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 136/204 (67%), Positives = 160/204 (78%), Gaps = 8/204 (4%)
 Frame = -2

Query  775  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  608
            ++FS      K  R  A V+A A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  61   KQFSGVCATTKHQRT-ACVKAMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMG  116

Query  607  LYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTF  428
            L+GD VP+T ENFR LCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  117  LFGDVVPKTVENFRVLCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  176

Query  427  KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE  248
            +DENF L H GPG++SMANAGPNTNGSQFFICTVKTPWLDN+HVVFGQVIEGM +V+ +E
Sbjct  177  EDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTPWLDNKHVVFGQVIEGMKLVRTLE  236

Query  247  SQETDRGDRPKKRVVISDCGELPI  176
            SQET   D PKK   I  CGELP+
Sbjct  237  SQETRAMDVPKKGCRIYACGELPM  260



>ref|XP_007163259.1| hypothetical protein PHAVU_001G219400g [Phaseolus vulgaris]
 gb|ESW35253.1| hypothetical protein PHAVU_001G219400g [Phaseolus vulgaris]
Length=259

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 156/187 (83%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +  V AT    E Q+KVT++ +FD+  G   G+A GRIV+GL+G++VP+TAENFRALC
Sbjct  74   RSMTCVNATDNALELQAKVTTKCFFDVEAG---GEALGRIVLGLFGEDVPKTAENFRALC  130

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG +FKDE+F L H GPG++SM
Sbjct  131  TGEKGYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGPSFKDESFSLKHTGPGILSM  190

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLDNRHVVFG VI+GMDVV+ +ESQET R D P+K   I 
Sbjct  191  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRTLESQETSRLDVPRKPCRIV  250

Query  196  DCGELPI  176
            +CGELPI
Sbjct  251  NCGELPI  257



>ref|XP_010523872.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic 
[Tarenaya hassleriana]
Length=256

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +A V+A A     Q+KVT +V+FD+ IG   G+ +GRIVIGL+GD VP+T ENFR LC
Sbjct  71   RRMACVKAMATEEALQAKVTKKVFFDVEIG---GEPSGRIVIGLFGDVVPKTVENFRVLC  127

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KG SFHR+IKDFMIQGGDF +GNGTGG SIYG +F+DENF L H GPGV+SM
Sbjct  128  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGNGTGGVSIYGSSFEDENFTLKHVGPGVLSM  187

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLDNRHVVFG V++GMD+VK +E+QET R D PKK   I 
Sbjct  188  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVVDGMDIVKNLEAQETGRMDAPKKTCRIY  247

Query  196  DCGELPI  176
             CGELP+
Sbjct  248  SCGELPV  254



>emb|CDX76611.1| BnaC08g31970D [Brassica napus]
Length=253

 Score =   232 bits (591),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 161/204 (79%), Gaps = 8/204 (4%)
 Frame = -2

Query  775  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  608
            + FS     +K+ R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AG+IV+G
Sbjct  52   KHFSGAYATIKNQRT-ACVKSMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGKIVMG  107

Query  607  LYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTF  428
            L+GD VP+T ENFR LCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  108  LFGDVVPKTVENFRVLCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  167

Query  427  KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE  248
            +DENF L H GPG++SMANAGPNTNGSQFFICTVKTPWLDN+HVVFGQVIEGM +V+ +E
Sbjct  168  EDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTPWLDNKHVVFGQVIEGMKLVRTLE  227

Query  247  SQETDRGDRPKKRVVISDCGELPI  176
            SQET   D PKK   I  CGELP+
Sbjct  228  SQETRAFDVPKKGCRIYACGELPL  251



>ref|XP_002876654.1| hypothetical protein ARALYDRAFT_486711 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52913.1| hypothetical protein ARALYDRAFT_486711 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 161/204 (79%), Gaps = 8/204 (4%)
 Frame = -2

Query  775  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  608
            ++FS      K  R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  41   KQFSGVHASTKHQRT-ACVKSMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMG  96

Query  607  LYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTF  428
            L+G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  97   LFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  156

Query  427  KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE  248
            +DENF L H GPG++SMANAGPNTNGSQFFICTVKTPWLDN+HVVFGQVIEGM +V+ +E
Sbjct  157  EDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTPWLDNKHVVFGQVIEGMKLVRTLE  216

Query  247  SQETDRGDRPKKRVVISDCGELPI  176
            SQET   D PKK   I  CGELP+
Sbjct  217  SQETRAFDVPKKGCRIYACGELPL  240



>ref|XP_002515157.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
 gb|EEF47141.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
Length=261

 Score =   231 bits (590),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 157/185 (85%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            +A ++A A   E Q+KVT++V+FD+ IG   G+ AGRIV+GL+GD VP+TAENFRALCTG
Sbjct  78   MACIKAMANDLEVQAKVTTKVFFDVDIG---GEPAGRIVMGLFGDVVPKTAENFRALCTG  134

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            +KG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SI+G +F+DE+F L H GPGV+SMAN
Sbjct  135  DKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGVSIFGSSFEDESFDLKHVGPGVLSMAN  194

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGPNTNGSQFFICTVKTPWLDNRHVVFGQVI+GMDVV+ +ES ET R D P+K   I +C
Sbjct  195  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIDGMDVVRKLESVETSRSDYPRKPCRIINC  254

Query  190  GELPI  176
            GELP+
Sbjct  255  GELPL  259



>ref|XP_010045506.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Eucalyptus grandis]
 gb|KCW88621.1| hypothetical protein EUGRSUZ_A00992 [Eucalyptus grandis]
Length=262

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 156/185 (84%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            +  ++A A     Q+KVT++ +FD+ IG   G+ AGRIVIGL+GD+VP+T ENFRALCTG
Sbjct  79   MVEIKAMATDLGLQAKVTNKCFFDVEIG---GEPAGRIVIGLFGDDVPKTVENFRALCTG  135

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+KG SFHR+IKDFMIQGGDF +GNGTGGKSIYG TF+DENF L H GPGV+SMAN
Sbjct  136  EKGFGYKGCSFHRIIKDFMIQGGDFTRGNGTGGKSIYGSTFEDENFALKHVGPGVLSMAN  195

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGP+TNGSQFFICTVKTPWLDNRHVVFGQV++GMDVV+ +ESQET R D P++   I +C
Sbjct  196  AGPSTNGSQFFICTVKTPWLDNRHVVFGQVVDGMDVVQKLESQETSRSDVPRQPCRIVNC  255

Query  190  GELPI  176
            GELP+
Sbjct  256  GELPL  260



>ref|NP_001190159.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
 gb|AEE80299.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
Length=259

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 158/202 (78%), Gaps = 5/202 (2%)
 Frame = -2

Query  775  QKFSSCSVQVKSGRP--LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLY  602
            ++FS      K  R   +  + A  +V EPQ+KVT++VYFD+ IG   G+ AGRIV+GL+
Sbjct  59   KQFSGVYATTKHQRTACVKSMAAEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMGLF  115

Query  601  GDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKD  422
            G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F+D
Sbjct  116  GEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFED  175

Query  421  ENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQ  242
            ENF L H GPG++SMANAGPNTNGSQFFICTVKT WLDN+HVVFGQVIEGM +V+ +ESQ
Sbjct  176  ENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLESQ  235

Query  241  ETDRGDRPKKRVVISDCGELPI  176
            ET   D PKK   I  CGELP+
Sbjct  236  ETRAFDVPKKGCRIYACGELPL  257



>ref|NP_001288530.1| uncharacterized protein LOC103634647 [Zea mays]
 gb|ACF84730.1| unknown [Zea mays]
Length=213

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 154/192 (80%), Gaps = 5/192 (3%)
 Frame = -2

Query  745  KSGRPLAPVRATAQ--VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAEN  572
            +  R    VRATA     E Q+KVTS+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +N
Sbjct  23   RDARGAVVVRATAAEGAVELQAKVTSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDN  79

Query  571  FRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGP  392
            FRALCTGEKG+G+KG SFHR+IKDFMIQGGDF + NGTGG+SIYG  F DENF L H GP
Sbjct  80   FRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFQQNNGTGGRSIYGECFDDENFTLKHVGP  139

Query  391  GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK  212
            GV+SMANAGPNTNGSQFFICTVKTPWLDNRHVVFG V+EGMDVVK +ESQET R D PK+
Sbjct  140  GVLSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVLEGMDVVKQLESQETSRSDTPKQ  199

Query  211  RVVISDCGELPI  176
               I +CGE+P+
Sbjct  200  PCRIVNCGEVPL  211



>gb|AAM63944.1| peptidylprolyl isomerase ROC4 [Arabidopsis thaliana]
Length=260

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 160/204 (78%), Gaps = 8/204 (4%)
 Frame = -2

Query  775  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  608
            ++FS      K  R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  59   KQFSGVYATTKHQRT-ACVKSMAAEEEEVTEPQAKVTNKVYFDVEIG---GEVAGRIVMG  114

Query  607  LYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTF  428
            L+G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  115  LFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  174

Query  427  KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE  248
            +DENF L H GPG++SMANAGPNTNGSQFFICTVKT WLDN+HVVFGQVIEGM +V+ +E
Sbjct  175  EDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLE  234

Query  247  SQETDRGDRPKKRVVISDCGELPI  176
            SQET   D PKK   I  CGELP+
Sbjct  235  SQETRAFDVPKKGCRIYACGELPL  258



>ref|XP_008655470.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Zea mays]
 gb|AFW79492.1| putative peptidyl-prolyl cis-trans isomerase family protein [Zea 
mays]
Length=242

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 152/184 (83%), Gaps = 5/184 (3%)
 Frame = -2

Query  721  VRATAQ--VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGE  548
            VRATA     E Q+KVTS+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +NFRALCTGE
Sbjct  60   VRATAAEGAVELQAKVTSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDNFRALCTGE  116

Query  547  kgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANA  368
            KG+G+KG SFHR+IKDFMIQGGDF + NGTGG+SIYG  F DENF L H GPGV+SMANA
Sbjct  117  KGYGYKGCSFHRIIKDFMIQGGDFQQNNGTGGRSIYGECFDDENFTLKHVGPGVLSMANA  176

Query  367  GPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCG  188
            GPNTNGSQFFICTVKTPWLDNRHVVFG V+EGMDVVK +ESQET R D PK+   I +CG
Sbjct  177  GPNTNGSQFFICTVKTPWLDNRHVVFGHVLEGMDVVKQLESQETSRSDTPKQPCRIVNCG  236

Query  187  ELPI  176
            E+P+
Sbjct  237  EVPL  240



>ref|XP_002990069.1| hypothetical protein SELMODRAFT_229509 [Selaginella moellendorffii]
 gb|EFJ08892.1| hypothetical protein SELMODRAFT_229509 [Selaginella moellendorffii]
Length=229

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 154/188 (82%), Gaps = 8/188 (4%)
 Frame = -2

Query  736  RPLAPVRATAQVAEP---QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFR  566
            RP A   A +   EP   Q+KVT + YFD+ IGN   +  GRIVIGLYGD+VP+T ENFR
Sbjct  47   RPFATQAAVS--VEPSTLQAKVTRKCYFDMKIGN---EPVGRIVIGLYGDDVPRTVENFR  101

Query  565  ALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGV  386
            ALC G+KG+G+KGS+FHRVIK+FMIQGGDFD+ +GTGG+SIYG  F+DENFKL H GPGV
Sbjct  102  ALCAGDKGYGYKGSAFHRVIKNFMIQGGDFDRCDGTGGRSIYGGKFEDENFKLTHTGPGV  161

Query  385  VSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRV  206
            +SMANAGPNTNGSQFF+CTVKT WLD +HVVFG V+EGMDVVK+IE+Q TDR DRPKK  
Sbjct  162  LSMANAGPNTNGSQFFLCTVKTDWLDKKHVVFGHVLEGMDVVKMIETQPTDRDDRPKKAC  221

Query  205  VISDCGEL  182
            VI DCGEL
Sbjct  222  VIVDCGEL  229



>ref|NP_191762.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
 sp|P34791.1|CP20C_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic; 
Short=PPIase CYP20-3; AltName: Full=Cyclophilin 
of 20 kDa 3; AltName: Full=Cyclosporin A-binding protein; AltName: 
Full=Rotamase CYP20-3; AltName: Full=Rotamase cyclophilin-4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA20048.1| cyclophilin [Arabidopsis thaliana]
 gb|AAB96831.1| cyclophilin [Arabidopsis thaliana]
 emb|CAB71910.1| peptidylprolyl isomerase ROC4 [Arabidopsis thaliana]
 gb|AAL24325.1| peptidylprolyl isomerase ROC4 [Arabidopsis thaliana]
 gb|AAM13283.1| peptidylprolyl isomerase ROC4 [Arabidopsis thaliana]
 gb|AEE80297.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
Length=260

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 160/204 (78%), Gaps = 8/204 (4%)
 Frame = -2

Query  775  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  608
            ++FS      K  R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  59   KQFSGVYATTKHQRT-ACVKSMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMG  114

Query  607  LYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTF  428
            L+G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  115  LFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  174

Query  427  KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE  248
            +DENF L H GPG++SMANAGPNTNGSQFFICTVKT WLDN+HVVFGQVIEGM +V+ +E
Sbjct  175  EDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLE  234

Query  247  SQETDRGDRPKKRVVISDCGELPI  176
            SQET   D PKK   I  CGELP+
Sbjct  235  SQETRAFDVPKKGCRIYACGELPL  258



>ref|XP_002986930.1| hypothetical protein SELMODRAFT_229229 [Selaginella moellendorffii]
 gb|EFJ12012.1| hypothetical protein SELMODRAFT_229229 [Selaginella moellendorffii]
Length=229

 Score =   228 bits (581),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 147/170 (86%), Gaps = 3/170 (2%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            Q+KVT + YFD+ IGN   +  GRIVIGLYGD+VP+T ENFRALC G+KG+G+KGS+FHR
Sbjct  63   QAKVTRKCYFDMKIGN---EPVGRIVIGLYGDDVPRTVENFRALCAGDKGYGYKGSAFHR  119

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            VIK+FMIQGGDFD+ +GTGG+SIYG  F+DENFKL H GPGV+SMANAGPNTNGSQFF+C
Sbjct  120  VIKNFMIQGGDFDRCDGTGGRSIYGGKFEDENFKLTHTGPGVLSMANAGPNTNGSQFFLC  179

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            TVKT WLD +HVVFG V+EGMDVVK+IE+Q TDR DRPKK  VI DCGEL
Sbjct  180  TVKTDWLDKKHVVFGHVLEGMDVVKMIETQPTDRDDRPKKACVIVDCGEL  229



>ref|NP_001240987.1| uncharacterized protein LOC100785805 [Glycine max]
 gb|ACU23099.1| unknown [Glycine max]
Length=260

 Score =   229 bits (584),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 154/187 (82%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +  V A   V E Q+KVT++ +FD+ +G   G+  GRIV+GL+G+ VP+T ENFRALC
Sbjct  75   RRMTCVNAADNVVELQAKVTTKCFFDVEVG---GEPVGRIVLGLFGEVVPKTVENFRALC  131

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG +FKDE+F L H GPGV+SM
Sbjct  132  TGEKGYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGPSFKDESFALKHVGPGVLSM  191

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLDNRHVVFG +I+GMDVVK +ESQET R D P+K   I 
Sbjct  192  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGHIIDGMDVVKTLESQETSRLDVPRKPCRIV  251

Query  196  DCGELPI  176
            +CGELPI
Sbjct  252  NCGELPI  258



>ref|NP_001150495.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
 gb|ACG39280.1| peptidyl-prolyl cis-trans isomerase [Zea mays]
Length=242

 Score =   228 bits (581),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 154/192 (80%), Gaps = 5/192 (3%)
 Frame = -2

Query  745  KSGRPLAPVRATAQ--VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAEN  572
            +  R    VRATA     E Q+KVTS+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +N
Sbjct  52   RDARGAVVVRATAAEGAVELQAKVTSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTIDN  108

Query  571  FRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGP  392
            FRALCTGEKG+G+KG SFHR+IKDFMIQGGDF + NGTGG+SIYG  F DENF L H GP
Sbjct  109  FRALCTGEKGYGYKGCSFHRIIKDFMIQGGDFQQNNGTGGRSIYGECFDDENFTLKHVGP  168

Query  391  GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK  212
            GV+SMANAGPNTNGSQFFICTVKTPWLDNRHVVFG V+EGMDVVK +ESQET R D PK+
Sbjct  169  GVLSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVLEGMDVVKQLESQETSRSDTPKQ  228

Query  211  RVVISDCGELPI  176
               I +CGE+P+
Sbjct  229  PCRIVNCGEVPL  240



>ref|XP_004494484.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like 
isoform X3 [Cicer arietinum]
Length=226

 Score =   228 bits (580),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 155/187 (83%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R L    A   V E Q+KVT++ +FD+ +G   G++ GRIV+GL+G++VP+T ENFRALC
Sbjct  41   RKLTCKAAAENVQELQAKVTTKCFFDVEVG---GESVGRIVLGLFGEDVPKTVENFRALC  97

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KGSSFHR+IK+FMIQGGDF +GNGTGG SIYG +F+DE+F L H GPGV+SM
Sbjct  98   TGEKGYGYKGSSFHRIIKEFMIQGGDFTEGNGTGGVSIYGSSFEDESFDLKHVGPGVLSM  157

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICT+KTPWLDNRHVVFG VI+GMDVV+ +ESQET R D P+K   I 
Sbjct  158  ANAGPNTNGSQFFICTIKTPWLDNRHVVFGHVIDGMDVVRTLESQETSRLDIPRKPCRIV  217

Query  196  DCGELPI  176
            +CGELPI
Sbjct  218  NCGELPI  224



>ref|XP_004494482.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like 
isoform X1 [Cicer arietinum]
 ref|XP_004494483.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=259

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 155/187 (83%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R L    A   V E Q+KVT++ +FD+ +G   G++ GRIV+GL+G++VP+T ENFRALC
Sbjct  74   RKLTCKAAAENVQELQAKVTTKCFFDVEVG---GESVGRIVLGLFGEDVPKTVENFRALC  130

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KGSSFHR+IK+FMIQGGDF +GNGTGG SIYG +F+DE+F L H GPGV+SM
Sbjct  131  TGEKGYGYKGSSFHRIIKEFMIQGGDFTEGNGTGGVSIYGSSFEDESFDLKHVGPGVLSM  190

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICT+KTPWLDNRHVVFG VI+GMDVV+ +ESQET R D P+K   I 
Sbjct  191  ANAGPNTNGSQFFICTIKTPWLDNRHVVFGHVIDGMDVVRTLESQETSRLDIPRKPCRIV  250

Query  196  DCGELPI  176
            +CGELPI
Sbjct  251  NCGELPI  257



>ref|XP_010413313.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic 
[Camelina sativa]
Length=264

 Score =   229 bits (583),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 147/176 (84%), Gaps = 3/176 (2%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V EPQ+KVT++VYFD+ IG   G+ AGRIV+GL+GD VP+T ENFR LCTGEK +G+KGS
Sbjct  90   VIEPQAKVTNKVYFDVEIG---GEVAGRIVMGLFGDVVPKTVENFRVLCTGEKKYGYKGS  146

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            SFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPG++SMANAGPNTNGSQ
Sbjct  147  SFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQ  206

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICTVKTPWLDN+HVVFGQVIEGM +V+ +ESQ T   D PKK   I  CGELPI
Sbjct  207  FFICTVKTPWLDNKHVVFGQVIEGMKLVRTLESQPTRAMDVPKKGCRIYACGELPI  262



>gb|AFK38232.1| unknown [Lotus japonicus]
Length=262

 Score =   228 bits (582),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 150/181 (83%), Gaps = 4/181 (2%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            A     E Q+KVTS+V+FD++IG   G+AAGRIV GL+GD VP+TAENFRALCTGEKG+G
Sbjct  83   AKESALELQAKVTSKVFFDVTIG---GEAAGRIVFGLFGDVVPKTAENFRALCTGEKGYG  139

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            FK   FHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPGV+SMANAGPNT
Sbjct  140  FKDCYFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFSLKHVGPGVLSMANAGPNT  199

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDR-PKKRVVISDCGELP  179
            NGSQFFICTV+TPWLDNRHVVFG VI+GMDVV+ +ESQET R D  P+K   I++ GELP
Sbjct  200  NGSQFFICTVQTPWLDNRHVVFGHVIDGMDVVRTLESQETSRSDNSPRKPCKIANSGELP  259

Query  178  I  176
            +
Sbjct  260  L  260



>emb|CAN69876.1| hypothetical protein VITISV_015631 [Vitis vinifera]
Length=253

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R L  V + A   E Q+KVT++ +FD+ IG   G+  GRIVIGL+G+ VP+TAENFR LC
Sbjct  68   RRLMCVNSMANEVELQAKVTTKCFFDVDIG---GEPVGRIVIGLFGEVVPKTAENFRVLC  124

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DENF L H GPGV+SM
Sbjct  125  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDENFALTHVGPGVLSM  184

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLD RHVVFG VI+GMDVV+ +ESQET R D PK    I 
Sbjct  185  ANAGPNTNGSQFFICTVKTPWLDRRHVVFGHVIDGMDVVRKLESQETSRSDYPKLTCRII  244

Query  196  DCGELPI  176
            +CGELP+
Sbjct  245  NCGELPM  251



>ref|XP_002273421.2| PREDICTED: peptidyl-prolyl cis-trans isomerase [Vitis vinifera]
 emb|CBI37036.3| unnamed protein product [Vitis vinifera]
Length=253

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R L  V + A   E Q+KVT++ +FD+ IG   G+  GRIVIGL+G+ VP+TAENFR LC
Sbjct  68   RRLMCVNSMANEVELQAKVTTKCFFDVDIG---GEPVGRIVIGLFGEVVPKTAENFRVLC  124

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DENF L H GPGV+SM
Sbjct  125  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDENFALTHVGPGVLSM  184

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLD RHVVFG VI+GMDVV+ +ESQET R D PK    I 
Sbjct  185  ANAGPNTNGSQFFICTVKTPWLDRRHVVFGHVIDGMDVVRKLESQETSRSDYPKLTCRII  244

Query  196  DCGELPI  176
            +CGELP+
Sbjct  245  NCGELPM  251



>gb|AAG40378.1|AF325026_1 AT3g62030 [Arabidopsis thaliana]
Length=260

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 160/204 (78%), Gaps = 8/204 (4%)
 Frame = -2

Query  775  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  608
            ++FS      K  R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  59   KQFSGVYATTKHQRT-ACVKSMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMG  114

Query  607  LYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTF  428
            L+G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  115  LFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  174

Query  427  KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE  248
            +DENF L H GPG++SMANAGPNTNGS+FFICTVKT WLDN+HVVFGQVIEGM +V+ +E
Sbjct  175  EDENFTLKHTGPGILSMANAGPNTNGSKFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLE  234

Query  247  SQETDRGDRPKKRVVISDCGELPI  176
            SQET   D PKK   I  CGELP+
Sbjct  235  SQETRAFDVPKKGCRIYACGELPL  258



>ref|XP_010468991.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 147/176 (84%), Gaps = 3/176 (2%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V EPQ+KVT++VYFD+ IG   G+ AGRIV+GL+GD VP+T ENFR LCTGEK +G+KGS
Sbjct  91   VIEPQAKVTNKVYFDVEIG---GEVAGRIVMGLFGDVVPKTVENFRVLCTGEKKYGYKGS  147

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            SFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPG++SMANAGPNTNGSQ
Sbjct  148  SFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQ  207

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICTVKTPWLDN+HVVFGQVIEGM +V+ +ESQ T   D PKK   I  CGELP+
Sbjct  208  FFICTVKTPWLDNKHVVFGQVIEGMKLVRTLESQPTRAMDVPKKGCRIYACGELPM  263



>emb|CDY58761.1| BnaA04g27460D [Brassica napus]
Length=258

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 147/176 (84%), Gaps = 3/176 (2%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            +A PQ+KVT +VYFD+ IG   G+ AGRIV+GL+GD VP+T ENFRALCTGEK +G+KGS
Sbjct  84   LAPPQAKVTHKVYFDVEIG---GEVAGRIVMGLFGDVVPRTVENFRALCTGEKKYGYKGS  140

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            SFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPG++SMANAGPNTNGSQ
Sbjct  141  SFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQ  200

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICT+KT WLDN+HVVFGQVIEGM +V+ +ESQET   D PKK   I  CGELP+
Sbjct  201  FFICTIKTSWLDNKHVVFGQVIEGMKLVRKLESQETRAMDVPKKACRIYACGELPV  256



>emb|CDX93994.1| BnaC04g21530D [Brassica napus]
Length=261

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 147/176 (84%), Gaps = 3/176 (2%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            +A PQ+KVT +VYFD+ IG   G+ AGRIV+GL+GD VP+T ENFRALCTGEK +G+KGS
Sbjct  87   LAPPQAKVTHKVYFDVEIG---GEVAGRIVMGLFGDVVPKTVENFRALCTGEKKYGYKGS  143

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            SFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPG++SMANAGPNTNGSQ
Sbjct  144  SFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQ  203

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICT+KT WLDN+HVVFGQVIEGM +V+ +ESQET   D PKK   I  CGELP+
Sbjct  204  FFICTIKTSWLDNKHVVFGQVIEGMKLVRRLESQETRAMDVPKKACRIYACGELPM  259



>ref|NP_001154684.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
 gb|AEE80298.1| peptidyl-prolyl cis-trans isomerase CYP20-3 [Arabidopsis thaliana]
Length=313

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 160/204 (78%), Gaps = 8/204 (4%)
 Frame = -2

Query  775  QKFSSCSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIG  608
            ++FS      K  R  A V++ A    +V EPQ+KVT++VYFD+ IG   G+ AGRIV+G
Sbjct  112  KQFSGVYATTKHQRT-ACVKSMAAEEEEVIEPQAKVTNKVYFDVEIG---GEVAGRIVMG  167

Query  607  LYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTF  428
            L+G+ VP+T ENFRALCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  F
Sbjct  168  LFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKF  227

Query  427  KDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIE  248
            +DENF L H GPG++SMANAGPNTNGSQFFICTVKT WLDN+HVVFGQVIEGM +V+ +E
Sbjct  228  EDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTSWLDNKHVVFGQVIEGMKLVRTLE  287

Query  247  SQETDRGDRPKKRVVISDCGELPI  176
            SQET   D PKK   I  CGELP+
Sbjct  288  SQETRAFDVPKKGCRIYACGELPL  311



>ref|XP_002455482.1| hypothetical protein SORBIDRAFT_03g011610 [Sorghum bicolor]
 gb|EES00602.1| hypothetical protein SORBIDRAFT_03g011610 [Sorghum bicolor]
Length=242

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            Q+KVT++ +FD+ +G   G+ AGRIVIGL+G+ VP+T +NFRALCTGEKG+G+KG SFHR
Sbjct  72   QAKVTTKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDNFRALCTGEKGYGYKGCSFHR  128

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            +IKDFMIQGGDF + NGTGG+SIYG +F DENF L H GPGV+SMANAGPNTNGSQFFIC
Sbjct  129  IIKDFMIQGGDFQENNGTGGRSIYGESFDDENFTLKHVGPGVLSMANAGPNTNGSQFFIC  188

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            TVKTPWLDNRHVVFG V+EGMDVVK +ESQET R D PK+   I +CGELP+
Sbjct  189  TVKTPWLDNRHVVFGHVLEGMDVVKQLESQETSRSDTPKQPCRIVNCGELPL  240



>ref|XP_008466218.1| PREDICTED: peptidyl-prolyl cis-trans isomerase A1 [Cucumis melo]
Length=252

 Score =   226 bits (575),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R L  V +  +  E Q++V+++ +FD+ IG   G+  GRIVIGL+GD VP+T ENFRALC
Sbjct  66   RTLICVNSATKDVELQAEVSTKCFFDVEIG---GEPVGRIVIGLFGDVVPRTVENFRALC  122

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KG SFHRVIKDFMIQGGDF  G+GTGG SIYG +F+DENF L HAGPGV+SM
Sbjct  123  TGEKGYGYKGCSFHRVIKDFMIQGGDFTNGDGTGGVSIYGPSFRDENFSLKHAGPGVLSM  182

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLDNRHVVFG VIEGMDVVK IESQET R D P+    I 
Sbjct  183  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIEGMDVVKQIESQETSRLDIPRLPCRIV  242

Query  196  DCGELPI  176
            +CGEL +
Sbjct  243  NCGELQV  249



>ref|XP_010512589.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
[Camelina sativa]
Length=263

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 160/205 (78%), Gaps = 9/205 (4%)
 Frame = -2

Query  775  QKFSS-CSVQVKSGRPLAPVRATA----QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVI  611
            ++FS  C+   K  R  A V++ A    +V EP +KVT++VYFD+ IG   G+ AGRIV+
Sbjct  61   KQFSGVCATTTKHQRT-ACVKSMAAEEEEVIEPIAKVTNKVYFDVEIG---GEVAGRIVM  116

Query  610  GLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRT  431
            GL+GD VP+T ENFR LCTGEK +G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG  
Sbjct  117  GLFGDVVPKTVENFRVLCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAK  176

Query  430  FKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLI  251
            F+DENF L H GPG++SMANAGPNTNGSQFFICTVKTPWLDN+HVVFGQVIEGM +V+ +
Sbjct  177  FEDENFTLKHTGPGILSMANAGPNTNGSQFFICTVKTPWLDNKHVVFGQVIEGMKLVRTL  236

Query  250  ESQETDRGDRPKKRVVISDCGELPI  176
            ESQ T   D PKK   I  CGELP+
Sbjct  237  ESQPTRAMDVPKKGCRIYACGELPM  261



>gb|KJB24499.1| hypothetical protein B456_004G147800 [Gossypium raimondii]
Length=255

 Score =   226 bits (575),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 147/180 (82%), Gaps = 3/180 (2%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            + A   E Q+KVT++ +FD+ IG   GKA GRIV+GL+GD VP+T ENFRALCTGE G+G
Sbjct  77   SMANDVELQAKVTTKCFFDVEIG---GKAVGRIVMGLFGDVVPRTVENFRALCTGENGYG  133

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            FKG SFHR+IKDFMIQGGDF  GNGTGG SIYG  F+DE+F L H GPGV+SMANAGPNT
Sbjct  134  FKGCSFHRIIKDFMIQGGDFTNGNGTGGMSIYGSKFEDESFALKHVGPGVLSMANAGPNT  193

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            NGSQFFICTVKTPWLDNRHVVFG VI+GMDVV+ +ESQET R D P+    I +CGELPI
Sbjct  194  NGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRELESQETSRTDGPRVPCRIVNCGELPI  253



>ref|XP_006402419.1| hypothetical protein EUTSA_v10006185mg [Eutrema salsugineum]
 gb|ESQ43872.1| hypothetical protein EUTSA_v10006185mg [Eutrema salsugineum]
Length=259

 Score =   226 bits (575),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 146/173 (84%), Gaps = 3/173 (2%)
 Frame = -2

Query  694  PQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFH  515
            PQ+KVT++VYFD+ IG   G+ AGRIV+GL+G+ VP+T ENFR LCTGEK +G+KGSSFH
Sbjct  88   PQAKVTNKVYFDVEIG---GEVAGRIVMGLFGEVVPKTVENFRVLCTGEKKYGYKGSSFH  144

Query  514  RVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI  335
            R+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPG++SMANAGPNTNGSQFFI
Sbjct  145  RIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFFI  204

Query  334  CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            CT+KTPWLDN+HVVFGQVIEGM +V+ +ESQET   D PKK   I  CGELP+
Sbjct  205  CTIKTPWLDNKHVVFGQVIEGMKLVRRLESQETRAMDVPKKGCRIYACGELPM  257



>ref|XP_003567459.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Brachypodium 
distachyon]
Length=239

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 160/201 (80%), Gaps = 7/201 (3%)
 Frame = -2

Query  766  SSCSVQVKSGR-PLAPVRATAQV---AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYG  599
            S+C++++ + R P   VRA A      E Q+KVT++ +FD+ IG   G+  G++VIGL+G
Sbjct  40   STCALRLAARRAPALVVRAAASSEGDVELQAKVTNKCFFDVEIG---GELVGKVVIGLFG  96

Query  598  DEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDE  419
            + VP+T +NFRALCTG+KG+G+KGSSFHR+IKDFMIQGGDF   NGTGG+SIYG  F DE
Sbjct  97   EVVPKTVDNFRALCTGDKGYGYKGSSFHRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDE  156

Query  418  NFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQE  239
            NF L H GPGV+SMANAGP+TNGSQFF+CTVKTPWLDNRHVVFG V+EGMDVVK +ESQE
Sbjct  157  NFTLKHVGPGVLSMANAGPDTNGSQFFVCTVKTPWLDNRHVVFGHVLEGMDVVKELESQE  216

Query  238  TDRGDRPKKRVVISDCGELPI  176
            T R D PK+   I +CGELP+
Sbjct  217  TSRADTPKQPCRIVNCGELPL  237



>ref|XP_006444641.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 ref|XP_006444644.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 ref|XP_006492443.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR57881.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|ESR57884.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|KDO86744.1| hypothetical protein CISIN_1g024387mg [Citrus sinensis]
 gb|KDO86745.1| hypothetical protein CISIN_1g024387mg [Citrus sinensis]
Length=237

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +  V + A+  E Q+KVT++V+FD+ IG   GK AGRIV+GL+GD VP+TAENFRALC
Sbjct  52   RRMFCVNSMAKDVELQAKVTTKVFFDVDIG---GKPAGRIVMGLFGDVVPKTAENFRALC  108

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DE+F L H GPGV+SM
Sbjct  109  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSM  168

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLDNRHVVFG VI+GMDVV+ +ES ET R D PK    I 
Sbjct  169  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRKLESVETSRTDYPKVPCRII  228

Query  196  DCGELPI  176
            + GELP+
Sbjct  229  NSGELPL  235



>gb|KDO86743.1| hypothetical protein CISIN_1g024387mg [Citrus sinensis]
Length=255

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +  V + A+  E Q+KVT++V+FD+ IG   GK AGRIV+GL+GD VP+TAENFRALC
Sbjct  70   RRMFCVNSMAKDVELQAKVTTKVFFDVDIG---GKPAGRIVMGLFGDVVPKTAENFRALC  126

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DE+F L H GPGV+SM
Sbjct  127  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSM  186

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLDNRHVVFG VI+GMDVV+ +ES ET R D PK    I 
Sbjct  187  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRKLESVETSRTDYPKVPCRII  246

Query  196  DCGELPI  176
            + GELP+
Sbjct  247  NSGELPL  253



>ref|XP_006444642.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 ref|XP_006492442.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR57882.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|KDO86741.1| hypothetical protein CISIN_1g024387mg [Citrus sinensis]
Length=267

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +  V + A+  E Q+KVT++V+FD+ IG   GK AGRIV+GL+GD VP+TAENFRALC
Sbjct  82   RRMFCVNSMAKDVELQAKVTTKVFFDVDIG---GKPAGRIVMGLFGDVVPKTAENFRALC  138

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DE+F L H GPGV+SM
Sbjct  139  TGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLSM  198

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLDNRHVVFG VI+GMDVV+ +ES ET R D PK    I 
Sbjct  199  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRKLESVETSRTDYPKVPCRII  258

Query  196  DCGELPI  176
            + GELP+
Sbjct  259  NSGELPL  265



>ref|XP_009116878.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic 
[Brassica rapa]
Length=257

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = -2

Query  706  QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg  527
            +V EPQ+KVT++VYFD+ IG   G+ AGRI +GL+GD VP+T ENFR LCTGEK +G+KG
Sbjct  82   EVIEPQAKVTNKVYFDVEIG---GEVAGRIEMGLFGDVVPKTVENFRVLCTGEKKYGYKG  138

Query  526  ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGS  347
            SSFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPG++SMANAGPNTNGS
Sbjct  139  SSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGS  198

Query  346  QFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            QFFICTVKTPWLD +HVVFGQVI+GM +V+ +ESQET   D PKK   I  CGELP+
Sbjct  199  QFFICTVKTPWLDGKHVVFGQVIKGMKLVRTLESQETRAFDVPKKGCRIYACGELPL  255



>ref|XP_003626095.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=256

 Score =   223 bits (569),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = -2

Query  775  QKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGD  596
            Q+F + S+     R +    A   V E Q+KVT++ +FD+  G   G++ GRIV+GL+G+
Sbjct  60   QQFGARSISYS--RRITCAAAAENVQELQAKVTTKCFFDVEAG---GESLGRIVLGLFGE  114

Query  595  EVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDEN  416
              P+T ENFRALCTG+KG+G+KG SFHR+IK+FMIQGGDF +GNGTGG SIYG +F+DE+
Sbjct  115  VAPKTVENFRALCTGDKGYGYKGCSFHRIIKEFMIQGGDFTEGNGTGGVSIYGSSFEDES  174

Query  415  FKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQET  236
            F L H GPGV+SMANAGPNTNGSQFFICTVKTPWLDNRHVVFG VI+GMDVV+ +ESQET
Sbjct  175  FALKHVGPGVLSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRTLESQET  234

Query  235  DRGDRPKKRVVISDCGELPI  176
             R D PKK   I +CGELPI
Sbjct  235  SRLDIPKKPCRIVNCGELPI  254



>emb|CDY11395.1| BnaA09g39610D [Brassica napus]
Length=258

 Score =   223 bits (569),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = -2

Query  706  QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg  527
            +V EPQ+KVT++V+FD+ IG   G+ AGRI +GL+GD VP+T ENFR LCTGEK +G+KG
Sbjct  83   EVIEPQAKVTNKVFFDVEIG---GEVAGRIEMGLFGDVVPKTVENFRVLCTGEKKYGYKG  139

Query  526  ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGS  347
            SSFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPG++SMANAGPNTNGS
Sbjct  140  SSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGS  199

Query  346  QFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            QFFICTVKTPWLD +HVVFGQVI+GM +V+ +ESQET   D PKK   I  CGELP+
Sbjct  200  QFFICTVKTPWLDGKHVVFGQVIKGMKLVRTLESQETRAFDVPKKGCRIYACGELPL  256



>gb|AFK43472.1| unknown [Medicago truncatula]
 gb|AES82313.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=261

 Score =   223 bits (569),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 157/200 (79%), Gaps = 5/200 (3%)
 Frame = -2

Query  775  QKFSSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGD  596
            Q+F + S+     R +    A   V E Q+KVT++ +FD+  G   G++ GRIV+GL+G+
Sbjct  65   QQFGARSISYS--RRITCAAAAENVQELQAKVTTKCFFDVEAG---GESLGRIVLGLFGE  119

Query  595  EVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDEN  416
              P+T ENFRALCTG+KG+G+KG SFHR+IK+FMIQGGDF +GNGTGG SIYG +F+DE+
Sbjct  120  VAPKTVENFRALCTGDKGYGYKGCSFHRIIKEFMIQGGDFTEGNGTGGVSIYGSSFEDES  179

Query  415  FKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQET  236
            F L H GPGV+SMANAGPNTNGSQFFICTVKTPWLDNRHVVFG VI+GMDVV+ +ESQET
Sbjct  180  FALKHVGPGVLSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRTLESQET  239

Query  235  DRGDRPKKRVVISDCGELPI  176
             R D PKK   I +CGELPI
Sbjct  240  SRLDIPKKPCRIVNCGELPI  259



>gb|EEC70431.1| hypothetical protein OsI_01440 [Oryza sativa Indica Group]
Length=238

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 149/184 (81%), Gaps = 5/184 (3%)
 Frame = -2

Query  721  VRATAQ--VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGE  548
            VRA A     E Q+KVTS+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +NFRALCTG+
Sbjct  56   VRAAAAEGAVELQAKVTSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDNFRALCTGD  112

Query  547  kgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANA  368
            KG+G+KG SFHR+IKDFMIQGGDF   NGTGG+SIYG  F DENF L H GPGV+SMANA
Sbjct  113  KGYGYKGCSFHRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDENFTLKHTGPGVLSMANA  172

Query  367  GPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCG  188
            GP+TNGSQFFIC VKTPWLDNRHVVFG V+EGMDVVK +ESQET R D PK+   I +CG
Sbjct  173  GPDTNGSQFFICNVKTPWLDNRHVVFGHVLEGMDVVKNLESQETSRSDIPKQPCRIVNCG  232

Query  187  ELPI  176
            ELP+
Sbjct  233  ELPV  236



>gb|KGN49788.1| Peptidyl-prolyl cis-trans isomerase [Cucumis sativus]
Length=252

 Score =   223 bits (568),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 154/191 (81%), Gaps = 4/191 (2%)
 Frame = -2

Query  748  VKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  569
            VK+ R +    AT  V E Q++V+++ +FD+ IG   G++AGRIVIGL+GD VP+T ENF
Sbjct  63   VKNRRLICANSATKNV-ELQAEVSTKCFFDVEIG---GESAGRIVIGLFGDVVPRTVENF  118

Query  568  RALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPG  389
            RALCTGEKG+G+KG SFHRVIKDFMIQGGDF  G+GTGG SIYG +F+DENF L H GPG
Sbjct  119  RALCTGEKGYGYKGCSFHRVIKDFMIQGGDFTNGDGTGGISIYGPSFRDENFSLKHVGPG  178

Query  388  VVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKR  209
            V+SMANAGP+TNGSQFFICTVKTPWLDNRHVVFG VIEGMDVVK IESQET   D P+  
Sbjct  179  VLSMANAGPDTNGSQFFICTVKTPWLDNRHVVFGHVIEGMDVVKRIESQETSNLDIPRMP  238

Query  208  VVISDCGELPI  176
              I +CGEL +
Sbjct  239  CRIVNCGELEV  249



>ref|XP_009767431.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like 
[Nicotiana sylvestris]
Length=235

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 150/195 (77%), Gaps = 15/195 (8%)
 Frame = -2

Query  757  SVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVP-QT  581
            SV  K+G     ++A  Q AE QSKVT  +                + +G+  + +P  +
Sbjct  54   SVLRKTGALSGSIQAAVQAAEVQSKVTQFILI--------------LALGIMLESLPVYS  99

Query  580  AENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVH  401
             + F ALCTGEKGFG+K S+FHRVIKDFMIQG DFDKGNGTGGKSIYGRTFKDENFKL H
Sbjct  100  NKKFCALCTGEKGFGYKDSAFHRVIKDFMIQGSDFDKGNGTGGKSIYGRTFKDENFKLTH  159

Query  400  AGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDR  221
             GPGVVSMANAGPNTNGSQFFIC VKTPWLD RHVVFGQV+E MD+VKLIESQETDRGDR
Sbjct  160  TGPGVVSMANAGPNTNGSQFFICAVKTPWLDERHVVFGQVLESMDIVKLIESQETDRGDR  219

Query  220  PKKRVVISDCGELPI  176
            P+KRVVISDCGELP+
Sbjct  220  PRKRVVISDCGELPV  234



>gb|EEE54351.1| hypothetical protein OsJ_01342 [Oryza sativa Japonica Group]
Length=232

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 151/190 (79%), Gaps = 6/190 (3%)
 Frame = -2

Query  736  RPLAPVRATAQ---VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFR  566
            +P AP    A+     E Q+KV S+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +NFR
Sbjct  44   KPRAPGAKGAETRGAVELQAKVNSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDNFR  100

Query  565  ALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGV  386
            ALCTG+KG+G+KG SFHR+IKDFMIQGGDF   NGTGG+SIYG  F DENF L H GPGV
Sbjct  101  ALCTGDKGYGYKGCSFHRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDENFTLKHTGPGV  160

Query  385  VSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRV  206
            +SMANAGP+TNGSQFFICTVKTPWLDNRHVVFG V+EGMDVVK +ESQET R D PK+  
Sbjct  161  LSMANAGPDTNGSQFFICTVKTPWLDNRHVVFGHVLEGMDVVKNLESQETSRSDIPKQPC  220

Query  205  VISDCGELPI  176
             I +CGELP+
Sbjct  221  RIVNCGELPV  230



>dbj|BAB39968.1| putative peptidyl-prolyl cis-trans isomerase, chloroplast precursor 
[Oryza sativa Japonica Group]
 dbj|BAB39983.1| putative peptidyl-prolyl cis-trans isomerase, chloroplast precursor 
[Oryza sativa Japonica Group]
 dbj|BAB64228.1| putative peptidyl-prolyl cis-trans isomerase, chloroplast precursor 
[Oryza sativa Japonica Group]
Length=231

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 145/174 (83%), Gaps = 3/174 (2%)
 Frame = -2

Query  697  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssF  518
            E Q+KV S+ +FD+ +G   G+ AGRIVIGL+G+ VP+T +NFRALCTG+KG+G+KG SF
Sbjct  59   ELQAKVNSKCFFDVEVG---GEPAGRIVIGLFGEVVPKTVDNFRALCTGDKGYGYKGCSF  115

Query  517  HRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF  338
            HR+IKDFMIQGGDF   NGTGG+SIYG  F DENF L H GPGV+SMANAGP+TNGSQFF
Sbjct  116  HRIIKDFMIQGGDFQNNNGTGGRSIYGECFDDENFTLKHTGPGVLSMANAGPDTNGSQFF  175

Query  337  ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            ICTVKTPWLDNRHVVFG V+EGMDVVK +ESQET R D PK+   I +CGELP+
Sbjct  176  ICTVKTPWLDNRHVVFGHVLEGMDVVKNLESQETSRSDIPKQPCRIVNCGELPV  229



>ref|XP_010240836.1| PREDICTED: peptidyl-prolyl cis-trans isomerase isoform X2 [Nelumbo 
nucifera]
Length=234

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 148/180 (82%), Gaps = 3/180 (2%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            + A+  E Q+KVT++ +FD+ IG   G+  GRIV+GL+G+ VP+T ENFRALCTGEKG+G
Sbjct  56   SAAKGLELQAKVTTKCFFDVEIG---GEPVGRIVMGLFGEVVPKTVENFRALCTGEKGYG  112

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            +KG SFHR+IKDFMIQGGDF  GNGTGG SIYG  F+DENF L+H GPGV+SMANAGP+T
Sbjct  113  YKGCSFHRIIKDFMIQGGDFTAGNGTGGMSIYGSNFEDENFTLIHIGPGVLSMANAGPDT  172

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            NGSQFFICTVKTPWLD RHVVFG V+EGM+VV+ +ESQET R D P+    I +CGELP+
Sbjct  173  NGSQFFICTVKTPWLDKRHVVFGHVVEGMEVVRKLESQETSRSDAPRLPCRIVNCGELPV  232



>ref|XP_004164092.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like 
[Cucumis sativus]
Length=252

 Score =   220 bits (561),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 153/191 (80%), Gaps = 4/191 (2%)
 Frame = -2

Query  748  VKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  569
            VK+ R +    AT  V E Q++V+++ +FD+ IG   G++AGRIVIGL+GD VP+T ENF
Sbjct  63   VKNRRLICANSATKNV-ELQAEVSTKCFFDVEIG---GESAGRIVIGLFGDVVPRTVENF  118

Query  568  RALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPG  389
            RALCTGEKG+G+KG SFHRVIKDFMIQGGDF  G+GTGG SIYG +F+DE F L H GPG
Sbjct  119  RALCTGEKGYGYKGCSFHRVIKDFMIQGGDFTNGDGTGGISIYGPSFRDEKFSLKHVGPG  178

Query  388  VVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKR  209
            V+SMANAGP+TNGSQFFICTVKTPWLDNRHVVFG VIEGMDVVK IESQET   D P+  
Sbjct  179  VLSMANAGPDTNGSQFFICTVKTPWLDNRHVVFGHVIEGMDVVKRIESQETSNLDIPRMP  238

Query  208  VVISDCGELPI  176
              I +CGEL +
Sbjct  239  CRIVNCGELEV  249



>ref|XP_004149480.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP20-3, chloroplastic-like [Cucumis sativus]
Length=253

 Score =   220 bits (561),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 152/191 (80%), Gaps = 3/191 (2%)
 Frame = -2

Query  748  VKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENF  569
            VK+ R +     +    E Q++V+++ +FD+ IG   G++AGRIVIGL+GD VP+T ENF
Sbjct  63   VKNRRLICAKXMSYCNVELQAEVSTKCFFDVEIG---GESAGRIVIGLFGDVVPRTVENF  119

Query  568  RALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPG  389
            RALCTGEKG+G+KG SFHRVIKDFMIQGGDF  G+GTGG SIYG +F+DENF L H GPG
Sbjct  120  RALCTGEKGYGYKGCSFHRVIKDFMIQGGDFTNGDGTGGISIYGPSFRDENFSLKHVGPG  179

Query  388  VVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKR  209
            V+SMANAGP+TNGSQFFICTVKTPWLDNRHVVFG VIEGMDVVK IESQET   D P+  
Sbjct  180  VLSMANAGPDTNGSQFFICTVKTPWLDNRHVVFGHVIEGMDVVKRIESQETSNLDIPRMP  239

Query  208  VVISDCGELPI  176
              I +CGEL +
Sbjct  240  CRIVNCGELEV  250



>gb|KDP28363.1| hypothetical protein JCGZ_14134 [Jatropha curcas]
Length=256

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +A V +     E Q+KVT++ +FD+ IG   G+ AGRIV+GL+GD VP+T ENFRALC
Sbjct  71   RRMACVNSMTNDVELQAKVTTKCFFDVDIG---GEPAGRIVMGLFGDVVPKTVENFRALC  127

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KG SFHR+IKDFMIQGGDF  GNGTGG SIYG +F+DE+F L H GPG++SM
Sbjct  128  TGEKGYGYKGCSFHRIIKDFMIQGGDFTAGNGTGGVSIYGSSFEDESFALKHVGPGILSM  187

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGP+TNGSQFFICTV TPWLDNRHVVFG VI+GMDVV+ +ES ET R D P+    I 
Sbjct  188  ANAGPDTNGSQFFICTVPTPWLDNRHVVFGNVIDGMDVVRKLESLETSRMDSPRAPCRII  247

Query  196  DCGELPI  176
            +CGELP+
Sbjct  248  NCGELPM  254



>ref|XP_010240835.1| PREDICTED: peptidyl-prolyl cis-trans isomerase isoform X1 [Nelumbo 
nucifera]
Length=266

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 148/180 (82%), Gaps = 3/180 (2%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            + A+  E Q+KVT++ +FD+ IG   G+  GRIV+GL+G+ VP+T ENFRALCTGEKG+G
Sbjct  88   SAAKGLELQAKVTTKCFFDVEIG---GEPVGRIVMGLFGEVVPKTVENFRALCTGEKGYG  144

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            +KG SFHR+IKDFMIQGGDF  GNGTGG SIYG  F+DENF L+H GPGV+SMANAGP+T
Sbjct  145  YKGCSFHRIIKDFMIQGGDFTAGNGTGGMSIYGSNFEDENFTLIHIGPGVLSMANAGPDT  204

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            NGSQFFICTVKTPWLD RHVVFG V+EGM+VV+ +ESQET R D P+    I +CGELP+
Sbjct  205  NGSQFFICTVKTPWLDKRHVVFGHVVEGMEVVRKLESQETSRSDAPRLPCRIVNCGELPV  264



>ref|XP_006444643.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 ref|XP_006444645.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|ESR57883.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|ESR57885.1| hypothetical protein CICLE_v10021681mg [Citrus clementina]
 gb|KDO86740.1| hypothetical protein CISIN_1g024387mg [Citrus sinensis]
Length=268

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 154/188 (82%), Gaps = 4/188 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +  V + A+  E Q+KVT++V+FD+ IG   GK AGRIV+GL+GD VP+TAENFRALC
Sbjct  82   RRMFCVNSMAKDVELQAKVTTKVFFDVDIG---GKPAGRIVMGLFGDVVPKTAENFRALC  138

Query  556  T-GEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVS  380
            T GEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG +F+DE+F L H GPGV+S
Sbjct  139  TAGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSSFEDESFVLKHVGPGVLS  198

Query  379  MANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVI  200
            MANAGPNTNGSQFFICTVKTPWLDNRHVVFG VI+GMDVV+ +ES ET R D PK    I
Sbjct  199  MANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRKLESVETSRTDYPKVPCRI  258

Query  199  SDCGELPI  176
             + GELP+
Sbjct  259  INSGELPL  266



>ref|XP_004967648.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
[Setaria italica]
Length=242

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 145/174 (83%), Gaps = 3/174 (2%)
 Frame = -2

Query  697  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssF  518
            E Q+KVT++ +FD+ +G   G+  GRIVIGL+G+ VP T ENFRALCTGEKG+G+KG SF
Sbjct  70   ELQAKVTNKCFFDVEVG---GEPLGRIVIGLFGEVVPMTVENFRALCTGEKGYGYKGCSF  126

Query  517  HRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF  338
            HR+IKDFMIQGGDF + NGTGG+SIYG +F DENF L H GPGV+SMANAGP+TNGSQFF
Sbjct  127  HRIIKDFMIQGGDFQENNGTGGRSIYGESFDDENFTLKHVGPGVLSMANAGPDTNGSQFF  186

Query  337  ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            ICTVKTPWLDNRHVVFG V+EGMDVVK +ESQET R D PK+   I +CGEL +
Sbjct  187  ICTVKTPWLDNRHVVFGHVLEGMDVVKQLESQETSRSDSPKQPCRIVNCGELHL  240



>ref|XP_003536011.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic 
isoform 1 [Glycine max]
Length=263

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +    A   V + Q+KVT++ +FD+ IG   G+ AGR+V GL+G++VP+T ENFRALC
Sbjct  78   RRMTCTNAKENVLQLQAKVTNKCFFDVEIG---GEPAGRVVFGLFGEDVPKTVENFRALC  134

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KGS FHR+I++FM+QGGDF +GNGTGG SIYG +F DENF L H GPGV+SM
Sbjct  135  TGEKGYGYKGSYFHRIIQNFMVQGGDFTEGNGTGGISIYGDSFDDENFNLKHVGPGVLSM  194

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAG NTNGSQFFICTV+TPWLDNRHVVFG VI+GMDVV+ +ESQET + D P+K   I+
Sbjct  195  ANAGTNTNGSQFFICTVQTPWLDNRHVVFGHVIDGMDVVRTLESQETGKFDNPRKPCKIA  254

Query  196  DCGELPI  176
            D GELPI
Sbjct  255  DSGELPI  261



>ref|XP_001775768.1| predicted protein [Physcomitrella patens]
 gb|EDQ59451.1| predicted protein, partial [Physcomitrella patens]
Length=168

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 146/171 (85%), Gaps = 4/171 (2%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            Q+KVT + YFDI I    GK AGRIV+GL+GD VP+T ENF ALCTGEKGFG++GS+FHR
Sbjct  1    QAKVTKKCYFDIEID---GKPAGRIVLGLFGDVVPRTVENFAALCTGEKGFGYQGSAFHR  57

Query  511  VIKDFMIQggdfdkgngtggKSIYG-RTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI  335
            VIK+FMIQGGDFDKGNGTGG S++G + FKDENFKL H G G++SMANAGPNTNGSQFF+
Sbjct  58   VIKNFMIQGGDFDKGNGTGGYSVFGTKNFKDENFKLKHTGEGILSMANAGPNTNGSQFFL  117

Query  334  CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            CTV TPWLD RHVVFGQVIEGMDVVK IE Q+TDR DRPKK+ VI+  GEL
Sbjct  118  CTVPTPWLDGRHVVFGQVIEGMDVVKTIEGQDTDRTDRPKKKCVIAKSGEL  168



>ref|XP_007051330.1| Peptidyl-prolyl cis-trans isomerase [Theobroma cacao]
 gb|EOX95487.1| Peptidyl-prolyl cis-trans isomerase [Theobroma cacao]
Length=258

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 145/172 (84%), Gaps = 3/172 (2%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            QSKVT++ +FD+ +G   G+  GRIV+GL+GD VP+T ENFRALCTGEKG+G+KG SFHR
Sbjct  88   QSKVTTKCFFDVEVG---GEPVGRIVMGLFGDVVPRTVENFRALCTGEKGYGYKGCSFHR  144

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            +IKDFMIQGGDF  GNGTGG+SIYG  F+DENF L H GPGV+SMANAGP+TNGSQFFIC
Sbjct  145  IIKDFMIQGGDFTNGNGTGGRSIYGSRFEDENFDLKHVGPGVLSMANAGPDTNGSQFFIC  204

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            TVKTPWLDNRHVVFG V++GMDVV+ +ESQET R D P+    I +CGELP+
Sbjct  205  TVKTPWLDNRHVVFGHVVDGMDVVRKLESQETSRSDSPRVPCRIVNCGELPL  256



>gb|ABC41016.1| chloroplast-localized cyclophilin, partial [Triticum aestivum]
Length=140

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  610  GLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRT  431
            GLYGD+VPQT ENFRALC  E+GFG+KGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRT
Sbjct  1    GLYGDDVPQTVENFRALCAEERGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRT  60

Query  430  FKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLI  251
            FKDENF+LVH GPGV+SMANAGPNTNGSQFFICT+KTPWLD RHVVFGQV+EGMD+V+ I
Sbjct  61   FKDENFQLVHTGPGVLSMANAGPNTNGSQFFICTMKTPWLDGRHVVFGQVLEGMDIVRTI  120

Query  250  ESQETDRGDRPKKRVVISDC  191
            ES ETDRGDRPKK+VVIS+C
Sbjct  121  ESSETDRGDRPKKKVVISEC  140



>ref|XP_009138740.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic-like 
[Brassica rapa]
Length=258

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 143/176 (81%), Gaps = 3/176 (2%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            +A PQ+KVT + YFD+ IG   G+ AGRI +GL GD VP+T ENFRALCTGEK +G+KGS
Sbjct  84   LAPPQAKVTHKAYFDVEIG---GEVAGRIGMGLLGDVVPRTVENFRALCTGEKKYGYKGS  140

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            SFHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPG++SMANAGPNTNGSQ
Sbjct  141  SFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQ  200

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICT+KT WLDN+HVVFGQVIEGM +V+ +ESQET   D PKK   I  CGEL +
Sbjct  201  FFICTIKTSWLDNKHVVFGQVIEGMKLVRKLESQETRAMDVPKKACRIYACGELSM  256



>ref|XP_002301464.2| cyclophilin family protein [Populus trichocarpa]
 gb|EEE80737.2| cyclophilin family protein [Populus trichocarpa]
Length=266

 Score =   219 bits (557),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 152/185 (82%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            +A   + A   + Q+KVT++ +FD+ +G   G+  GRIV+GL+GD VP+TAENFRALCTG
Sbjct  83   MACANSMANDVDLQAKVTTKCFFDVEVG---GELVGRIVMGLFGDVVPKTAENFRALCTG  139

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            +KG+G+KG SFHR+IKDFMIQGGDF +G+GTGGKSIYG +F+DE+F L H GPGV+SMAN
Sbjct  140  DKGYGYKGCSFHRIIKDFMIQGGDFTRGDGTGGKSIYGSSFEDESFSLKHVGPGVLSMAN  199

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGPNTNGSQFFICTVKTPWLDNRHVVFG VI+GMDVV+ +ES ET R D P+K   + + 
Sbjct  200  AGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRKLESVETSRSDNPRKPCRVVNS  259

Query  190  GELPI  176
            GELP+
Sbjct  260  GELPL  264



>gb|KEH43161.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=251

 Score =   218 bits (556),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 148/181 (82%), Gaps = 4/181 (2%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            ++A  A+ Q+KVTS+V+FD+ IG   G++AGRIVIGL+GD VP+T ENFRALCTGEKG+G
Sbjct  72   SSANAADLQAKVTSKVFFDVVIG---GESAGRIVIGLFGDVVPKTVENFRALCTGEKGYG  128

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            +K S+FHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPGV+SMANAGPNT
Sbjct  129  YKDSTFHRIIKDFMIQGGDFTEGNGTGGVSIYGGKFEDENFALKHVGPGVLSMANAGPNT  188

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDR-GDRPKKRVVISDCGELP  179
            NGSQFFICTV T WLDNRHVVFG VI+GMDVV  +ESQET    + P K   I + GELP
Sbjct  189  NGSQFFICTVPTSWLDNRHVVFGHVIDGMDVVTTLESQETSSYNNGPLKSCKIVNSGELP  248

Query  178  I  176
            +
Sbjct  249  L  249



>ref|XP_006840420.1| hypothetical protein AMTR_s00045p00158000 [Amborella trichopoda]
 gb|ERN02095.1| hypothetical protein AMTR_s00045p00158000 [Amborella trichopoda]
Length=255

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R L    A     E Q+ VT++ +FD+ +G   G+  GRIV+GL+GD VP T ENFRALC
Sbjct  70   RGLVCNNAMTHDQELQADVTTKCFFDVEVG---GEPVGRIVLGLFGDVVPATVENFRALC  126

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKGFG+KG SFHR+IKDFM+Q GDFDKGNGTGG+SIYG  F+DENF L H GPGV+SM
Sbjct  127  TGEKGFGYKGCSFHRIIKDFMVQSGDFDKGNGTGGRSIYGSKFEDENFILKHIGPGVLSM  186

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICT KTPWLD RHVVFG V+EGMDVV+ +ESQET R D PK    I 
Sbjct  187  ANAGPNTNGSQFFICTTKTPWLDKRHVVFGHVLEGMDVVRALESQETSRSDVPKLPCRIV  246

Query  196  DCGELPI  176
            +CGELP+
Sbjct  247  NCGELPL  253



>ref|XP_008227760.1| PREDICTED: peptidyl-prolyl cis-trans isomerase isoform X2 [Prunus 
mume]
Length=250

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 144/174 (83%), Gaps = 3/174 (2%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V + Q+KVT++ +FD  IG   G+A GR+V+GL+GD VP+T ENFRALCTGEKG+G+KG 
Sbjct  77   VEQLQAKVTTKCFFDTEIG---GEAVGRLVLGLFGDVVPKTVENFRALCTGEKGYGYKGC  133

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            SFHR+IKDFMIQGGDF +G+GTGG SIYG TF DE+F L H GPGV+SMANAGP TNGSQ
Sbjct  134  SFHRIIKDFMIQGGDFTEGDGTGGISIYGSTFADESFALKHVGPGVLSMANAGPGTNGSQ  193

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            FFICTVKTPWLDNRHVVFG VIEGMDV++ +ESQET R D P+    I +CGEL
Sbjct  194  FFICTVKTPWLDNRHVVFGHVIEGMDVLRKLESQETSRSDVPRLPCRIVNCGEL  247



>ref|XP_008227759.1| PREDICTED: peptidyl-prolyl cis-trans isomerase isoform X1 [Prunus 
mume]
Length=252

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 145/176 (82%), Gaps = 3/176 (2%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V + Q+KVT++ +FD  IG   G+A GR+V+GL+GD VP+T ENFRALCTGEKG+G+KG 
Sbjct  79   VEQLQAKVTTKCFFDTEIG---GEAVGRLVLGLFGDVVPKTVENFRALCTGEKGYGYKGC  135

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            SFHR+IKDFMIQGGDF +G+GTGG SIYG TF DE+F L H GPGV+SMANAGP TNGSQ
Sbjct  136  SFHRIIKDFMIQGGDFTEGDGTGGISIYGSTFADESFALKHVGPGVLSMANAGPGTNGSQ  195

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FFICTVKTPWLDNRHVVFG VIEGMDV++ +ESQET R D P+    I +CGEL +
Sbjct  196  FFICTVKTPWLDNRHVVFGHVIEGMDVLRKLESQETSRSDVPRLPCRIVNCGELLL  251



>ref|XP_007221498.1| hypothetical protein PRUPE_ppa010357mg [Prunus persica]
 gb|EMJ22697.1| hypothetical protein PRUPE_ppa010357mg [Prunus persica]
Length=252

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 144/174 (83%), Gaps = 3/174 (2%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            V + Q+KVT++ +FD  IG   G+A GR+V+GL+GD VP+T ENFRALCTGEKG+G+KG 
Sbjct  79   VEQLQAKVTTKCFFDTEIG---GEAVGRLVLGLFGDVVPKTVENFRALCTGEKGYGYKGC  135

Query  523  sFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQ  344
            SFHR+IKDFMIQGGDF +G+GTGG SIYG TF DE+F L H GPGV+SMANAGP TNGSQ
Sbjct  136  SFHRIIKDFMIQGGDFTEGDGTGGVSIYGSTFADESFALKHVGPGVLSMANAGPGTNGSQ  195

Query  343  FFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            FFICTVKTPWLDNRHVVFG VIEGMDV++ +ESQET R D P+    I +CGEL
Sbjct  196  FFICTVKTPWLDNRHVVFGHVIEGMDVLRKLESQETSRSDVPRLPCRIVNCGEL  249



>ref|XP_004288662.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Fragaria vesca 
subsp. vesca]
Length=240

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 150/187 (80%), Gaps = 5/187 (3%)
 Frame = -2

Query  736  RPLAPVRATAQVAEP--QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRA  563
            + +  V +TA   E   Q+KVT++ +FDI IG   G+A GR+VIGL+G+ VP+T ENFRA
Sbjct  53   KTMVCVNSTANELEEKLQAKVTTRCFFDIDIG---GEAVGRVVIGLFGEVVPKTVENFRA  109

Query  562  LCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVV  383
            LCTGEKG+G+KG SFHR+IKDFMIQGGDF +G+GTGG SIYG  F+DENF L H GPGVV
Sbjct  110  LCTGEKGYGYKGCSFHRIIKDFMIQGGDFTEGDGTGGISIYGSKFEDENFALKHVGPGVV  169

Query  382  SMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVV  203
            SMANAGP TNGSQFFICTVKTPWLD+RHVVFG +IEGM+VV+ +ESQET R D P+    
Sbjct  170  SMANAGPGTNGSQFFICTVKTPWLDDRHVVFGHIIEGMNVVRKLESQETSRSDVPRLPCR  229

Query  202  ISDCGEL  182
            I +CGEL
Sbjct  230  IVNCGEL  236



>ref|XP_002951189.1| hypothetical protein VOLCADRAFT_81413 [Volvox carteri f. nagariensis]
 gb|EFJ47718.1| hypothetical protein VOLCADRAFT_81413 [Volvox carteri f. nagariensis]
Length=200

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = -2

Query  688  SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRV  509
            + +T +VYFD+ IG   G  AGRIVIGLYG++VP+T ENFRALCTGEKGFG+KGS FHRV
Sbjct  35   AAITKKVYFDVDIG---GNKAGRIVIGLYGNDVPKTVENFRALCTGEKGFGYKGSPFHRV  91

Query  508  IKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICT  329
            IK FMIQGGDF  GNGTGGKSIYGRTF DENFK  H GPG++SMANAGP TNGSQFFICT
Sbjct  92   IKQFMIQGGDFTNGNGTGGKSIYGRTFADENFKYRHTGPGILSMANAGPGTNGSQFFICT  151

Query  328  VKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            V TPWLD RHVVFG+V+EGMDVV  +E   T RGDRP + + I +CGEL
Sbjct  152  VPTPWLDGRHVVFGEVVEGMDVVAKVEGFPTGRGDRPVEPITIGECGEL  200



>gb|AFK42902.1| unknown [Lotus japonicus]
Length=184

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 149/181 (82%), Gaps = 3/181 (2%)
 Frame = -2

Query  721  VRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkg  542
            + A   V E Q++VT++ +FDI +G   G+  GRIV+GL+G+  P+T ENFR LCTGEKG
Sbjct  4    LNAAEIVQELQAEVTTKCFFDIEVG---GEPVGRIVLGLFGEVAPRTVENFRVLCTGEKG  60

Query  541  fgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGP  362
            +G+KGSSFHR+I++FMIQGGDF +G+GTGG SIYG +F+DE+F L H GPGV+SMANAGP
Sbjct  61   YGYKGSSFHRIIQEFMIQGGDFTEGDGTGGTSIYGSSFEDESFALKHVGPGVLSMANAGP  120

Query  361  NTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            NTNGSQFFICTVKTPWLDNRHVVFG VI+GMDVV+ +ESQET R D P+K   I +CGEL
Sbjct  121  NTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVRTLESQETSRLDIPRKPCRIVNCGEL  180

Query  181  P  179
            P
Sbjct  181  P  181



>emb|CDJ93250.1| Peptidyl-prolyl cis-trans isomerase domain containing protein 
[Haemonchus contortus]
Length=202

 Score =   215 bits (547),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = -2

Query  682  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIK  503
            VT QVYFDISIG   GK AGRIVIGL+G+ VP+TAENF  L TG KG+G+KGS FHRVIK
Sbjct  24   VTKQVYFDISIG---GKPAGRIVIGLFGNAVPKTAENFLQLATGSKGYGYKGSKFHRVIK  80

Query  502  DFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK  323
            DFMIQGGDF +G+GTGGKSIYG  F DENF L H GPG +SMANAGP+TNGSQFFICTVK
Sbjct  81   DFMIQGGDFTRGDGTGGKSIYGERFADENFDLHHYGPGWLSMANAGPDTNGSQFFICTVK  140

Query  322  TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            TPWLD RHVVFG+V+EGM VV+ IES ET  GDRPK+ VVI+D GEL +
Sbjct  141  TPWLDGRHVVFGKVLEGMSVVRKIESTETHPGDRPKEDVVITDSGELAL  189



>ref|XP_011025284.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Populus euphratica]
Length=266

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            Q+KVT++ +FD+ +G   G+  GRIV+GL+GD VP+TAENFRALCTG+KG+G+KG SFHR
Sbjct  96   QAKVTTKCFFDVEVG---GEPVGRIVMGLFGDVVPKTAENFRALCTGDKGYGYKGCSFHR  152

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            +IKDFMIQGGDF +G+GTGGKSIYG +F+DE+F L H GPGV+SMANAGPNTNGSQFFIC
Sbjct  153  IIKDFMIQGGDFTRGDGTGGKSIYGSSFEDESFSLKHVGPGVLSMANAGPNTNGSQFFIC  212

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            TVKTPWLDNRHVVFG VI+GMDVV+ +ES ET R D P+K   + + GELP+
Sbjct  213  TVKTPWLDNRHVVFGHVIDGMDVVRKLESVETSRSDNPRKPCRVVNSGELPL  264



>ref|XP_010907913.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
A1-like [Elaeis guineensis]
Length=267

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 143/174 (82%), Gaps = 3/174 (2%)
 Frame = -2

Query  697  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssF  518
            E Q+KVT + +FD+ IG   G+  GRIVIGLYG+ VP+T ENFRALCTGEKG G+KG SF
Sbjct  95   ELQAKVTKKCFFDVEIG---GEPVGRIVIGLYGEVVPRTVENFRALCTGEKGIGYKGCSF  151

Query  517  HRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF  338
            HR+IKDFMIQGGDFD GNGTGG+SIYG  F DE+F L H GPGV+SMANAGP+TNGSQFF
Sbjct  152  HRIIKDFMIQGGDFDHGNGTGGRSIYGPQFDDESFTLRHIGPGVLSMANAGPDTNGSQFF  211

Query  337  ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            ICTVKTPWLD RHVVFG V+EGMD+V+ +ESQET R D P+    I +CGELP+
Sbjct  212  ICTVKTPWLDKRHVVFGHVLEGMDIVRKLESQETSRSDVPRLPCRIVNCGELPM  265



>sp|Q41651.1|CYPB_VICFA RecName: Full=Peptidyl-prolyl cis-trans isomerase, chloroplastic; 
Short=PPIase; AltName: Full=Cyclophilin; AltName: Full=Cyclosporin 
A-binding protein; Short=CYP B; AltName: Full=Rotamase; 
Flags: Precursor [Vicia faba]
 gb|AAA64430.1| cyclophilin [Vicia faba]
Length=248

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 148/181 (82%), Gaps = 4/181 (2%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            A  +VAE Q+KVTS+++FDI IG   G++AGRIVIGL+GD VP+T ENF+ L TG KG+G
Sbjct  69   AQGEVAELQAKVTSKIFFDIEIG---GESAGRIVIGLFGDAVPKTVENFKTLSTGAKGYG  125

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            ++GS FHR+I +FMIQGGDF +GNGTGG SIYG  F+DE+F L H GPGV+SMANAGPNT
Sbjct  126  YQGSFFHRIIPNFMIQGGDFTEGNGTGGVSIYGSKFEDESFDLKHVGPGVLSMANAGPNT  185

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDR-PKKRVVISDCGELP  179
            NGSQFFICTV TPWLDNRHVVFG VIEG+DVVK +ESQET + D  PKK   I+  GELP
Sbjct  186  NGSQFFICTVPTPWLDNRHVVFGHVIEGLDVVKQLESQETSKLDNSPKKPCKIAKSGELP  245

Query  178  I  176
            +
Sbjct  246  L  246



>ref|XP_010672482.1| PREDICTED: peptidyl-prolyl cis-trans isomerase A1 [Beta vulgaris 
subsp. vulgaris]
Length=257

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 146/179 (82%), Gaps = 3/179 (2%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            ++A V +  ++VT++V+FD+ IG   G+  GRIV+GL+GD VP+TAENFR LCTGEKG+G
Sbjct  79   SSADVQDLGAEVTTKVFFDVDIG---GEPVGRIVMGLFGDVVPKTAENFRVLCTGEKGYG  135

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            +KG  FHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPGV+SMANAGP T
Sbjct  136  YKGCHFHRIIKDFMIQGGDFTEGNGTGGISIYGSKFEDENFTLKHVGPGVLSMANAGPGT  195

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            NGSQFFICTV TPWLDN+HVVFGQV+EGMDVV+ +ES ET   + P+K   I +CGELP
Sbjct  196  NGSQFFICTVPTPWLDNKHVVFGQVLEGMDVVRTLESTETSSSNGPRKPCRIINCGELP  254



>ref|XP_001700546.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
 gb|EDO97990.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
Length=200

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = -2

Query  688  SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRV  509
            + VT +VYFD++IG     +AGR+VIGLYG++VP T ENFRALCTGEKGFG+KGS FHRV
Sbjct  35   AAVTKKVYFDVNIG---ANSAGRVVIGLYGNDVPDTVENFRALCTGEKGFGYKGSVFHRV  91

Query  508  IKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICT  329
            IK FMIQGGDF  GNGTGGKSIYG  F DENFK  H GPG++SMANAGPNTNGSQFFICT
Sbjct  92   IKQFMIQGGDFTAGNGTGGKSIYGARFNDENFKYKHTGPGILSMANAGPNTNGSQFFICT  151

Query  328  VKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            V TPWLD RHVVFG+V+EG+DVV  +E+  T RGDRP + + I+ CGEL
Sbjct  152  VATPWLDGRHVVFGEVVEGLDVVAKVENSPTGRGDRPVEPITIAACGEL  200



>gb|ABA01141.1| peptidylprolyl isomerase/cyclophilin-like protein [Chlamydomonas 
incerta]
Length=201

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = -2

Query  688  SKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRV  509
            + +T +VYFDI+IG     +AGR+VIGLYG++VPQT ENFRALCTGEKGFG+KGS FHRV
Sbjct  36   AAITKKVYFDINIG---ANSAGRVVIGLYGNDVPQTVENFRALCTGEKGFGYKGSPFHRV  92

Query  508  IKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICT  329
            IK FMIQGGDF  GNGTGGKSIYG  F DENFK  H GPGV+SMANAGPNTNGSQFFICT
Sbjct  93   IKQFMIQGGDFTAGNGTGGKSIYGARFNDENFKYKHTGPGVLSMANAGPNTNGSQFFICT  152

Query  328  VKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            V TPWLD RHVVFG+V+EG DVV  +E+  T RGDRP + + ++ CGEL
Sbjct  153  VATPWLDGRHVVFGEVVEGQDVVDKVENFPTGRGDRPVEPITVAACGEL  201



>gb|EYB84042.1| hypothetical protein Y032_0323g2468 [Ancylostoma ceylanicum]
Length=202

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = -2

Query  682  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIK  503
            VT QVYFDI+IG   GK AGRIVIGL+G+ VP+T ENF  L TG KG+G+KGS FHRVIK
Sbjct  24   VTKQVYFDITIG---GKPAGRIVIGLFGNVVPKTTENFLQLATGAKGYGYKGSKFHRVIK  80

Query  502  DFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK  323
            DFMIQGGDF +G+GTGGKSIYG  FKDENF L H GPG +SMANAGP+TNGSQFFICTVK
Sbjct  81   DFMIQGGDFTRGDGTGGKSIYGDRFKDENFVLSHYGPGWLSMANAGPDTNGSQFFICTVK  140

Query  322  TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            TPWLD RHVVFG+V+EGM VV+ IE+ +T+ GDRP + V ISD GELP+
Sbjct  141  TPWLDGRHVVFGKVLEGMSVVRKIENTKTNPGDRPAESVEISDSGELPL  189



>gb|KFK35389.1| hypothetical protein AALP_AA5G278800 [Arabis alpina]
Length=621

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 145/174 (83%), Gaps = 3/174 (2%)
 Frame = -2

Query  697  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssF  518
            EP +KVT++VYFD+ IG   G+ AGRIV+GL+G+ VP+T ENFR LCTGEK +G+KGSSF
Sbjct  449  EPIAKVTNKVYFDVEIG---GEVAGRIVMGLFGEVVPKTVENFRVLCTGEKKYGYKGSSF  505

Query  517  HRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF  338
            HR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GPG++SMANAGPNTNGSQFF
Sbjct  506  HRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTGPGILSMANAGPNTNGSQFF  565

Query  337  ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            ICTVKTPWLDN+HVVFGQVIEGM +V+ +ESQ T   D PKK   I  CGELPI
Sbjct  566  ICTVKTPWLDNKHVVFGQVIEGMKLVRTLESQPTRAMDIPKKGCRIYACGELPI  619



>emb|CBQ70421.1| probable cyclophilin b [Sporisorium reilianum SRZ2]
Length=213

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 140/174 (80%), Gaps = 3/174 (2%)
 Frame = -2

Query  700  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  521
            A+PQ  VT +VYFDIS     GK  GRIV+GLYGD+VP+TAENFRAL TGEKGFG+KGS 
Sbjct  32   ADPQPNVTHRVYFDIS---HDGKDVGRIVLGLYGDDVPKTAENFRALATGEKGFGYKGSK  88

Query  520  FHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF  341
            FHRVI +FMIQGGDF++G+G GG SIYG  F DENFKL H GPGV+SMANAGPNTNG+QF
Sbjct  89   FHRVISNFMIQGGDFERGDGRGGYSIYGGKFDDENFKLKHTGPGVLSMANAGPNTNGAQF  148

Query  340  FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            FICTVKT WLD RHVVFG+++EGM+ VK IE+     GD+P   V++ D GELP
Sbjct  149  FICTVKTSWLDGRHVVFGRILEGMETVKYIENVPKGYGDKPVHDVIVKDSGELP  202



>sp|Q01490.1|PPIB_ORPSP RecName: Full=Peptidyl-prolyl cis-trans isomerase B; Short=PPIase 
B; AltName: Full=Cyclophilin B; AltName: Full=Rotamase 
B; Flags: Precursor [Orpinomyces sp. PC-2]
 gb|AAD04195.1| cyclophilin B precursor [Orpinomyces sp. PC-2]
Length=203

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 142/180 (79%), Gaps = 3/180 (2%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            AT   A    KVT++VYFDI  G+   K  GRIV+GLYG+ VP+T ENFRAL TGEKG+G
Sbjct  17   ATLVSASTNPKVTNKVYFDIKQGD---KDLGRIVLGLYGEVVPKTVENFRALATGEKGYG  73

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            +K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG++SMANAG +T
Sbjct  74   YKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFADENFKLRHTGPGILSMANAGRDT  133

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            NGSQFFI TV T WLD RHVVFG+VIEGMDVV  IE+ +T  GDRP   V+I+DCGELP+
Sbjct  134  NGSQFFITTVTTSWLDGRHVVFGKVIEGMDVVTAIETTKTLPGDRPATPVIIADCGELPV  193



>gb|ABC47329.1| cyclophilin B precursor [Orpinomyces sp. PC-2]
Length=203

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 150/196 (77%), Gaps = 4/196 (2%)
 Frame = -2

Query  760  CSVQVKSGRPLAPVR-ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQ  584
             ++ +KS   LA V  AT   A    KVT++VYFDI  G+   K  GRIV+GLYG+ VP+
Sbjct  1    MNLSIKSVIFLAIVALATLVSASTNPKVTNKVYFDIRQGD---KDLGRIVLGLYGEVVPK  57

Query  583  TAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLV  404
            T ENFRAL TGEKG+G+K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL 
Sbjct  58   TVENFRALATGEKGYGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFADENFKLR  117

Query  403  HAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGD  224
            H GPG++SMANAG +TNGSQFFI TV T WLD RHVVFG+VIEGMDVV  IE+ +T  GD
Sbjct  118  HTGPGILSMANAGRDTNGSQFFITTVTTSWLDGRHVVFGKVIEGMDVVTAIETTKTLPGD  177

Query  223  RPKKRVVISDCGELPI  176
            RP   V+I+DCGELP+
Sbjct  178  RPATPVIIADCGELPV  193



>ref|XP_001771085.1| predicted protein [Physcomitrella patens]
 gb|EDQ64086.1| predicted protein [Physcomitrella patens]
Length=249

 Score =   211 bits (536),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 164/213 (77%), Gaps = 24/213 (11%)
 Frame = -2

Query  769  FSSCSVQVKSG-RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDE  593
            F + S Q++S   P    RAT +  +    VT++ YFDI+IGN   K AGR+V+GL+G++
Sbjct  44   FGAGSQQLRSASEPTNFQRATTRAMQ----VTTKCYFDITIGN---KPAGRVVLGLFGED  96

Query  592  VPQTAENFRALCTG----------------EkgfgfkgssFHRVIKDFMIQggdfdkgng  461
            VP T +NF+ LCTG                EKGFGFKGS+FHRVIK+FMIQGGDFD+GNG
Sbjct  97   VPITVKNFQQLCTGLNYLYEGIMRVIVVACEKGFGFKGSAFHRVIKNFMIQGGDFDRGNG  156

Query  460  tggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQV  281
            TGGKSIYGRTF+DENFKL H GPG++SMANAGP+TNGSQFFICTV+TPWL+N+HVVFGQV
Sbjct  157  TGGKSIYGRTFRDENFKLRHTGPGILSMANAGPHTNGSQFFICTVETPWLNNKHVVFGQV  216

Query  280  IEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            IEG+DVV+ IE+Q+TD  D+P++  VI+D GEL
Sbjct  217  IEGLDVVRTIENQDTDHNDKPRQACVIADSGEL  249



>ref|XP_008343225.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like isoform X1 
[Malus domestica]
Length=255

 Score =   210 bits (535),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            Q+ VT++ +FDI IG   G+A GR+V+GL+G  VP+T ENFRALCTGEKG+G+KG S HR
Sbjct  85   QATVTTKCFFDIDIG---GEAVGRLVLGLFGQVVPKTVENFRALCTGEKGYGYKGCSXHR  141

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            +IKDFMIQGGDF +G+GTGG SIYG  F DE+F L H GPGV+SMANAGP TNGSQFFIC
Sbjct  142  IIKDFMIQGGDFTQGDGTGGVSIYGSKFADESFALKHVGPGVLSMANAGPGTNGSQFFIC  201

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            TVKTPWLDNRHVVFG VIEGMDV++ +ESQET R D P+    I +CGEL
Sbjct  202  TVKTPWLDNRHVVFGHVIEGMDVLRKLESQETSRLDVPRLPCRIVNCGEL  251



>ref|XP_008343228.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like isoform X4 
[Malus domestica]
Length=249

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            Q+ VT++ +FDI IG   G+A GR+V+GL+G  VP+T ENFRALCTGEKG+G+KG S HR
Sbjct  79   QATVTTKCFFDIDIG---GEAVGRLVLGLFGQVVPKTVENFRALCTGEKGYGYKGCSXHR  135

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            +IKDFMIQGGDF +G+GTGG SIYG  F DE+F L H GPGV+SMANAGP TNGSQFFIC
Sbjct  136  IIKDFMIQGGDFTQGDGTGGVSIYGSKFADESFALKHVGPGVLSMANAGPGTNGSQFFIC  195

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            TVKTPWLDNRHVVFG VIEGMDV++ +ESQET R D P+    I +CGEL
Sbjct  196  TVKTPWLDNRHVVFGHVIEGMDVLRKLESQETSRLDVPRLPCRIVNCGEL  245



>ref|XP_008343226.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like isoform X2 
[Malus domestica]
Length=253

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            Q+ VT++ +FDI IG   G+A GR+V+GL+G  VP+T ENFRALCTGEKG+G+KG S HR
Sbjct  83   QATVTTKCFFDIDIG---GEAVGRLVLGLFGQVVPKTVENFRALCTGEKGYGYKGCSXHR  139

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            +IKDFMIQGGDF +G+GTGG SIYG  F DE+F L H GPGV+SMANAGP TNGSQFFIC
Sbjct  140  IIKDFMIQGGDFTQGDGTGGVSIYGSKFADESFALKHVGPGVLSMANAGPGTNGSQFFIC  199

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            TVKTPWLDNRHVVFG VIEGMDV++ +ESQET R D P+    I +CGEL
Sbjct  200  TVKTPWLDNRHVVFGHVIEGMDVLRKLESQETSRLDVPRLPCRIVNCGEL  249



>ref|XP_008343227.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like isoform X3 
[Malus domestica]
Length=251

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            Q+ VT++ +FDI IG   G+A GR+V+GL+G  VP+T ENFRALCTGEKG+G+KG S HR
Sbjct  81   QATVTTKCFFDIDIG---GEAVGRLVLGLFGQVVPKTVENFRALCTGEKGYGYKGCSXHR  137

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            +IKDFMIQGGDF +G+GTGG SIYG  F DE+F L H GPGV+SMANAGP TNGSQFFIC
Sbjct  138  IIKDFMIQGGDFTQGDGTGGVSIYGSKFADESFALKHVGPGVLSMANAGPGTNGSQFFIC  197

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            TVKTPWLDNRHVVFG VIEGMDV++ +ESQET R D P+    I +CGEL
Sbjct  198  TVKTPWLDNRHVVFGHVIEGMDVLRKLESQETSRLDVPRLPCRIVNCGEL  247



>ref|XP_001766197.1| predicted protein [Physcomitrella patens]
 gb|EDQ69046.1| predicted protein [Physcomitrella patens]
Length=186

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 142/187 (76%), Gaps = 5/187 (3%)
 Frame = -2

Query  736  RPLAPVRATAQVAE--PQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRA  563
            R    VRA    +E   Q KVT + +FDI I +   K  GRI+ GL+GD VP T ENFR 
Sbjct  3    RNQVNVRAAQVPSEVTTQDKVTKKCFFDIEIDD---KPCGRIIFGLFGDTVPDTVENFRC  59

Query  562  LCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVV  383
            LCTGE+ FG+KGS+FHRVIKDFMIQGGDFD+GNGTGG SIYG TFKDENFKL H G GV+
Sbjct  60   LCTGERRFGYKGSAFHRVIKDFMIQGGDFDQGNGTGGYSIYGNTFKDENFKLRHTGEGVL  119

Query  382  SMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVV  203
            SMAN GP+TNGSQFFICT +T WLD RHVVFGQVIEGMDVVK IE Q+ D  DRP K+ V
Sbjct  120  SMANRGPDTNGSQFFICTAETSWLDGRHVVFGQVIEGMDVVKAIEGQDVDPNDRPMKKCV  179

Query  202  ISDCGEL  182
            I + GEL
Sbjct  180  IVESGEL  186



>ref|XP_009341536.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like isoform X1 
[Pyrus x bretschneideri]
Length=253

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 141/175 (81%), Gaps = 3/175 (2%)
 Frame = -2

Query  706  QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg  527
            Q  + Q+ VT++ + DI IG   G+A GR+V+GL+G  VP+T ENFRALCTGEKG+G+KG
Sbjct  78   QQPQLQATVTTKCFLDIDIG---GEAVGRLVLGLFGQVVPKTVENFRALCTGEKGYGYKG  134

Query  526  ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGS  347
             SFHR+IKDFMIQGGDF +G+GTGG SIYG  F DE+F L H GPGV+SMANAGP TNGS
Sbjct  135  CSFHRIIKDFMIQGGDFTQGDGTGGVSIYGSKFADESFALKHVGPGVLSMANAGPGTNGS  194

Query  346  QFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            QFFICTVKTPWLDNRHVVFG VIEGMDV++ +ESQET R D P+    I +CGEL
Sbjct  195  QFFICTVKTPWLDNRHVVFGHVIEGMDVLRKLESQETSRLDVPRLPCRIVNCGEL  249



>gb|KHG11065.1| Peptidyl-prolyl cis-trans isomerase, chloroplastic [Gossypium 
arboreum]
Length=250

 Score =   208 bits (529),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 140/174 (80%), Gaps = 8/174 (5%)
 Frame = -2

Query  697  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssF  518
            E Q+KVT++ +FD+ IG   GKA GRIV+GL+GD VP+T ENFR     E G+GFKG SF
Sbjct  83   ELQAKVTTKCFFDVEIG---GKAVGRIVMGLFGDVVPRTVENFR-----ENGYGFKGCSF  134

Query  517  HRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFF  338
            HR+IKDFMIQGGDF  GNGTGG SIYG  F+DE+F L H GPGV+SMANAGPNTNGSQFF
Sbjct  135  HRIIKDFMIQGGDFTNGNGTGGMSIYGSKFEDESFALKHVGPGVLSMANAGPNTNGSQFF  194

Query  337  ICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            ICTVKTPWLDNRHVVFG VI+GMDVV+ +ESQET R D P+    I +CGELPI
Sbjct  195  ICTVKTPWLDNRHVVFGHVIDGMDVVRELESQETSRTDGPRVPCRIVNCGELPI  248



>ref|XP_009341538.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like isoform X3 
[Pyrus x bretschneideri]
Length=249

 Score =   207 bits (528),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 141/175 (81%), Gaps = 3/175 (2%)
 Frame = -2

Query  706  QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg  527
            Q  + Q+ VT++ + DI IG   G+A GR+V+GL+G  VP+T ENFRALCTGEKG+G+KG
Sbjct  74   QQPQLQATVTTKCFLDIDIG---GEAVGRLVLGLFGQVVPKTVENFRALCTGEKGYGYKG  130

Query  526  ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGS  347
             SFHR+IKDFMIQGGDF +G+GTGG SIYG  F DE+F L H GPGV+SMANAGP TNGS
Sbjct  131  CSFHRIIKDFMIQGGDFTQGDGTGGVSIYGSKFADESFALKHVGPGVLSMANAGPGTNGS  190

Query  346  QFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            QFFICTVKTPWLDNRHVVFG VIEGMDV++ +ESQET R D P+    I +CGEL
Sbjct  191  QFFICTVKTPWLDNRHVVFGHVIEGMDVLRKLESQETSRLDVPRLPCRIVNCGEL  245



>ref|XP_009341537.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like isoform X2 
[Pyrus x bretschneideri]
Length=251

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 141/175 (81%), Gaps = 3/175 (2%)
 Frame = -2

Query  706  QVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg  527
            Q  + Q+ VT++ + DI IG   G+A GR+V+GL+G  VP+T ENFRALCTGEKG+G+KG
Sbjct  76   QQPQLQATVTTKCFLDIDIG---GEAVGRLVLGLFGQVVPKTVENFRALCTGEKGYGYKG  132

Query  526  ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGS  347
             SFHR+IKDFMIQGGDF +G+GTGG SIYG  F DE+F L H GPGV+SMANAGP TNGS
Sbjct  133  CSFHRIIKDFMIQGGDFTQGDGTGGVSIYGSKFADESFALKHVGPGVLSMANAGPGTNGS  192

Query  346  QFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            QFFICTVKTPWLDNRHVVFG VIEGMDV++ +ESQET R D P+    I +CGEL
Sbjct  193  QFFICTVKTPWLDNRHVVFGHVIEGMDVLRKLESQETSRLDVPRLPCRIVNCGEL  247



>ref|XP_004337460.1| peptidylprolyl cis-trans isomerase [Acanthamoeba castellanii 
str. Neff]
 gb|ELR15447.1| peptidylprolyl cis-trans isomerase [Acanthamoeba castellanii 
str. Neff]
Length=172

 Score =   205 bits (521),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 139/171 (81%), Gaps = 10/171 (6%)
 Frame = -2

Query  673  QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs-------sFH  515
            +V+FDI+IG   G+AAGR+ + L+ D VP+TAENFRALCTGEKG G  G        +FH
Sbjct  5    RVFFDITIG---GEAAGRVTMELFADVVPKTAENFRALCTGEKGVGRSGKPLHFKGCAFH  61

Query  514  RVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI  335
            RVIKDFMIQGGDF  GNGTGG+SIYG  F+DENFKL H GPG++SMANAGPNTNGSQFFI
Sbjct  62   RVIKDFMIQGGDFTAGNGTGGESIYGGEFRDENFKLKHTGPGILSMANAGPNTNGSQFFI  121

Query  334  CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            CTVKT WLDN+HVVFG+V++GMDV++ +ESQ  D  D P+K+ VI+DCG+L
Sbjct  122  CTVKTTWLDNKHVVFGKVVDGMDVIRKVESQTVDADDAPRKKCVIADCGQL  172



>emb|CDS10860.1| hypothetical protein LRAMOSA11346 [Absidia idahoensis var. thermophila]
Length=204

 Score =   206 bits (524),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = -2

Query  682  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIK  503
            VT++VYFDI  G+   +  GRIVIGLYG  VP+TAENFRAL TGEKG+G+KGS FHRVIK
Sbjct  31   VTNKVYFDIKQGD---EDLGRIVIGLYGKTVPKTAENFRALATGEKGYGYKGSKFHRVIK  87

Query  502  DFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK  323
             FMIQGGDF  G+GTGGKSIYG  F+DENFKL H GPGV+SMANAG NTNGSQFFI TVK
Sbjct  88   QFMIQGGDFTNGDGTGGKSIYGGKFEDENFKLQHTGPGVLSMANAGKNTNGSQFFITTVK  147

Query  322  TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            T WLD RHVVFG+V+EGMDVV+ IE+ +T+R D+P+  +VI+D GELP+
Sbjct  148  TSWLDGRHVVFGKVLEGMDVVEAIENTKTNRRDKPEVDIVIADSGELPV  196



>gb|AHK24889.1| peptidyl-prolyl cis-trans isomerase, partial [Lilium lancifolium]
Length=172

 Score =   205 bits (521),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 141/172 (82%), Gaps = 3/172 (2%)
 Frame = -2

Query  691  QSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHR  512
            Q++VT++ +FD+ IG   G+  GRIV+GL+G  VP+T ENFRALCTGE GFG+KG SFHR
Sbjct  2    QAEVTTKCFFDVEIG---GEPVGRIVLGLFGKVVPKTVENFRALCTGENGFGYKGCSFHR  58

Query  511  VIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFIC  332
            +IKDFMIQGGDF++GNGTGG+SIYG  F+DE F L H GPGV+SMANAGPNTNGSQFFIC
Sbjct  59   IIKDFMIQGGDFERGNGTGGRSIYGSKFEDEGFTLNHVGPGVLSMANAGPNTNGSQFFIC  118

Query  331  TVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            T+KTPWLD  HVVFG V+EGMDV++ +ESQET R D P+    I +CGEL +
Sbjct  119  TLKTPWLDKHHVVFGHVVEGMDVIRKLESQETSRSDVPRLPCRIVNCGELTM  170



>ref|XP_004495847.1| PREDICTED: peptidyl-prolyl cis-trans isomerase, chloroplastic-like 
[Cicer arietinum]
Length=253

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 149/193 (77%), Gaps = 6/193 (3%)
 Frame = -2

Query  748  VKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGN-PVGKAAGRIVIGLYGDEVPQTAEN  572
            + S R      A   V E Q+KVT++ +FD+ IG+ PVG    RIV GL+G+ VP+T EN
Sbjct  63   ITSRRITCTSSAKENVVELQAKVTNKCFFDVEIGDEPVG----RIVFGLFGEVVPKTVEN  118

Query  571  FRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGP  392
            FRALCTGEKG+G+KGS FHR+IKDFMIQGGDF +GNGTGG SIYG  F+DENF L H GP
Sbjct  119  FRALCTGEKGYGYKGSYFHRIIKDFMIQGGDFTEGNGTGGVSIYGAKFEDENFALKHVGP  178

Query  391  GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDR-GDRPK  215
            GV+SMANAG NTNGSQFFICTV+T WLD  HVVFG VI+G+DVV+ +ESQET+R  + P+
Sbjct  179  GVLSMANAGRNTNGSQFFICTVETSWLDKAHVVFGHVIDGLDVVRTLESQETNRSNNNPR  238

Query  214  KRVVISDCGELPI  176
            K   I++ GELPI
Sbjct  239  KACKIANSGELPI  251



>ref|XP_002110986.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV26990.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=202

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 142/175 (81%), Gaps = 3/175 (2%)
 Frame = -2

Query  700  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  521
            A+   KVT +V+FDI+IG   G+ AGRI IGL+G  VP+T  NF AL TGEKGFG+KGS 
Sbjct  22   AKKGPKVTKKVFFDITIG---GEKAGRIEIGLFGSTVPKTVTNFVALATGEKGFGYKGSV  78

Query  520  FHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF  341
            FHRVIKDFMIQGGDF  G+GTGGKSIYGR F DENFKL HAGPG +SMANAG +TNGSQF
Sbjct  79   FHRVIKDFMIQGGDFTNGDGTGGKSIYGRKFDDENFKLKHAGPGYLSMANAGRHTNGSQF  138

Query  340  FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FI TV+TPWLD RHVVFG+V++GMD+V+ IE+ +T   DRP+K V I+DCGE+ +
Sbjct  139  FITTVRTPWLDGRHVVFGKVLDGMDIVRKIENSKTSHNDRPEKEVKIADCGEITV  193



>dbj|GAC97260.1| peptidyl-prolyl cis-trans isomerase [Pseudozyma hubeiensis SY62]
Length=186

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 141/177 (80%), Gaps = 5/177 (3%)
 Frame = -2

Query  712  TAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  533
            +A   EP   VT++VYFDIS  N   K  GRIV+GLYG++VP+TAENFRAL TGEKGFG+
Sbjct  5    SASTTEPV--VTTKVYFDISHDN---KDVGRIVLGLYGNDVPKTAENFRALATGEKGFGY  59

Query  532  kgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTN  353
            KGS FHRVI +FMIQGGDF++G+G GG SIYG  F DENFKL H GPGV+SMANAGPNTN
Sbjct  60   KGSKFHRVISNFMIQGGDFERGDGRGGYSIYGGKFDDENFKLKHTGPGVLSMANAGPNTN  119

Query  352  GSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            G+QFFICTVKT WLD RHVVFG+++EGMDVVK IE+     GD+P   V++ D GEL
Sbjct  120  GAQFFICTVKTSWLDGRHVVFGRIVEGMDVVKYIENVPKGYGDKPVADVIVKDSGEL  176



>gb|KIH69528.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Ancylostoma 
duodenale]
Length=216

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 141/177 (80%), Gaps = 8/177 (5%)
 Frame = -2

Query  682  VTSQVYFDISIGNP--------VGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg  527
            VT QVYFDI+IG          V   AGRIVIGL+G+ VP+TAENF  L TG KG+G+KG
Sbjct  27   VTKQVYFDITIGGKPFCVSTKYVPSQAGRIVIGLFGNVVPKTAENFLQLATGAKGYGYKG  86

Query  526  ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGS  347
            S FHRVIKDFMIQGGDF +G+GTGGKSIYG  FKDENF L H GPG +SMANAGP+TNGS
Sbjct  87   SKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFKDENFVLSHYGPGWLSMANAGPDTNGS  146

Query  346  QFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            QFFICTVKTPWLD RHVVFG+V+EGM VV+ IE+ +T+ GDRP + V ISD GELP+
Sbjct  147  QFFICTVKTPWLDGRHVVFGKVLEGMSVVRKIENTKTNPGDRPAESVEISDSGELPL  203



>gb|EJW80238.1| cyclophilin-type peptidyl-prolyl cis-trans isomerase-15 [Wuchereria 
bancrofti]
Length=203

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 144/179 (80%), Gaps = 3/179 (2%)
 Frame = -2

Query  712  TAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  533
            T+  A+  + VT +VYFD++IG+   K  GRI IGL+G++VP+TAENFRAL TGEKGFG+
Sbjct  16   TSNNAKEMATVTKKVYFDVAIGD---KKIGRIEIGLFGNDVPKTAENFRALATGEKGFGY  72

Query  532  kgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTN  353
            KGS FHRVIKDFMIQGGDF KG+GTGGKSIYG  F+DENFKL H G G +SMANAG +TN
Sbjct  73   KGSKFHRVIKDFMIQGGDFTKGDGTGGKSIYGDRFEDENFKLKHYGAGWLSMANAGKDTN  132

Query  352  GSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            GSQFFI TV+T WLD RHVVFG+V+ GMDVV+ IE   T  GDRPK+ V I DCGELP+
Sbjct  133  GSQFFITTVQTTWLDGRHVVFGKVLNGMDVVRKIEQTSTHPGDRPKQDVKIVDCGELPL  191



>gb|KHN43398.1| Peptidyl-prolyl cis-trans isomerase, chloroplastic [Glycine soja]
Length=254

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 145/187 (78%), Gaps = 9/187 (5%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +  V A   V E Q+KVT++ +FD+ +G   G+  GRIV+GL+G+           LC
Sbjct  75   RRMTCVNAADNVVELQAKVTTKCFFDVEVG---GEPVGRIVLGLFGEI------KLNNLC  125

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KGSSFHR+IKDFMIQGGDF +GNGTGG SIYG +FKDE+F L H GPGV+SM
Sbjct  126  TGEKGYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGPSFKDESFALKHVGPGVLSM  185

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKTPWLDNRHVVFG +I+GMDVVK +ESQET R D P+K   I 
Sbjct  186  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGHIIDGMDVVKTLESQETSRLDVPRKPCRIV  245

Query  196  DCGELPI  176
            +CGELPI
Sbjct  246  NCGELPI  252



>gb|ERG83631.1| peptidyl-prolyl cis-trans isomerase b [Ascaris suum]
Length=203

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = -2

Query  682  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIK  503
            VT +V+ DI IG   GK  GRIVIGL+G+EVP+TAENFRAL TGEKG+GFKGS FHRVIK
Sbjct  26   VTKKVFLDIEIG---GKKTGRIVIGLFGNEVPKTAENFRALATGEKGYGFKGSKFHRVIK  82

Query  502  DFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK  323
            DFMIQGGDF +G+GTGGKSIYG  F DENFKL H G G +SMANAG +TNGSQFFI TV+
Sbjct  83   DFMIQGGDFTRGDGTGGKSIYGERFPDENFKLQHYGAGWLSMANAGKDTNGSQFFITTVQ  142

Query  322  TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            T WL+ RHVVFG+V+EGM+VV+ IES  T  GDRP+K VVI +CGELP+
Sbjct  143  TSWLNGRHVVFGKVLEGMNVVREIESTPTHPGDRPQKDVVIVECGELPL  191



>emb|CDI51937.1| probable cyclophilin b [Melanopsichium pennsylvanicum 4]
Length=314

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 138/169 (82%), Gaps = 4/169 (2%)
 Frame = -2

Query  682  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIK  503
            VT++VYFDI      GK  GRIV+GLYG++VP+TAENFRAL TGE GFG+KGS FHRVI 
Sbjct  34   VTNKVYFDIE---HDGKDVGRIVLGLYGNDVPRTAENFRALATGEHGFGYKGSKFHRVIS  90

Query  502  DFMIQggdfdkgngtggKSIYGRT-FKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTV  326
            +FMIQGGDF+KG+G GG SIYG+T F DENFKL H GPGV+SMANAGPNTNG+QFFICTV
Sbjct  91   NFMIQGGDFEKGDGRGGYSIYGKTKFNDENFKLKHTGPGVLSMANAGPNTNGAQFFICTV  150

Query  325  KTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            KT WLD RHVVFG+++EGMD+VK IE+     GD+P   V++ D GELP
Sbjct  151  KTSWLDGRHVVFGRIVEGMDIVKYIENVPKGYGDKPVHDVIVKDSGELP  199



>gb|ETS61121.1| hypothetical protein PaG_05069 [Pseudozyma aphidis DSM 70725]
Length=301

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 137/168 (82%), Gaps = 3/168 (2%)
 Frame = -2

Query  682  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIK  503
            VT +VYFDI+     GK  GRI +GL+G++VP+TAENFRAL TGEKGFG+KGS FHRVI 
Sbjct  27   VTHKVYFDIA---HDGKDVGRITLGLFGNDVPKTAENFRALATGEKGFGYKGSKFHRVIA  83

Query  502  DFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK  323
            +FMIQGGDF++G+G GG SIYG  F DENFKL H GPG++SMANAGPNTNG+QFFICTVK
Sbjct  84   NFMIQGGDFERGDGRGGYSIYGGKFDDENFKLKHTGPGILSMANAGPNTNGAQFFICTVK  143

Query  322  TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            T WLDNRHVVFG+VI+GMD+VK IE+     GD+P   V++ D GELP
Sbjct  144  TSWLDNRHVVFGKVIDGMDIVKYIENVPKGYGDKPSSDVIVKDAGELP  191



>ref|XP_007876711.1| hypothetical protein PFL1_01020 [Pseudozyma flocculosa PF-1]
 gb|EPQ31687.1| hypothetical protein PFL1_01020 [Pseudozyma flocculosa PF-1]
Length=317

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 141/185 (76%), Gaps = 5/185 (3%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L    + A   EP  KVT++VYFD+      GK  GRIV+GLYGD VP+T ENFRAL TG
Sbjct  18   LLSFSSNASTQEP--KVTNKVYFDME---HDGKHIGRIVMGLYGDVVPKTVENFRALATG  72

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKG+G+K S+FHRVIK+FMIQGGDF  GNGTGGKSIYG  F+DENF L H GPGV+SMAN
Sbjct  73   EKGYGYKDSTFHRVIKNFMIQGGDFTNGNGTGGKSIYGNKFEDENFTLKHTGPGVLSMAN  132

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG NTNGSQFFICTVKT WLD +HVVFG+VIEGMDVV  IE+     GD+P   V I++ 
Sbjct  133  AGRNTNGSQFFICTVKTSWLDGKHVVFGKVIEGMDVVSFIENVPKGYGDKPSATVKIANS  192

Query  190  GELPI  176
            GELP+
Sbjct  193  GELPV  197



>emb|CCF54768.1| probable cyclophilin b [Ustilago hordei]
Length=209

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 142/179 (79%), Gaps = 5/179 (3%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            ++A  ++P   VT++VYFDIS  +   K  GRI +GLYG +VP+TAENFRAL TGEKGFG
Sbjct  25   SSASTSDPV--VTNKVYFDISHDS---KDVGRITLGLYGKDVPRTAENFRALATGEKGFG  79

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            +KGS FHRVI +FMIQGGDF++G+G GG SIYG  F DENF L H GPGV+SMANAGPNT
Sbjct  80   YKGSKFHRVISNFMIQGGDFERGDGRGGYSIYGGKFDDENFNLKHTGPGVLSMANAGPNT  139

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            NG+QFFICTVKT WLD+RHVVFG+V+EGMD+VK IE+     GD+P   V++ D GELP
Sbjct  140  NGAQFFICTVKTSWLDDRHVVFGRVLEGMDIVKYIENVPKGYGDKPVHDVIVKDSGELP  198



>emb|CDP90818.1| Protein Bm13780, partial [Brugia malayi]
Length=204

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 142/179 (79%), Gaps = 3/179 (2%)
 Frame = -2

Query  712  TAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  533
            T+  A+  + VT +VYFDI+IG+   K  GRI IGL+G++VP+T ENFRAL TGEKGFG+
Sbjct  17   TSNNAKEMATVTKKVYFDIAIGD---KKIGRIEIGLFGNDVPKTVENFRALATGEKGFGY  73

Query  532  kgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTN  353
            KGS FHRVIKDFMIQGGDF +G+GTGGKSIYG  F+DENFKL H G G +SMANAG +TN
Sbjct  74   KGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFEDENFKLKHYGAGWLSMANAGKDTN  133

Query  352  GSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            GSQFFI TV+T WLD RHVVFG+V+ GMDVV+ IE   T  GDRPK+ V I DCGEL +
Sbjct  134  GSQFFITTVQTTWLDGRHVVFGKVLSGMDVVRKIEQTSTHPGDRPKQSVEIVDCGELSL  192



>ref|XP_001896264.1| cyclophilin-type peptidyl-prolyl cis-trans isomerase-15, Bmcyp-5 
[Brugia malayi]
 gb|AAK91501.1| R2 [Brugia malayi]
Length=203

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 142/179 (79%), Gaps = 3/179 (2%)
 Frame = -2

Query  712  TAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  533
            T+  A+  + VT +VYFDI+IG+   K  GRI IGL+G++VP+T ENFRAL TGEKGFG+
Sbjct  16   TSNNAKEMATVTKKVYFDIAIGD---KKIGRIEIGLFGNDVPKTVENFRALATGEKGFGY  72

Query  532  kgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTN  353
            KGS FHRVIKDFMIQGGDF +G+GTGGKSIYG  F+DENFKL H G G +SMANAG +TN
Sbjct  73   KGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFEDENFKLKHYGAGWLSMANAGKDTN  132

Query  352  GSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            GSQFFI TV+T WLD RHVVFG+V+ GMDVV+ IE   T  GDRPK+ V I DCGEL +
Sbjct  133  GSQFFITTVQTTWLDGRHVVFGKVLSGMDVVRKIEQTSTHPGDRPKQSVEIVDCGELSL  191



>ref|XP_011398089.1| Peptidyl-prolyl cis-trans isomerase B [Auxenochlorella protothecoides]
 gb|KFM25198.1| Peptidyl-prolyl cis-trans isomerase B [Auxenochlorella protothecoides]
Length=223

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 131/176 (74%), Gaps = 3/176 (2%)
 Frame = -2

Query  709  AQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfk  530
            A  A  +  VT  VYFDI+IG   GK  GRI IGLYGD+VP+TAENFR L  G+    +K
Sbjct  51   AAGAGDRGPVTKTVYFDITIG---GKPEGRITIGLYGDDVPKTAENFRTLAVGKGELTYK  107

Query  529  gssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNG  350
            GS FHRVI DFMIQGGDF   NGTGGKSIYGRTF DENFK  H   G++SMANAGPNTNG
Sbjct  108  GSPFHRVIPDFMIQGGDFTNQNGTGGKSIYGRTFPDENFKFKHTKVGLLSMANAGPNTNG  167

Query  349  SQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            SQFFI T  TPWLD RHVVFG+VI+G DVVK IE   T RGD+P + V+++D GEL
Sbjct  168  SQFFITTALTPWLDGRHVVFGEVIDGYDVVKKIEGTRTSRGDKPVEPVLVADAGEL  223



>ref|XP_008777294.1| PREDICTED: peptidyl-prolyl cis-trans isomerase A1-like isoform 
X2 [Phoenix dactylifera]
Length=272

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 141/178 (79%), Gaps = 3/178 (2%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            A  +  E Q+KVT + +FD+ IG   G+  GRI++GLYG+ VP+T ENFRALCTGEKGFG
Sbjct  92   AEKEGVELQAKVTKKCFFDVEIG---GEPVGRILMGLYGEVVPRTVENFRALCTGEKGFG  148

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            +KG SFHR+IKDFMIQGGDFD GNGTGG+SIYG  F DE+F L H GPGV+SMANAGP+T
Sbjct  149  YKGCSFHRIIKDFMIQGGDFDHGNGTGGRSIYGPRFDDESFTLKHIGPGVLSMANAGPDT  208

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            NGSQFFICTVKTPWLD RHVVFG V+E MDVV+ +ESQE  R D P+    I +CG +
Sbjct  209  NGSQFFICTVKTPWLDKRHVVFGHVLERMDVVRELESQEISRSDVPRLPCRIINCGAM  266



>ref|XP_001693941.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
 gb|EDP02877.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Chlamydomonas 
reinhardtii]
Length=243

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 144/173 (83%), Gaps = 4/173 (2%)
 Frame = -2

Query  700  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  521
            A+ + KVT +VYFD+S+G   G+ AGRIV+GLYG++VP+T  NF AL TGEKGFG+KG +
Sbjct  74   ADEEPKVTQKVYFDVSVG---GQPAGRIVMGLYGEDVPKTVANFVALATGEKGFGYKGCT  130

Query  520  FHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF  341
            FHR+IK+F+IQGGDF++GNGTGG SIYGR F DE+FK++HA PGV+SMANAGPNTNGSQF
Sbjct  131  FHRIIKNFVIQGGDFERGNGTGGYSIYGRRFADESFKILHA-PGVLSMANAGPNTNGSQF  189

Query  340  FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            FI TV TPWL+ RHVVFG+V+EGMDVV  +E+   DRG RP + VVI +CG L
Sbjct  190  FITTVDTPWLNGRHVVFGRVLEGMDVVSALENTTVDRGARPTQPVVIDNCGVL  242



>gb|KHN95402.1| peptidyl-prolyl cis-trans isomerase B precursor [Metarhizium 
album ARSEF 1941]
Length=266

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 147/195 (75%), Gaps = 4/195 (2%)
 Frame = -2

Query  760  CSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQT  581
             S  +  G  L     TA+ A+   K+TS+VYFDI  G+   KA GRIVIGLYG  VP+T
Sbjct  8    VSFALLIGVGLVLFSQTAEAAKG-PKITSKVYFDIEHGD---KALGRIVIGLYGKTVPET  63

Query  580  AENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVH  401
            AENFRAL TGEKGFG++GS+FHRVIK FMIQGGDF KG+GTGGKSIYG  FKDENFKL H
Sbjct  64   AENFRALATGEKGFGYEGSTFHRVIKQFMIQGGDFTKGDGTGGKSIYGAKFKDENFKLKH  123

Query  400  AGPGVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDR  221
               G++SMANAGP+TNGSQFFI TV T WLD RHVVFG+V+EG DVV+ IES ET  GD+
Sbjct  124  TKKGLLSMANAGPDTNGSQFFITTVITSWLDGRHVVFGEVLEGYDVVEKIESVETSEGDK  183

Query  220  PKKRVVISDCGELPI  176
            P + V I+  GEL I
Sbjct  184  PLQTVKIAKSGELEI  198



>ref|XP_003058664.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57119.1| predicted protein [Micromonas pusilla CCMP1545]
Length=217

 Score =   199 bits (506),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 136/170 (80%), Gaps = 6/170 (4%)
 Frame = -2

Query  685  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVI  506
            K+T  V+FD++I    G+ AGRI +GLYG   P+TAENFRAL TGEKGFGFKGSSFHRVI
Sbjct  44   KITHTVFFDVAI---AGEPAGRIEMGLYGKTTPKTAENFRALATGEKGFGFKGSSFHRVI  100

Query  505  KDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTV  326
            KDFMIQGGDF  G+GTGGKSIYG TF DENFKL H GPG +SMANAGP+TNGSQFFICTV
Sbjct  101  KDFMIQGGDFTNGDGTGGKSIYGETFPDENFKLKHTGPGTLSMANAGPDTNGSQFFICTV  160

Query  325  KTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            KT WLD RHVVFG+V  GMDVVK IE+ +   G  PK+ V I D GE+P+
Sbjct  161  KTSWLDGRHVVFGKVTNGMDVVKAIEALD---GTPPKQEVTIVDAGEIPM  207



>ref|XP_007510149.1| peptidyl-prolyl cis-trans isomerase B [Bathycoccus prasinos]
 emb|CCO18494.1| peptidyl-prolyl cis-trans isomerase B [Bathycoccus prasinos]
Length=212

 Score =   199 bits (505),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 138/175 (79%), Gaps = 6/175 (3%)
 Frame = -2

Query  700  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  521
            A+   K+T+ VYFD+SIG   GK AGRI +GLYG  VP+T ENFRAL TGEKG+G++GS+
Sbjct  36   AKKGPKITNTVYFDVSIG---GKDAGRITMGLYGATVPKTVENFRALATGEKGYGYEGST  92

Query  520  FHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF  341
            FHRVIKDFMIQGGDF KG+GTGGKSIYG  F DENFKL H GPG +SMANAGPNTNGSQF
Sbjct  93   FHRVIKDFMIQGGDFTKGDGTGGKSIYGEKFADENFKLKHTGPGTLSMANAGPNTNGSQF  152

Query  340  FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FICTV T WLD RHVVFG+V +GMDVV+ IE+     G  P + V I+  GELP+
Sbjct  153  FICTVVTSWLDGRHVVFGRVTDGMDVVRKIEAL---NGTPPSETVTITKSGELPM  204



>gb|KEI40562.1| hypothetical protein L969DRAFT_338716 [Mixia osmundae IAM 14324]
Length=218

 Score =   199 bits (505),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 140/180 (78%), Gaps = 4/180 (2%)
 Frame = -2

Query  715  ATAQVAEPQS-KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgf  539
            AT+Q A  +  K+TS+V+FDI  G+   K  GRIVIGLYG  VP+TAENFRAL TGEKG+
Sbjct  18   ATSQTAAQKGPKITSKVFFDIKQGD---KDLGRIVIGLYGKTVPKTAENFRALATGEKGY  74

Query  538  gfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPN  359
            G++GS FHRVIK FMIQGGDF   +GTGGKSIYG  F DENFKL H GPGV+SMAN+G +
Sbjct  75   GYEGSIFHRVIKQFMIQGGDFTNFDGTGGKSIYGNKFPDENFKLRHTGPGVLSMANSGKD  134

Query  358  TNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            TNGSQFFI TV T WLD +HVVFG+VIEGMDVV  +E+   D  DRP +++VI+  GELP
Sbjct  135  TNGSQFFITTVTTSWLDGKHVVFGRVIEGMDVVTAVENTSKDGRDRPLEKIVIAKSGELP  194



>ref|XP_010556114.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=277

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 137/148 (93%), Gaps = 1/148 (1%)
 Frame = -2

Query  766  SSCSVQVKSGRPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVP  587
            SSC V  ++ R  + V+A+++VA+ QSK+T +VYFDIS+GNPVGK AGRIVIGLYGD+VP
Sbjct  56   SSCLVTSRTNRYFS-VQASSEVADVQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVP  114

Query  586  QTAENFRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKL  407
            QTAENFRALCTG+KGFG+KGS+FHRVIKDFMIQGGDF+KGNGTGGKS+YGRTFKDENFKL
Sbjct  115  QTAENFRALCTGDKGFGYKGSTFHRVIKDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKL  174

Query  406  VHAGPGVVSMANAGPNTNGSQFFICTVK  323
             H+GPGVVSMANAGPNTNGSQFFICTVK
Sbjct  175  SHSGPGVVSMANAGPNTNGSQFFICTVK  202



>ref|XP_006260964.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Alligator mississippiensis]
Length=231

 Score =   199 bits (506),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 140/170 (82%), Gaps = 3/170 (2%)
 Frame = -2

Query  685  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVI  506
            KVT++VYFD+SIG    +A GR+VIGL+G  VP+T ENF AL TGEKGFGFKGS FHRVI
Sbjct  56   KVTAKVYFDLSIGE---EAVGRVVIGLFGKTVPKTVENFVALATGEKGFGFKGSKFHRVI  112

Query  505  KDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTV  326
            KDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMANAG +TNGSQFF+ TV
Sbjct  113  KDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWVSMANAGKDTNGSQFFVTTV  172

Query  325  KTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            KTPWLD +HVVFG+V+EGMDVV+ +E+ +TD  D+P K V I+DCG + +
Sbjct  173  KTPWLDGKHVVFGKVLEGMDVVRKVENTKTDGRDKPLKDVTIADCGTIEV  222



>gb|ETN71295.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Necator 
americanus]
Length=228

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 139/193 (72%), Gaps = 23/193 (12%)
 Frame = -2

Query  682  VTSQVYFDISIGNP-----------------------VGKAAGRIVIGLYGDEVPQTAEN  572
            VT QVYFDI+IG                             AGRIVIGL+G+ VP+TAEN
Sbjct  24   VTKQVYFDITIGGKPNTPSRSKADGVLQKLFLHAFEEASFKAGRIVIGLFGNVVPKTAEN  83

Query  571  FRALCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGP  392
            F  L TG  G+G+KGS FHRVIKDFMIQGGDF +G+GTGGKSIYG  FKDENF L H GP
Sbjct  84   FLQLATGANGYGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFKDENFALQHYGP  143

Query  391  GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK  212
            G +SMANAGP+TNGSQFFICTVKTPWLD RHVVFG+V+EGM VV+ IE+ +T+ GDRP +
Sbjct  144  GWLSMANAGPDTNGSQFFICTVKTPWLDGRHVVFGKVLEGMSVVRKIENTKTNPGDRPAE  203

Query  211  RVVISDCGELPIV  173
             V ISD GELP+ 
Sbjct  204  AVEISDSGELPLA  216



>gb|EST06371.1| cyclophilin [Pseudozyma brasiliensis GHG001]
Length=206

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 138/176 (78%), Gaps = 3/176 (2%)
 Frame = -2

Query  700  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  521
            + P+  VT +VYFDIS  N   K  GRI +GLYG++VP+TAENFRAL TGEKGFG+KGS 
Sbjct  30   STPEPVVTHKVYFDISHDN---KDVGRITLGLYGNDVPRTAENFRALATGEKGFGYKGSK  86

Query  520  FHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF  341
            FHRVI +FMIQGGDF++G+G GG SIYG  F DENFKL H GPGV+SMANAG NTNG+QF
Sbjct  87   FHRVINNFMIQGGDFERGDGRGGYSIYGGKFDDENFKLKHTGPGVLSMANAGKNTNGAQF  146

Query  340  FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPIV  173
            FICTV+T WLD RHVVFG++I+GMDVVK IE+     GD+P   V+I D GEL  V
Sbjct  147  FICTVQTSWLDGRHVVFGRIIDGMDVVKYIENVPKGYGDKPVHDVIIKDSGELEKV  202



>gb|EXX53905.1| peptidylprolyl isomerase family protein CPR5 [Rhizophagus irregularis 
DAOM 197198w]
Length=208

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 134/169 (79%), Gaps = 3/169 (2%)
 Frame = -2

Query  682  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIK  503
            +T++V+FD+  G+   +  GRIVIGLYG  VP+T ENFRAL TGEKGFG+KGS FHRVIK
Sbjct  32   ITNKVFFDVKHGD---EELGRIVIGLYGKTVPKTVENFRALATGEKGFGYKGSIFHRVIK  88

Query  502  DFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK  323
            DFMIQGGDF KG+GTGGKSIYG  F DENFKL H GPGV+SMANAGP+TNGSQFFI T  
Sbjct  89   DFMIQGGDFTKGDGTGGKSIYGNKFADENFKLRHTGPGVLSMANAGPDTNGSQFFITTKA  148

Query  322  TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            T WLD RHVVFG V+EGMD+V  IE  E    DRPK+ V I DCGELPI
Sbjct  149  TSWLDERHVVFGYVLEGMDIVHKIEDVEKGPSDRPKENVTIIDCGELPI  197



>ref|XP_005829570.1| cyclophilin B [Guillardia theta CCMP2712]
 emb|CAI77920.1| cyclophilin B [Guillardia theta]
 gb|EKX42590.1| cyclophilin B [Guillardia theta CCMP2712]
Length=195

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 144/183 (79%), Gaps = 5/183 (3%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            LA V A A+   P  KVT++V+FDI+I    GK AGRIV+GLYG  VPQTAENFRAL TG
Sbjct  16   LATVGAEAKKKGP--KVTTKVFFDITID---GKDAGRIVMGLYGKSVPQTAENFRALSTG  70

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG++GS FHRVIK+FMIQGGDF +G+GTGGKSIYG  F DENFK  H   G++SMAN
Sbjct  71   EKGFGYEGSIFHRVIKNFMIQGGDFTRGDGTGGKSIYGERFADENFKFKHTKGGLLSMAN  130

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TV TPWLD +HVVFG+V+EGMD+V  IE+ +TD  D+P+K V I+  
Sbjct  131  AGKDTNGSQFFITTVPTPWLDGKHVVFGEVLEGMDLVHKIENSKTDGRDKPEKEVKIAKS  190

Query  190  GEL  182
            GEL
Sbjct  191  GEL  193



>ref|XP_006628998.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B-like [Lepisosteus 
oculatus]
Length=216

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 143/185 (77%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  + A   +   KVT++VYFDI IG+   +  GR+VIGL+G  VP+T ENF AL TG
Sbjct  26   LFPGGSVADEKKKGPKVTAKVYFDIRIGD---EDVGRVVIGLFGKTVPKTVENFIALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+K   FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG +SMAN
Sbjct  83   EKGFGYKNRKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWLSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TV+TPWLD +HVVFG+++EGMDVV+ IES +TD  D+P K V+I DC
Sbjct  143  AGKDTNGSQFFITTVQTPWLDGKHVVFGKILEGMDVVRKIESTKTDGRDKPLKDVIIHDC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIDV  207



>gb|KDB12004.1| peptidyl-prolyl cis-trans isomerase B precursor [Ustilaginoidea 
virens]
Length=269

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 143/180 (79%), Gaps = 5/180 (3%)
 Frame = -2

Query  709  AQVAEPQS--KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            +Q AE     ++TS+VYFDI IG   GK AGRIV+GLYG  VP+TAENFRAL TGEKG+G
Sbjct  23   SQTAEAAKGPRITSKVYFDIEIG---GKPAGRIVMGLYGKTVPETAENFRALATGEKGYG  79

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            ++GS FHRVIKDFMIQGGDF KG+GTGGKSIYG  FKDENFKL H   G++SMANAGP+T
Sbjct  80   YEGSMFHRVIKDFMIQGGDFTKGDGTGGKSIYGEKFKDENFKLKHTMKGLLSMANAGPDT  139

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            NGSQFFI TV T WLD RHVVFGQV+EG  +V++IE+ +T  GD+P++ V I   GEL +
Sbjct  140  NGSQFFITTVVTSWLDGRHVVFGQVLEGYSIVEMIENVKTLAGDKPEEAVKIVKSGELEV  199



>dbj|GAK62917.1| peptidyl-prolyl cis-trans isomerase B [Pseudozyma antarctica]
Length=301

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 140/177 (79%), Gaps = 5/177 (3%)
 Frame = -2

Query  709  AQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfk  530
            A  +EP   VT +VYFDI+     GK  GRI +GL+G++VP+TAENFRAL TGEKGFG+K
Sbjct  20   ASSSEPV--VTHKVYFDIA---HDGKDVGRITLGLFGNDVPKTAENFRALATGEKGFGYK  74

Query  529  gssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNG  350
            GS FHRVI +FMIQGGDF++G+G GG SIYG  F DENFKL H GPG++SMANAGPNTNG
Sbjct  75   GSKFHRVIANFMIQGGDFERGDGRGGYSIYGGKFDDENFKLKHTGPGILSMANAGPNTNG  134

Query  349  SQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            +QFFICTVKT WLDN HVVFG+VI+GMD+VK IE+     GD+P   V++ D GELP
Sbjct  135  AQFFICTVKTSWLDNVHVVFGKVIDGMDIVKYIENVPKGYGDKPSSDVIVKDAGELP  191



>ref|XP_009829338.1| peptidyl-prolyl cis-trans isomerase [Aphanomyces astaci]
 gb|ETV81480.1| peptidyl-prolyl cis-trans isomerase [Aphanomyces astaci]
Length=202

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 130/181 (72%), Gaps = 11/181 (6%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs  524
            VA    K+T QVYFDISIG   G  AGRIV+GLYG  VP+T ENFRALCTGEKG G  G 
Sbjct  17   VAAAGPKITHQVYFDISIG---GHNAGRIVMGLYGKSVPKTVENFRALCTGEKGLGKTGK  73

Query  523  sF-------HRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAG  365
            +        HR+I DFMIQGGDF  G GTGG+SIYG  F+DENFKL H GPG +SMANAG
Sbjct  74   ALWYKDSTFHRIIPDFMIQGGDFTHGTGTGGESIYGEKFEDENFKLKHEGPGTLSMANAG  133

Query  364  PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE  185
            PNTNGSQFFICTVKT WLD RHVVFG+VI G+DVVK +ES     G  P + V I   GE
Sbjct  134  PNTNGSQFFICTVKTSWLDGRHVVFGRVISGLDVVKAVESVGAGSG-TPSQTVTIKASGE  192

Query  184  L  182
            L
Sbjct  193  L  193



>ref|XP_011386997.1| putative cyclophilin b [Ustilago maydis 521]
 gb|KIS71107.1| putative cyclophilin b [Ustilago maydis 521]
Length=210

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 138/180 (77%), Gaps = 5/180 (3%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            +TA   +P   +T +VYFDIS  N   K  GRIV+GLYG +VP+TAENFRAL TGEKGFG
Sbjct  26   STASTTDPT--ITHKVYFDISHNN---KDIGRIVVGLYGKDVPRTAENFRALATGEKGFG  80

Query  535  fkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNT  356
            +KGS FHRVI  FMIQGGDF++G+G GG SIYG  F DENFK  H GPG+VSMANAG NT
Sbjct  81   YKGSKFHRVISSFMIQGGDFERGDGRGGYSIYGGKFDDENFKFKHTGPGIVSMANAGRNT  140

Query  355  NGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            NG+QFFICTVKT  LD RHVVFG+V++GMDVVK IE   T  GD+P   V++ D GELP+
Sbjct  141  NGAQFFICTVKTSHLDGRHVVFGRVLDGMDVVKYIEKVPTGYGDKPVHDVLVKDSGELPV  200



>ref|XP_005142557.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Melopsittacus 
undulatus]
Length=223

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = -2

Query  685  KVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVI  506
            KVT++V+FD+ IG    + AGR+VIGL+G  VP+T ENF AL TGEKGFGFKGS FHRVI
Sbjct  48   KVTAKVFFDLRIGE---EDAGRVVIGLFGKTVPKTVENFVALATGEKGFGFKGSKFHRVI  104

Query  505  KDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTV  326
            KDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMANAG +TNGSQFFI TV
Sbjct  105  KDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTV  164

Query  325  KTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            KTPWLD +HVVFG+V+EGMDVV+ +ES +TD  D+P K V I+DCG + +
Sbjct  165  KTPWLDGKHVVFGKVLEGMDVVRKVESTKTDSRDKPLKDVTIADCGTIEV  214



>ref|XP_004716344.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Echinops telfairi]
Length=216

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 143/185 (77%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  + A   +   KVT +VYFD+ +G+   + AGR+VIGL+G  VP+T +NF AL TG
Sbjct  26   LLPGSSVADEKKKGPKVTVKVYFDLRVGD---EDAGRVVIGLFGKTVPKTVDNFVALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMAN
Sbjct  83   EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +ES +TD  D+P K V I+DC
Sbjct  143  AGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVESTKTDGRDKPLKDVTIADC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIEV  207



>ref|XP_007235156.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Astyanax mexicanus]
Length=216

 Score =   197 bits (502),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 145/185 (78%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  + A   +   KVT++VYFDI IG+   +  GRIVIGL+G  VP+TAENF AL TG
Sbjct  26   LFPNGSDADEKKKGPKVTAKVYFDIRIGD---EDVGRIVIGLFGKTVPKTAENFLALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+KGS FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG +SMAN
Sbjct  83   EKGFGYKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWLSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TV+TPWLD +HVVFG+++EGMDVV+ IE+ +TD  D+P K V I +C
Sbjct  143  AGKDTNGSQFFITTVQTPWLDGKHVVFGKILEGMDVVRKIEATKTDGRDKPLKDVTIHEC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIEV  207



>ref|XP_004500254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like [Cicer 
arietinum]
Length=204

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 142/192 (74%), Gaps = 12/192 (6%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            LA ++A  +  E   +VT +VYFD+ I    GKAAGR+VIGLYG  VP+TAENFRALCTG
Sbjct  18   LALIQA-KKSKEDLKEVTHKVYFDVEID---GKAAGRVVIGLYGKTVPKTAENFRALCTG  73

Query  550  Ekgfgf-------kgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGP  392
            EKG G        KGSSFHR+I  FMIQGGDF  GNG GG+SIYG  F DENFKL H GP
Sbjct  74   EKGTGKNGKPLHYKGSSFHRIIPSFMIQGGDFTHGNGMGGESIYGEKFADENFKLKHTGP  133

Query  391  GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK  212
            G++SMANAGP+TNGSQFFI TV T WLD RHVVFG+V+ GMDVV  IE++    G  PK 
Sbjct  134  GLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGNQSG-TPKS  192

Query  211  RVVISDCGELPI  176
            +VVI+D GELP+
Sbjct  193  KVVIADSGELPL  204



>ref|XP_001626713.1| predicted protein [Nematostella vectensis]
 gb|EDO34613.1| predicted protein [Nematostella vectensis]
Length=203

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 3/169 (2%)
 Frame = -2

Query  682  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIK  503
            VT +V+FDI+IG   G+ AGRI IGL+G  VP+TAENF  L TGEKGFG+K S FHRVI+
Sbjct  25   VTKKVFFDITIG---GEKAGRIEIGLFGKAVPKTAENFFQLATGEKGFGYKNSIFHRVIQ  81

Query  502  DFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK  323
            DFMIQGGDF KG+GTGGKSIYG+ F DENFKL H G G +SMANAG +TNGSQFFI TVK
Sbjct  82   DFMIQGGDFTKGDGTGGKSIYGQKFADENFKLQHYGAGWLSMANAGKDTNGSQFFITTVK  141

Query  322  TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            TPWLD RHVVFG+V++GMDVV+ IE  +TD GDRP K V ++D G L +
Sbjct  142  TPWLDGRHVVFGKVLKGMDVVRKIEKSKTDHGDRPVKEVKVADSGSLTV  190



>gb|EFO27785.2| cyclophilin-type peptidyl-prolyl cis-trans isomerase-15 [Loa 
loa]
Length=203

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 139/175 (79%), Gaps = 3/175 (2%)
 Frame = -2

Query  700  AEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgss  521
            A+    VT +VYFDI+IG   G+  GRI IGL+G++VP+T ENFRAL TGEKGFG+KGS 
Sbjct  20   AKETVTVTKKVYFDIAIG---GEKVGRIEIGLFGNDVPKTTENFRALATGEKGFGYKGSK  76

Query  520  FHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF  341
            FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H G G +SMANAG +TNGSQF
Sbjct  77   FHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFDDENFKLKHYGAGWLSMANAGKDTNGSQF  136

Query  340  FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FI TV+T WLD RHVVFG+V+ GMDVV+ IE   T  GDRP++ V I DCGELP+
Sbjct  137  FITTVQTTWLDGRHVVFGKVLGGMDVVRKIEHTATHPGDRPQQDVEIIDCGELPL  191



>ref|XP_002508058.1| peptidylprolyl isomerase, precursor [Micromonas sp. RCC299]
 gb|ACO69316.1| peptidylprolyl isomerase, precursor [Micromonas sp. RCC299]
Length=208

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 142/190 (75%), Gaps = 10/190 (5%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSK----VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRA  563
            LA +   A VAE + K    +T +VYFDI+I    G+ AGRI +GLYG  VP+TAENFRA
Sbjct  15   LAVLFLAAGVAEAKKKKGPKITHKVYFDITI---AGEPAGRIEMGLYGKTVPKTAENFRA  71

Query  562  LCTGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVV  383
            L TGEKGFG+KGS FHRVIKDFMIQGGDF  G+GTGGKSIYG  F DENFKL H+GPG +
Sbjct  72   LATGEKGFGYKGSKFHRVIKDFMIQGGDFTNGDGTGGKSIYGEKFADENFKLKHSGPGTL  131

Query  382  SMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVV  203
            SMANAGP+TNGSQFFICTVKT WLD RHVVFG+V  GMDVV+ IE      G  P   V+
Sbjct  132  SMANAGPDTNGSQFFICTVKTSWLDGRHVVFGKVTAGMDVVRKIEEL---NGTPPTDEVL  188

Query  202  ISDCGELPIV  173
            I+D GE+ + 
Sbjct  189  IADSGEIDMA  198



>ref|XP_007166051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Balaenoptera 
acutorostrata scammoni]
Length=216

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 143/185 (77%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  + A   +   KVT++VYFD+ IG+   +  GR+VIGL+G  VP+T +NF AL TG
Sbjct  26   LLPGPSAADEKKKGPKVTAKVYFDLRIGD---EDIGRVVIGLFGKTVPKTVDNFVALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMAN
Sbjct  83   EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +ES +TD  DRP K V I+DC
Sbjct  143  AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMDVVRKVESTKTDGRDRPLKDVTIADC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIEV  207



>ref|XP_006899681.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Elephantulus 
edwardii]
Length=216

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 144/185 (78%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  +TA   +   KVT +V+FD+ IG+   +  GR+VIGL+G  VP+T +NF AL TG
Sbjct  26   LLPGPSTADEKKKGPKVTVKVFFDLRIGD---EDVGRVVIGLFGKTVPKTVDNFVALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMAN
Sbjct  83   EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +ES +TD  D+P K V+I+DC
Sbjct  143  AGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVESTKTDSRDKPLKDVIIADC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIEV  207



>ref|XP_571865.1| cyclophilin [Cryptococcus neoformans var. neoformans JEC21]
 ref|XP_774392.1| hypothetical protein CNBG3730 [Cryptococcus neoformans var. neoformans 
B-3501A]
 sp|P0CP79.1|PPIB_CRYNB RecName: Full=Peptidyl-prolyl cis-trans isomerase B; Short=PPIase 
B; AltName: Full=Rotamase B; Flags: Precursor [Cryptococcus 
neoformans var. neoformans B-3501A]
 sp|P0CP78.1|PPIB_CRYNJ RecName: Full=Peptidyl-prolyl cis-trans isomerase B; Short=PPIase 
B; AltName: Full=Rotamase B; Flags: Precursor [Cryptococcus 
neoformans var. neoformans JEC21]
 gb|EAL19745.1| hypothetical protein CNBG3730 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW44558.1| cyclophilin, putative [Cryptococcus neoformans var. neoformans 
JEC21]
Length=231

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 140/175 (80%), Gaps = 9/175 (5%)
 Frame = -2

Query  682  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG------Ekgfgfkgss  521
            +T++VYFDI  G   GK  GRIV+GLYG  VP+TAENFRAL TG      + G+G++GSS
Sbjct  43   ITNKVYFDIEHG---GKPLGRIVMGLYGKTVPKTAENFRALATGKNSDGEDLGYGYEGSS  99

Query  520  FHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF  341
            FHR+IK+FMIQGGDF KG+GTGGKSIYG  F DENFKL H GPGV+SMANAG +TNGSQF
Sbjct  100  FHRIIKNFMIQGGDFTKGDGTGGKSIYGSKFPDENFKLKHTGPGVLSMANAGRDTNGSQF  159

Query  340  FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FICTVKT WLDNRHVVFG V+EGMDVV  +E+ +T RGD+P + + I+  GELPI
Sbjct  160  FICTVKTAWLDNRHVVFGHVLEGMDVVYAMENVKTSRGDKPVEPITIAASGELPI  214



>gb|ACU15989.1| unknown [Glycine max]
Length=243

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = -2

Query  736  RPLAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALC  557
            R +    A   V + Q+KVT++ +FD+ IG   G+ AGR+V GL+G++VP+T ENFRALC
Sbjct  78   RRMTCTNAKENVLQLQAKVTNKCFFDVEIG---GEPAGRVVFGLFGEDVPKTVENFRALC  134

Query  556  TGEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
            TGEKG+G+KGS FHR+I++FM+QGGDF +GNGTGG SIYG +F DENF L H GPGV+SM
Sbjct  135  TGEKGYGYKGSYFHRIIQNFMVQGGDFTEGNGTGGISIYGDSFDDENFNLKHVGPGVLSM  194

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQE  239
            ANAG NTNGSQFFICTV+TPWLDNRHVVFG VI+GMDVV+ +ESQ 
Sbjct  195  ANAGTNTNGSQFFICTVQTPWLDNRHVVFGHVIDGMDVVRTLESQR  240



>ref|NP_001236075.1| uncharacterized protein LOC100305485 precursor [Glycine max]
 gb|ACU13170.1| unknown [Glycine max]
 gb|KHN06231.1| Peptidyl-prolyl cis-trans isomerase CYP19-4 [Glycine soja]
Length=204

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 135/181 (75%), Gaps = 11/181 (6%)
 Frame = -2

Query  697  EPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg---  527
            E   +VT +VYFD+ I    GK AGRIV+GLYG  VP+TAENFRALCTGEKG G  G   
Sbjct  28   EDLKEVTHKVYFDVEIN---GKEAGRIVMGLYGKAVPKTAENFRALCTGEKGTGKSGKPL  84

Query  526  ----ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPN  359
                SSFHR+I  FM+QGGDF +GNG GG+SIYG  F DENFKL H GPG++SMANAGPN
Sbjct  85   HYKGSSFHRIIPSFMLQGGDFTQGNGMGGESIYGEKFADENFKLKHTGPGLLSMANAGPN  144

Query  358  TNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELP  179
            TNGSQFFI TV T WLD RHVVFG+V+ GMDVV  IE++ T  G  PK +VVI D GELP
Sbjct  145  TNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKIEAEGTQSG-TPKSKVVIVDSGELP  203

Query  178  I  176
            +
Sbjct  204  L  204



>gb|KGB76290.1| peptidyl-prolyl cis-trans isomerase B [Cryptococcus gattii R265]
 gb|KIR28231.1| peptidyl-prolyl cis-trans isomerase B [Cryptococcus gattii LA55]
 gb|KIR33470.1| peptidyl-prolyl cis-trans isomerase B [Cryptococcus gattii MMRL2647]
 gb|KIR41787.1| peptidyl-prolyl cis-trans isomerase B [Cryptococcus gattii Ram5]
 gb|KIR73389.1| peptidyl-prolyl cis-trans isomerase B [Cryptococcus gattii CA1014]
 gb|KIR91724.1| peptidyl-prolyl cis-trans isomerase B [Cryptococcus gattii CBS 
10090]
 gb|KIR99144.1| peptidyl-prolyl cis-trans isomerase B [Cryptococcus gattii 2001/935-1]
 gb|KIY60099.1| peptidyl-prolyl cis-trans isomerase B [Cryptococcus gattii 99/473]
Length=221

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 140/175 (80%), Gaps = 9/175 (5%)
 Frame = -2

Query  682  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG------Ekgfgfkgss  521
            +T++VYFDI  G   GK  GRIV+GLYG  VP+TAENFRAL TG      + G+G++GSS
Sbjct  33   ITNKVYFDIEHG---GKPLGRIVMGLYGKTVPKTAENFRALATGKNSDGEDLGYGYEGSS  89

Query  520  FHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQF  341
            FHR+IK+FMIQGGDF KG+GTGGKSIYG  F DENFKL H GPGV+SMANAG +TNGSQF
Sbjct  90   FHRIIKNFMIQGGDFTKGDGTGGKSIYGGKFPDENFKLKHTGPGVLSMANAGRDTNGSQF  149

Query  340  FICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            FICTVKT WLDNRHVVFG V+EGMD+V  +E+ +T RGD+P + V I+  GELPI
Sbjct  150  FICTVKTSWLDNRHVVFGHVLEGMDIVYAMENVKTSRGDKPVEPVTIAASGELPI  204



>ref|XP_001366685.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Monodelphis 
domestica]
Length=216

 Score =   197 bits (500),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 142/185 (77%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  + A   +   KVT++VYFD+ IG    + AGRIVIGL+G   P+T ENF  L TG
Sbjct  26   LLPGFSVADEKKKGPKVTTKVYFDLQIGE---ENAGRIVIGLFGKTTPKTVENFVVLTTG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFGFKGS FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMAN
Sbjct  83   EKGFGFKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWVSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TVKTPWLD +HVVFG+V+EGMDVV+ +E+ +TD  D+P K V I+DC
Sbjct  143  AGKDTNGSQFFITTVKTPWLDGKHVVFGKVLEGMDVVRKVENTKTDGRDKPLKDVTIADC  202

Query  190  GELPI  176
            G + +
Sbjct  203  GTIEV  207



>gb|AIG55930.1| secreted protein [Achlya hypogyna]
Length=205

 Score =   196 bits (499),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 138/190 (73%), Gaps = 11/190 (6%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            +A +  +   A    K+T+QVYFDI IGN   + AGRIV+GLYG   P+T ENFRALCTG
Sbjct  11   VALLFVSMAAAAKSPKITNQVYFDIKIGN---RDAGRIVMGLYGKTTPKTVENFRALCTG  67

Query  550  Ekgfgfkg-------ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGP  392
            EKG G KG       S+FHR+I DFMIQGGDF  G GTGG+SIYG  F DENFKL H GP
Sbjct  68   EKGTGTKGKPLWYKDSAFHRIIPDFMIQGGDFTHGTGTGGESIYGDRFDDENFKLKHEGP  127

Query  391  GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK  212
            G +SMANAGPN+NGSQFFICTVKT WLD RHVVFG+VI GMDVVK +E   +  G  P +
Sbjct  128  GTLSMANAGPNSNGSQFFICTVKTSWLDGRHVVFGRVISGMDVVKAVEKVGSGSG-TPSE  186

Query  211  RVVISDCGEL  182
            RV I++ GEL
Sbjct  187  RVTIANSGEL  196



>ref|XP_780268.2| PREDICTED: peptidyl-prolyl cis-trans isomerase B-like isoform 
1 [Strongylocentrotus purpuratus]
Length=217

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 145/186 (78%), Gaps = 4/186 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSK-VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCT  554
            L P  A A+ A  ++  VT +V+FDI+IG+   +  GRIVIGL+G  VP+TA+NF  L T
Sbjct  24   LMPADAEAKEATKKNALVTDKVFFDITIGD---EKTGRIVIGLFGQTVPKTAKNFIGLAT  80

Query  553  GEkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMA  374
            GEKGFG+KGS FHRVIKDFMIQGGDF KG+GTGGKSIYG  FKDENFKL H G G +SMA
Sbjct  81   GEKGFGYKGSKFHRVIKDFMIQGGDFTKGDGTGGKSIYGDKFKDENFKLSHYGAGWLSMA  140

Query  373  NAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISD  194
            NAG +TNGSQFF+ T+KT WLD +HVVFG+V+EGMDVV+ IES +T R D+P K VVI+D
Sbjct  141  NAGKDTNGSQFFLTTIKTSWLDGKHVVFGKVLEGMDVVRKIESTKTGRNDKPAKDVVIAD  200

Query  193  CGELPI  176
             G + +
Sbjct  201  SGTIEV  206



>ref|XP_002597710.1| hypothetical protein BRAFLDRAFT_279769 [Branchiostoma floridae]
 gb|EEN53722.1| hypothetical protein BRAFLDRAFT_279769 [Branchiostoma floridae]
Length=208

 Score =   196 bits (499),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = -2

Query  712  TAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgf  533
            T Q A  +  VT +VYFDI IG   G+ AGR+V+GL+GD  P+TA NF  L T EKGFG+
Sbjct  27   TLQAAGTERLVTKKVYFDIEIG---GEKAGRVVMGLFGDITPKTAANFEQLTTHEKGFGY  83

Query  532  kgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTN  353
            KGS+FHRVIK FMIQGGDF +G+GTGGKSIYG  F DENF L H  PG++SMANAGPNTN
Sbjct  84   KGSAFHRVIKKFMIQGGDFTRGDGTGGKSIYGNKFPDENFMLSHTEPGLLSMANAGPNTN  143

Query  352  GSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            GSQFFI TV TPWL+ RHVVFG+V+EGMDVV  +E+   DR DRPKK  VI+DCG L +
Sbjct  144  GSQFFITTVPTPWLNGRHVVFGKVLEGMDVVTRVENSAVDRRDRPKKACVIADCGTLEL  202



>gb|AFK44786.1| unknown [Lotus japonicus]
Length=204

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 143/192 (74%), Gaps = 12/192 (6%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            LAP++A  +  E   +VT +V+FD+ I    GKAAGRIV+GLYG  VP+TAENFRALCTG
Sbjct  18   LAPIQA-KKSKEDLKEVTHKVFFDVEID---GKAAGRIVMGLYGKTVPKTAENFRALCTG  73

Query  550  Ekgfgfkg-------ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGP  392
            EKG G  G       SSFHR+I  FMIQGGDF +GNG GG+SIYG  F DENFKL H GP
Sbjct  74   EKGIGKSGKPLHFKGSSFHRIIPSFMIQGGDFTQGNGMGGESIYGEKFPDENFKLKHTGP  133

Query  391  GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK  212
            G++SMANAGP+TNGSQFFI TV T WLD RHVVFG+V+ GMDVV  +E++    G  PK 
Sbjct  134  GLLSMANAGPDTNGSQFFITTVTTSWLDGRHVVFGKVLSGMDVVYKMEAEGNQSG-TPKS  192

Query  211  RVVISDCGELPI  176
            +VVI+D GELP+
Sbjct  193  KVVIADSGELPL  204



>ref|XP_006920335.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Pteropus alecto]
 ref|XP_011361654.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Pteropus vampyrus]
 gb|ELK05343.1| Peptidyl-prolyl cis-trans isomerase B [Pteropus alecto]
Length=216

 Score =   196 bits (499),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 144/185 (78%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  +TA   +   KVT +VYFD+ IG+   +  GR+VIGL+G  VP+T +NF AL TG
Sbjct  26   LLPGPSTADEKKKGPKVTVKVYFDLRIGD---EDIGRVVIGLFGKTVPKTVDNFVALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMAN
Sbjct  83   EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TVKT WLD +HVVFG+V+EGM+VV+ +ES +TD  D+P K VVI+DC
Sbjct  143  AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDGRDKPLKDVVIADC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIEV  207



>ref|XP_005347803.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Microtus ochrogaster]
Length=216

 Score =   196 bits (499),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 142/185 (77%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  + A   +   KVT QVYFD+ IG+   +  GR+V GL+G  VP+T +NF AL TG
Sbjct  26   LLPGPSVANDKKKGPKVTVQVYFDLQIGD---EPVGRVVFGLFGKTVPKTVDNFVALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMAN
Sbjct  83   EKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +ES +TD  D+P K V+I+DC
Sbjct  143  AGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVESTKTDSRDKPLKDVIIADC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIEV  207



>ref|XP_001782168.1| predicted protein [Physcomitrella patens]
 gb|EDQ52991.1| predicted protein [Physcomitrella patens]
Length=198

 Score =   196 bits (497),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 140/187 (75%), Gaps = 11/187 (6%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            A A++ +   +VT +V+FD+ IG   G+ AGR+V+GL+G   P+T ENFRALCTGEKG G
Sbjct  16   AQAKIEKGLDEVTHKVFFDVEIG---GQPAGRVVMGLFGKAAPKTVENFRALCTGEKGKG  72

Query  535  fkg-------ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
              G       S+FHR+I  FMIQGGDF  GNG GG+SIYG  F DE+FKL H GPG++SM
Sbjct  73   LSGKPLHFKGSAFHRIIPSFMIQGGDFTHGNGRGGESIYGEKFADESFKLKHTGPGILSM  132

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            ANAGPNTNGSQFFICTVKT WLD RHVVFG+V+ GMDVV  +E++ T  G  PKK+V I+
Sbjct  133  ANAGPNTNGSQFFICTVKTSWLDGRHVVFGKVLSGMDVVYKVEAEGTS-GGTPKKKVTIA  191

Query  196  DCGELPI  176
            D GE+P+
Sbjct  192  DSGEIPL  198



>emb|CEP19173.1| hypothetical protein [Parasitella parasitica]
Length=204

 Score =   196 bits (497),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 3/169 (2%)
 Frame = -2

Query  682  VTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIK  503
            +T +VYFDI  G+   +  GRIVIGLYG  VP+T ENF+AL TGEKGFG+KGS+FHRVIK
Sbjct  31   ITDKVYFDIKQGD---EELGRIVIGLYGKTVPKTTENFKALATGEKGFGYKGSTFHRVIK  87

Query  502  DFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVK  323
            DFMIQGGDF  G+GTGGKSIYG  F DENFKL H GPGV+SMANAGPN+NGSQFFI TVK
Sbjct  88   DFMIQGGDFTNGDGTGGKSIYGDKFADENFKLRHTGPGVLSMANAGPNSNGSQFFITTVK  147

Query  322  TPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            T WLD +HVVFG+V+EGMDVV  IE  E    D+PK+ ++I+D G LP+
Sbjct  148  TSWLDGKHVVFGKVLEGMDVVFKIEKCEKGFRDKPKEDIIIADSGALPV  196



>ref|XP_004315275.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Tursiops truncatus]
Length=216

 Score =   196 bits (498),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 142/185 (77%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  + A   +   KVT +VYFD+ IG+   +  GR+VIGL+G  VP+T +NF AL TG
Sbjct  26   LLPGPSAADEKKKGPKVTVKVYFDLRIGD---EDIGRVVIGLFGKTVPKTVDNFVALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMAN
Sbjct  83   EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +ES +TD  DRP K V I+DC
Sbjct  143  AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMDVVRKVESTKTDGRDRPLKDVTIADC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIEV  207



>ref|XP_005281008.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Chrysemys picta 
bellii]
Length=224

 Score =   196 bits (499),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 143/183 (78%), Gaps = 3/183 (2%)
 Frame = -2

Query  724  PVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEk  545
            P  + A+  +   KVT++VYFD+ IG+   +  GR+V GL+G  VP+T ENF AL TGEK
Sbjct  36   PAASRAEERKKGPKVTAKVYFDLRIGD---EDVGRVVFGLFGKTVPKTVENFVALATGEK  92

Query  544  gfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAG  365
            GFGFKGS FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMANAG
Sbjct  93   GFGFKGSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGDRFPDENFKLKHYGPGWVSMANAG  152

Query  364  PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE  185
             +TNGSQFFI TVKTPWLD +HVVFG+++EGMDVV+ +E+ +TD  D+P K V I+DCG 
Sbjct  153  KDTNGSQFFITTVKTPWLDGKHVVFGKILEGMDVVRKVENTKTDSRDKPLKDVTIADCGT  212

Query  184  LPI  176
            + +
Sbjct  213  IEV  215



>emb|CDR39798.1| RHTO0S04e09670g2_1 [Rhodosporidium toruloides]
Length=203

 Score =   196 bits (497),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 141/185 (76%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L  V A   +A     +T++VYFD+  G   GK  GRIV+GL+G  VP+T ENFR L TG
Sbjct  12   LLAVFANVALAAKGPVITNKVYFDVEHG---GKPMGRIVMGLFGKTVPKTTENFRQLATG  68

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            E GFG++GS FHRVIK+FMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG++SMAN
Sbjct  69   EAGFGYEGSHFHRVIKNFMIQGGDFTRGDGTGGKSIYGDRFADENFKLRHTGPGLLSMAN  128

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGP+TNGSQFFI TV+T WL+NRHVVFG+V+EGMD+V  IE+     GD+PK++V I   
Sbjct  129  AGPDTNGSQFFITTVETSWLNNRHVVFGKVLEGMDIVYAIENVPKGHGDKPKEQVKIVKS  188

Query  190  GELPI  176
            GELP+
Sbjct  189  GELPV  193



>gb|ETN78289.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Necator 
americanus]
Length=171

 Score =   194 bits (494),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 134/171 (78%), Gaps = 11/171 (6%)
 Frame = -2

Query  673  QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs-------sFH  515
            QV+FDI+IG   GKA+GRIV+ LY D VP+TAENFRALCTGEKG G  G         FH
Sbjct  5    QVFFDITIG---GKASGRIVMELYSDIVPKTAENFRALCTGEKGMGKSGKPLHFKGCKFH  61

Query  514  RVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI  335
            R+I +FMIQGGDF +GNGTGG+SIYG  F DENFK  H GPGV+SMANAGPNTNGSQFF+
Sbjct  62   RIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKERHTGPGVLSMANAGPNTNGSQFFL  121

Query  334  CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            CTVKT WLD +HVVFG+VIEGMDVVK IES  +  G +P K  VI+DCG+L
Sbjct  122  CTVKTEWLDGKHVVFGRVIEGMDVVKTIESHGSQSG-KPSKDCVIADCGQL  171



>ref|XP_007450762.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Lipotes vexillifer]
Length=216

 Score =   196 bits (498),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 142/185 (77%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  + A   +   KVT +VYFD+ IG+   +  GR+VIGL+G  VP+T +NF AL TG
Sbjct  26   LLPGPSAADEKKKGPKVTVKVYFDLRIGD---EDIGRVVIGLFGKTVPKTVDNFVALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMAN
Sbjct  83   EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +ES +TD  DRP K V I+DC
Sbjct  143  AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMDVVRKVESTKTDGRDRPLKDVTIADC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIEV  207



>gb|KDN44958.1| hypothetical protein K437DRAFT_256824 [Tilletiaria anomala UBC 
951]
Length=205

 Score =   196 bits (497),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            LA +  T   A P   VT +VYFDI  G+   K  GRIV+GLYG  VP+T ENFRAL TG
Sbjct  15   LAVLSGTETRANPD--VTHKVYFDIKHGD---KDVGRIVMGLYGKVVPKTTENFRALATG  69

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG++GS+FHRVI +FMIQGGDF  G+G GGKSIYG  F+DENF L H GPG +SMAN
Sbjct  70   EKGFGYQGSAFHRVIANFMIQGGDFTSGDGRGGKSIYGPRFEDENFDLKHEGPGTLSMAN  129

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGP TNGSQFF+CTVKT WLD RHVVFG+V+EGMDVV  IE   T   DRPK++V+I   
Sbjct  130  AGPGTNGSQFFLCTVKTSWLDGRHVVFGRVLEGMDVVSYIEKVPTGPQDRPKEKVLIVKS  189

Query  190  GELP  179
            GELP
Sbjct  190  GELP  193



>ref|XP_007120755.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Physeter catodon]
Length=216

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 142/185 (77%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  + A   +   KVT +VYFD+ IG+   +  GR+VIGL+G  VP+T +NF AL TG
Sbjct  26   LLPGPSAADEKKKGPKVTVKVYFDLRIGD---EDIGRVVIGLFGKTVPKTVDNFVALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMAN
Sbjct  83   EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +ES +TD  DRP K V I+DC
Sbjct  143  AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMDVVRKVESTKTDGRDRPLKDVTIADC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIEV  207



>gb|EMS19251.1| peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [Rhodosporidium 
toruloides NP11]
 emb|CDR39797.1| RHTO0S04e09670g1_1 [Rhodosporidium toruloides]
Length=210

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 141/185 (76%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L  V A   +A     +T++VYFD+  G   GK  GRIV+GL+G  VP+T ENFR L TG
Sbjct  12   LLAVFANVALAAKGPVITNKVYFDVEHG---GKPMGRIVMGLFGKTVPKTTENFRQLATG  68

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            E GFG++GS FHRVIK+FMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG++SMAN
Sbjct  69   EAGFGYEGSHFHRVIKNFMIQGGDFTRGDGTGGKSIYGDRFADENFKLRHTGPGLLSMAN  128

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AGP+TNGSQFFI TV+T WL+NRHVVFG+V+EGMD+V  IE+     GD+PK++V I   
Sbjct  129  AGPDTNGSQFFITTVETSWLNNRHVVFGKVLEGMDIVYAIENVPKGHGDKPKEQVKIVKS  188

Query  190  GELPI  176
            GELP+
Sbjct  189  GELPV  193



>emb|CDJ82690.1| Peptidyl-prolyl cis-trans isomerase domain containing protein 
[Haemonchus contortus]
Length=171

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 134/171 (78%), Gaps = 11/171 (6%)
 Frame = -2

Query  673  QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs-------sFH  515
            QV+FDI+IG   GKA+GRIV+ LY D VP+TAENFRALCTGEKG G  G         FH
Sbjct  5    QVFFDITIG---GKASGRIVMELYSDIVPKTAENFRALCTGEKGMGKSGKPLHYKGCKFH  61

Query  514  RVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI  335
            R+I +FMIQGGDF +GNGTGG+SIYG  F DENFK  H GPGV+SMANAGPNTNGSQFF+
Sbjct  62   RIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKERHTGPGVLSMANAGPNTNGSQFFL  121

Query  334  CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            CTVKT WLD +HVVFG+V EGMDVVKL+ES  +  G +P K  VI+DCG+L
Sbjct  122  CTVKTEWLDGKHVVFGRVTEGMDVVKLVESHGSQSG-KPSKDCVIADCGQL  171



>gb|KHJ92301.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type [Oesophagostomum 
dentatum]
Length=196

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 134/171 (78%), Gaps = 11/171 (6%)
 Frame = -2

Query  673  QVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgs-------sFH  515
            QV+FDI+IG   GKA+GRIV+ LY D VP+TAENFRALCTGEKG G  G         FH
Sbjct  30   QVFFDITIG---GKASGRIVMELYSDIVPKTAENFRALCTGEKGMGKSGKPLHFKGCKFH  86

Query  514  RVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFI  335
            R+I +FMIQGGDF +GNGTGG+SIYG  F DENFK  H GPGV+SMANAGPNTNGSQFF+
Sbjct  87   RIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKERHTGPGVLSMANAGPNTNGSQFFL  146

Query  334  CTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGEL  182
            CTVKT WLD +HVVFG+VIEGMDVVK IES  +  G +P K  VI+DCG+L
Sbjct  147  CTVKTEWLDGKHVVFGRVIEGMDVVKAIESHGSQSG-KPSKDCVIADCGQL  196



>ref|XP_006093465.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Myotis lucifugus]
 ref|XP_006770848.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Myotis davidii]
 ref|XP_008137359.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Eptesicus fuscus]
 gb|ELK24875.1| Peptidyl-prolyl cis-trans isomerase B [Myotis davidii]
Length=216

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 144/185 (78%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  +TA   +   KVT +VYFD+ IG+   +  GR+VIGL+G  VP+T +NF AL TG
Sbjct  26   LLPGPSTADEKKKGPKVTVKVYFDLRIGD---EDIGRVVIGLFGKTVPKTVDNFVALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMAN
Sbjct  83   EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TVKT WLD +HVVFG+V+EGM+VV+ +ES +TD  D+P K V+I+DC
Sbjct  143  AGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDGRDKPLKDVIIADC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIEV  207



>ref|XP_008604422.1| peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [Saprolegnia 
diclina VS20]
 gb|EQC41853.1| peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [Saprolegnia 
diclina VS20]
Length=203

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 134/181 (74%), Gaps = 11/181 (6%)
 Frame = -2

Query  703  VAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkg-  527
            V     K+T+QVYFDI IGN   + AGR+V+GLYG   P+T ENFRALCTGEKG G KG 
Sbjct  18   VGAKSPKITNQVYFDIKIGN---RDAGRVVMGLYGKTTPKTVENFRALCTGEKGTGTKGK  74

Query  526  ------ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAG  365
                  S+FHR+I DFMIQGGDF  G GTGG+SIYG  F DENFKL H GPG +SMANAG
Sbjct  75   PLWYKDSAFHRIIPDFMIQGGDFTHGTGTGGESIYGDRFDDENFKLKHEGPGTLSMANAG  134

Query  364  PNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGE  185
            PN+NGSQFFICTVKT WLD RHVVFG+VI GMDVVK +E   +  G  P +RV I++ GE
Sbjct  135  PNSNGSQFFICTVKTSWLDGRHVVFGRVISGMDVVKAVEKIGSGSG-TPSERVTIANSGE  193

Query  184  L  182
            L
Sbjct  194  L  194



>ref|XP_003418399.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B [Loxodonta africana]
Length=216

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 142/185 (77%), Gaps = 3/185 (2%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            L P  + A   +   KVT +VYFD+ IG+   +  GR+VIGL+G  VP+T +NF AL TG
Sbjct  26   LLPGPSVADEKKKGPKVTVKVYFDLRIGD---EDVGRVVIGLFGKTVPKTVDNFVALATG  82

Query  550  EkgfgfkgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMAN  371
            EKGFG+K S FHRVIKDFMIQGGDF +G+GTGGKSIYG  F DENFKL H GPG VSMAN
Sbjct  83   EKGFGYKDSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMAN  142

Query  370  AGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDC  191
            AG +TNGSQFFI TVKT WLD +HVVFG+V+EGMDVV+ +ES +TD  D+P K V I+DC
Sbjct  143  AGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKVESTKTDSRDKPLKDVTIADC  202

Query  190  GELPI  176
            G++ +
Sbjct  203  GKIEV  207



>gb|ESA04457.1| hypothetical protein GLOINDRAFT_66613, partial [Rhizophagus irregularis 
DAOM 181602]
Length=173

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 130/165 (79%), Gaps = 3/165 (2%)
 Frame = -2

Query  670  VYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfgfkgssFHRVIKDFMI  491
            V+FD+  G+   +  GRIVIGLYG  VP+T ENFRAL TGEKGFG+KGS FHRVIKDFMI
Sbjct  1    VFFDVKHGD---EELGRIVIGLYGKTVPKTVENFRALATGEKGFGYKGSIFHRVIKDFMI  57

Query  490  QggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSMANAGPNTNGSQFFICTVKTPWL  311
            QGGDF KG+GTGGKSIYG  F DENFKL H GPGV+SMANAGP+TNGSQFFI T  T WL
Sbjct  58   QGGDFTKGDGTGGKSIYGNKFADENFKLRHTGPGVLSMANAGPDTNGSQFFITTKATSWL  117

Query  310  DNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVISDCGELPI  176
            D RHVVFG V+EGMD+V  IE  E    DRPK+ V I DCGELPI
Sbjct  118  DERHVVFGYVLEGMDIVHKIEDVEKGPSDRPKENVTIIDCGELPI  162



>ref|XP_003055075.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60327.1| predicted protein [Micromonas pusilla CCMP1545]
Length=202

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 139/186 (75%), Gaps = 13/186 (7%)
 Frame = -2

Query  715  ATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTGEkgfg  536
            ATA  A P  KVT +V+FD+SIG   G  AGRI +GLYGD VP+TAENFRAL TGEKG G
Sbjct  22   ATASDASP--KVTDKVFFDVSIG---GIPAGRITMGLYGDVVPKTAENFRALATGEKGTG  76

Query  535  f-------kgssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGPGVVSM  377
                    KGS+FHRVI +FMIQGGDF  GNG GG+SIYG  F DENF L HAGPG +SM
Sbjct  77   KRGKPLHYKGSTFHRVIPNFMIQGGDFTDGNGRGGESIYGAKFADENFSLQHAGPGDLSM  136

Query  376  ANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKKRVVIS  197
            AN+GPNTNGSQFFICT+KT WLD RHVVFG+V+EGMDVV  IE+  +  G  P K V I+
Sbjct  137  ANSGPNTNGSQFFICTIKTSWLDGRHVVFGKVLEGMDVVYKIEAVGSSSG-TPSKEVTIT  195

Query  196  DCGELP  179
            D G+LP
Sbjct  196  DSGQLP  201



>ref|XP_008797942.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-1-like isoform 
X2 [Phoenix dactylifera]
Length=210

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 141/192 (73%), Gaps = 12/192 (6%)
 Frame = -2

Query  730  LAPVRATAQVAEPQSKVTSQVYFDISIGNPVGKAAGRIVIGLYGDEVPQTAENFRALCTG  551
            LA ++A A   E   +VT +VYFDI IG   GK AGRIV+GL+G  VP+TAENFRALCTG
Sbjct  24   LALIQAKAS-KENLKEVTHKVYFDIEIG---GKPAGRIVMGLFGKTVPKTAENFRALCTG  79

Query  550  Ekgfgfkg-------ssFHRVIKDFMIQggdfdkgngtggKSIYGRTFKDENFKLVHAGP  392
            EKG G  G       S+FHR+I  FMIQGGDF  G+G GG+SIYG  F DENFKL H GP
Sbjct  80   EKGSGKSGKPLHYKGSTFHRIIPSFMIQGGDFTLGDGRGGESIYGTKFADENFKLKHTGP  139

Query  391  GVVSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGQVIEGMDVVKLIESQETDRGDRPKK  212
            G++SMANAGP+TNGSQFFI TV T WLD +HVVFG+VI GMDVV  +E++    G  PK 
Sbjct  140  GLMSMANAGPDTNGSQFFITTVTTSWLDGKHVVFGKVISGMDVVYKVEAEGRQNGT-PKS  198

Query  211  RVVISDCGELPI  176
            +VVI+D GELP+
Sbjct  199  KVVIADSGELPL  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1889938564800