BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038J03

Length=962
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57272.1|  elongation factor 1-alpha                              553   0.0      Ipomoea nil [qian niu]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          548   0.0      Nicotiana tomentosiformis
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               548   0.0      Nicotiana sylvestris
ref|XP_007015467.1|  GTP binding Elongation factor Tu family prot...    544   0.0      
gb|AAC15413.1|  translation elongation factor-1 alpha                   547   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049145.1|  Os03g0177400                                       547   0.0      
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               547   0.0      Nicotiana tomentosiformis
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          547   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001234035.1|  elongation factor 1-alpha                          547   0.0      Solanum lycopersicum
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          546   0.0      Oryza brachyantha
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          546   0.0      Nicotiana sylvestris
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          546   0.0      Nicotiana sylvestris
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    546   0.0      
dbj|BAA34348.1|  elongation factor-1 alpha                              545   0.0      Nicotiana paniculata
dbj|BAA23658.1|  EF-1 alpha                                             545   0.0      Oryza sativa [red rice]
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    545   0.0      Theobroma cacao [chocolate]
gb|AGH32502.1|  translation elongation factor-1 alpha                   545   0.0      Stylosanthes guianensis [stylo]
gb|AFW76429.1|  putative translation elongation factor Tu family ...    538   0.0      
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               544   0.0      Nicotiana tomentosiformis
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          544   0.0      Solanum lycopersicum
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    544   0.0      Nicotiana tabacum [American tobacco]
gb|KJB53395.1|  hypothetical protein B456_009G4199001                   538   0.0      Gossypium raimondii
gb|KJB53396.1|  hypothetical protein B456_009G4199001                   539   0.0      Gossypium raimondii
dbj|BAC23049.1|  Elongation factor 1-alpha                              543   0.0      Solanum tuberosum [potatoes]
gb|AAN77897.1|  elongation factor 1 alpha                               543   0.0      Stevia rebaudiana
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               543   0.0      Elaeis guineensis
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               543   0.0      Tarenaya hassleriana [spider flower]
gb|KHG20498.1|  Elongation factor 1-alpha                               543   0.0      Gossypium arboreum [tree cotton]
gb|AGT16628.1|  elongation factor 1 alpha                               541   0.0      Saccharum hybrid cultivar R570
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          543   0.0      Sesamum indicum [beniseed]
ref|XP_002518072.1|  elongation factor 1-alpha, putative                536   0.0      Ricinus communis
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          542   0.0      Solanum tuberosum [potatoes]
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          542   0.0      Tarenaya hassleriana [spider flower]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    542   0.0      
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          542   0.0      Tarenaya hassleriana [spider flower]
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    542   0.0      Eucalyptus grandis [rose gum]
gb|AGH55661.1|  elongation factor 1-alpha                               537   0.0      Atropa belladonna [deadly nightshade]
gb|ABU63160.1|  elongation factor                                       542   0.0      Saccharum officinarum [noble cane]
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          542   0.0      Phoenix dactylifera
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    542   0.0      Theobroma cacao [chocolate]
gb|AAQ90154.1|  putative translation elongation factor protein          535   0.0      Solanum tuberosum [potatoes]
gb|KJB09231.1|  hypothetical protein B456_001G130700                    541   0.0      Gossypium raimondii
gb|AAL79775.1|  elongation factor 1 alpha                               541   0.0      Saccharum hybrid cultivar CP72-2086
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               541   0.0      Sesamum indicum [beniseed]
ref|NP_001152668.1|  LOC100286309                                       541   0.0      Zea mays [maize]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          541   0.0      Elaeis guineensis
gb|AGY80449.1|  elongation factor 1-alpha                               541   0.0      Dendrocalamus latiflorus [sweet bamboo]
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         540   0.0      Jatropha curcas
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     541   0.0      Saccharum hybrid cultivar CP65-357
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               541   0.0      Elaeis guineensis
gb|AFY06644.1|  elongation factor 1-alpha                               536   0.0      Carica papaya [mamon]
ref|XP_002528020.1|  elongation factor 1-alpha, putative                537   0.0      
ref|XP_002539209.1|  elongation factor 1-alpha, putative                535   0.0      Ricinus communis
ref|XP_008783723.1|  PREDICTED: elongation factor 1-alpha isoform X2    535   0.0      
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          541   0.0      Tarenaya hassleriana [spider flower]
gb|KHG26926.1|  Elongation factor 1-alpha                               541   0.0      Gossypium arboreum [tree cotton]
gb|ABA12220.1|  translation elongation factor 1A-4                      541   0.0      Gossypium hirsutum [American cotton]
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             539   0.0      Solanum tuberosum [potatoes]
gb|ABB86283.1|  elongation factor-1 alpha-like                          541   0.0      Solanum tuberosum [potatoes]
gb|ABA12218.1|  translation elongation factor 1A-2                      540   0.0      Gossypium hirsutum [American cotton]
gb|ABA12225.1|  translation elongation factor 1A-9                      541   0.0      Gossypium hirsutum [American cotton]
gb|ABA12221.1|  translation elongation factor 1A-5                      540   0.0      Gossypium hirsutum [American cotton]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    540   0.0      Eucalyptus grandis [rose gum]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               540   0.0      Phoenix dactylifera
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  540   0.0      Citrus sinensis [apfelsine]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    540   0.0      Sesamum indicum [beniseed]
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         540   0.0      Jatropha curcas
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             540   0.0      Citrus clementina [clementine]
gb|ABV26710.1|  elongation factor 1 alpha                               540   0.0      Gerbera hybrid cultivar
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  538   0.0      Solanum tuberosum [potatoes]
gb|AFC88830.1|  putative elongation factor 1-alpha                      540   0.0      Miscanthus sinensis
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          540   0.0      Elaeis guineensis
ref|NP_001105587.1|  elongation factor 1-alpha                          540   0.0      Zea mays [maize]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                540   0.0      Ricinus communis
emb|CDX70032.1|  BnaA10g23810D                                          535   0.0      
gb|KHG23927.1|  Elongation factor 1-alpha                               540   0.0      Gossypium arboreum [tree cotton]
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    540   0.0      Theobroma cacao [chocolate]
ref|NP_001275481.1|  elongation factor 1-alpha-like                     539   0.0      Solanum tuberosum [potatoes]
gb|ADI24333.1|  elongation factor 1-alpha                               539   0.0      Miscanthus sinensis
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          539   0.0      Solanum tuberosum [potatoes]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             539   0.0      Solanum tuberosum [potatoes]
ref|NP_001290506.1|  elongation factor 1-alpha                          539   0.0      Elaeis guineensis
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          539   0.0      Setaria italica
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    539   0.0      
gb|AGT16893.1|  elongation factor 1-alpha                               539   0.0      Saccharum hybrid cultivar R570
gb|ABA12217.1|  translation elongation factor 1A-1                      539   0.0      Gossypium hirsutum [American cotton]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          539   0.0      Phoenix dactylifera
gb|AID52924.1|  elongation factor 1-alpha                               538   0.0      Carthamus tinctorius
gb|ACR38047.1|  unknown                                                 538   0.0      Zea mays [maize]
gb|KJB48746.1|  hypothetical protein B456_008G084000                    536   0.0      Gossypium raimondii
dbj|BAC66180.1|  elongation factor 1A                                   538   0.0      Avicennia marina
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               538   0.0      Eucalyptus grandis [rose gum]
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               538   0.0      Pyrus x bretschneideri [bai li]
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          538   0.0      Nelumbo nucifera [Indian lotus]
gb|KGN47308.1|  hypothetical protein Csa_6G290890                       532   0.0      Cucumis sativus [cucumbers]
ref|XP_006304901.1|  hypothetical protein CARUB_v100092941mg            533   0.0      
emb|CDY61938.1|  BnaCnng38780D                                          537   0.0      Brassica napus [oilseed rape]
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          538   0.0      Phoenix dactylifera
ref|XP_002528028.1|  elongation factor 1-alpha, putative                538   0.0      
gb|KHG28979.1|  Elongation factor 1-alpha                               538   0.0      Gossypium arboreum [tree cotton]
emb|CDY22710.1|  BnaC08g43440D                                          536   0.0      Brassica napus [oilseed rape]
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    537   0.0      Setaria italica
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          537   0.0      Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB48747.1|  hypothetical protein B456_008G084000                    536   0.0      Gossypium raimondii
gb|AHE76183.1|  elongation factor 1-alpha                               537   0.0      Chrysanthemum indicum
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          537   0.0      Eucalyptus grandis [rose gum]
dbj|BAH56641.1|  elongation factor 1a                                   533   0.0      Nelumbo nucifera [Indian lotus]
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        537   0.0      Bruguiera sexangula
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   537   0.0      Lilium longiflorum [Easter lily]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               537   0.0      Musa acuminata subsp. malaccensis [pisang utan]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    537   0.0      Zea mays [maize]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             537   0.0      Brassica rapa
gb|ABA12219.1|  translation elongation factor 1A-3                      537   0.0      Gossypium hirsutum [American cotton]
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          537   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    537   0.0      
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          537   0.0      Elaeis guineensis
gb|KHG01531.1|  Elongation factor 1-alpha                               537   0.0      Gossypium arboreum [tree cotton]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               537   0.0      Malus domestica [apple tree]
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               537   0.0      Cucumis melo [Oriental melon]
gb|ABA12223.1|  translation elongation factor 1A-7                      536   0.0      Gossypium hirsutum [American cotton]
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             536   0.0      Prunus persica
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          536   0.0      Eucalyptus grandis [rose gum]
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          536   0.0      
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        537   0.0      Brassica rapa
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          536   0.0      Zea mays [maize]
emb|CDX93604.1|  BnaA06g04440D                                          537   0.0      
gb|KGN61480.1|  hypothetical protein Csa_2G139820                       531   0.0      Cucumis sativus [cucumbers]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    536   0.0      Zea mays [maize]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               536   0.0      Tarenaya hassleriana [spider flower]
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          536   0.0      
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          536   0.0      Elaeis guineensis
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              536   0.0      Capsicum annuum
emb|CAA06245.1|  elongation factor 1-alpha (EF1-a)                      531   0.0      Cicer arietinum [garbanzo]
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          536   0.0      Eucalyptus grandis [rose gum]
emb|CAD60652.1|  elongation factor                                      535   0.0      Solanum tuberosum [potatoes]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          535   0.0      Pyrus x bretschneideri [bai li]
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             535   0.0      Citrus clementina [clementine]
gb|KHN18669.1|  Elongation factor 1-alpha                               535   0.0      Glycine soja [wild soybean]
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             535   0.0      Prunus persica
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          535   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               535   0.0      Cucumis melo [Oriental melon]
gb|AEN79476.1|  elongation factor 1-alpha                               535   0.0      Ziziphus jujuba [Chinese jujube]
dbj|BAF02151.1|  elongation factor 1-alpha                              535   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     535   0.0      Glycine max [soybeans]
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             535   0.0      Eutrema salsugineum [saltwater cress]
gb|AAL57653.1|  At1g07930/T6D22_3                                       535   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               535   0.0      Prunus mume [ume]
emb|CDX95108.1|  BnaC05g05630D                                          536   0.0      
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             535   0.0      Capsella rubella
gb|AFW77593.1|  putative translation elongation factor Tu family ...    535   0.0      
ref|NP_200847.1|  elongation factor 1-alpha 4                           535   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    535   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          535   0.0      Pyrus x bretschneideri [bai li]
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         535   0.0      Jatropha curcas
gb|KHN14872.1|  Elongation factor 1-alpha                               535   0.0      Glycine soja [wild soybean]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             535   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AIM48895.1|  elongation factor 1-alpha                               534   0.0      Cinnamomum camphora
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          535   0.0      Cicer arietinum [garbanzo]
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          535   0.0      Cucumis sativus [cucumbers]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        535   0.0      Brassica rapa
emb|CAA34456.1|  elongation factor 1-alpha                              535   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY58828.1|  BnaAnng15460D                                          539   0.0      Brassica napus [oilseed rape]
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          535   0.0      Malus domestica [apple tree]
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        535   0.0      Hevea brasiliensis [jebe]
gb|ACG31866.1|  elongation factor 1-alpha                               534   0.0      Zea mays [maize]
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          535   0.0      Tarenaya hassleriana [spider flower]
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             534   0.0      Phaseolus vulgaris [French bean]
gb|ACI96243.1|  elongation factor 1-alpha                               534   0.0      Prunus persica
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        534   0.0      Brassica rapa
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    534   0.0      Populus euphratica
ref|NP_001288407.1|  elongation factor 1-alpha-like                     534   0.0      Zea mays [maize]
gb|KHG27341.1|  Elongation factor 1-alpha                               534   0.0      Gossypium arboreum [tree cotton]
gb|AAX54511.1|  elongation factor 1 alpha                               534   0.0      Actinidia deliciosa [Chinese gooseberry]
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               534   0.0      Vitis vinifera
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          534   0.0      Cucumis sativus [cucumbers]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          534   0.0      Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG24249.1|  Elongation factor 1-alpha                               532   0.0      Gossypium arboreum [tree cotton]
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          534   0.0      Populus euphratica
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    534   0.0      Populus euphratica
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               534   0.0      Fragaria vesca subsp. vesca
dbj|BAL14665.1|  elongation factor 1-alpha                              534   0.0      Chrysanthemum seticuspe f. boreale
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             534   0.0      Citrus clementina [clementine]
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     534   0.0      Glycine max [soybeans]
gb|KGN51227.1|  hypothetical protein Csa_5G495940                       530   0.0      Cucumis sativus [cucumbers]
dbj|BAM13874.1|  elongation factor 1 alpha                              533   0.0      Symplocarpus renifolius
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               533   0.0      Vitis vinifera
ref|NP_001288465.1|  elongation factor 1-alpha-like                     533   0.0      Zea mays [maize]
gb|ACS68200.1|  elongation factor 1 alpha                               533   0.0      Brassica napus [oilseed rape]
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               533   0.0      Fragaria vesca subsp. vesca
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    533   0.0      Glycine max [soybeans]
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          533   0.0      Musa acuminata subsp. malaccensis [pisang utan]
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    533   0.0      Manihot esculenta [manioc]
gb|AGJ50595.1|  EF1alpha                                                533   0.0      Pericallis cruenta
gb|ABA12224.1|  translation elongation factor 1A-8                      533   0.0      Gossypium hirsutum [American cotton]
ref|NP_001105617.1|  elongation factor alpha3                           533   0.0      Zea mays [maize]
gb|ACG34498.1|  elongation factor 1-alpha                               533   0.0      Zea mays [maize]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    533   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KEH43533.1|  GTP-binding elongation factor Tu family protein         529   0.0      Medicago truncatula
gb|KGN51228.1|  Elongation factor 1-alpha                               531   0.0      Cucumis sativus [cucumbers]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    533   0.0      Gossypium raimondii
dbj|BAH19898.1|  AT1G07930                                              533   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHN42761.1|  Elongation factor 1-alpha                               533   0.0      Glycine soja [wild soybean]
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   533   0.0      Lilium longiflorum [Easter lily]
gb|EPS66340.1|  elongation factor 1-alpha                               532   0.0      Genlisea aurea
gb|AIX10769.1|  elongation factor 1 alpha                               532   0.0      Panax notoginseng [san-qi]
gb|AFP44110.1|  elongation factor 1-alpha                               532   0.0      Lycoris longituba
gb|AAK82537.1|  At1g07930/T6D22_3                                       532   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  532   0.0      Solanum tuberosum [potatoes]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   532   0.0      Lilium longiflorum [Easter lily]
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          532   0.0      Prunus mume [ume]
gb|EPS66069.1|  elongation factor 1-alpha                               532   0.0      Genlisea aurea
gb|AIZ68131.1|  translation elongation factor 1-alpha                   532   0.0      Ornithogalum longebracteatum [sea-onion]
gb|AEI29162.1|  EF1a-like protein                                       530   0.0      Phalaenopsis hybrid cultivar
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               532   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          531   0.0      
gb|AAY56337.1|  elongation factor-1 alpha                               531   0.0      Musa acuminata [banana]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         531   0.0      
ref|XP_003604823.1|  Elongation factor 1-alpha                          531   0.0      
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          531   0.0      Fragaria vesca subsp. vesca
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    531   0.0      
gb|AHB86963.1|  elongation factor 1-alpha                               531   0.0      Sedum alfredii
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               531   0.0      Brachypodium distachyon [annual false brome]
ref|NP_001105933.1|  elongation factor alpha2                           531   0.0      
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          531   0.0      Amborella trichopoda
gb|AEQ75495.1|  elongation factor 1-alpha                               531   0.0      Rosa multiflora [Japanese rose]
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        531   0.0      Hevea brasiliensis [jebe]
ref|NP_001280807.1|  elongation factor 1-alpha-like                     531   0.0      Malus domestica [apple tree]
gb|AAL32631.1|  putative elongation factor 1-a                          531   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          531   0.0      Amborella trichopoda
gb|ABA12222.1|  translation elongation factor 1A-6                      531   0.0      Gossypium hirsutum [American cotton]
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          531   0.0      
gb|AGI15328.1|  elongation factor 1                                     531   0.0      Aegiceras corniculatum
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               531   0.0      Vitis vinifera
gb|AGV54713.1|  elongation factor 1-alpha                               531   0.0      Phaseolus vulgaris [French bean]
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             530   0.0      Prunus persica
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               530   0.0      Tarenaya hassleriana [spider flower]
ref|XP_002312029.1|  ADR12-2 family protein                             530   0.0      Populus trichocarpa [western balsam poplar]
gb|AAF99703.1|  elongation factor                                       530   0.0      Saccharum officinarum [noble cane]
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          530   0.0      
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          530   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001237425.1|  elongation factor-1A                               530   0.0      
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             530   0.0      Prunus persica
ref|XP_002311107.1|  ADR12-2 family protein                             530   0.0      Populus trichocarpa [western balsam poplar]
gb|AGC94754.1|  elongation factor 1 alpha                               530   0.0      Euphorbia lathyris
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             530   0.0      Phaseolus vulgaris [French bean]
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    530   0.0      Glycine max [soybeans]
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          530   0.0      Malus domestica [apple tree]
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          529   0.0      Beta vulgaris subsp. vulgaris [field beet]
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         529   0.0      Medicago truncatula
ref|NP_001183947.1|  uncharacterized protein LOC100502553               527   0.0      
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    529   0.0      Daucus carota [carrots]
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    533   0.0      
ref|NP_001105935.1|  elongation factor alpha8                           529   0.0      
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         529   0.0      Medicago truncatula
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          529   0.0      Sorghum bicolor [broomcorn]
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         529   0.0      Medicago truncatula
ref|XP_002311106.1|  ADR12-2 family protein                             528   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    528   0.0      Populus euphratica
dbj|BAM13877.1|  elongation factor 1 alpha                              528   0.0      Arum maculatum [cuckoo-pint]
gb|AAL69396.1|  elongation factor 1-alpha                               528   0.0      Elaeis oleifera
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             528   0.0      
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             528   0.0      
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             528   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        528   0.0      Brassica rapa
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               528   0.0      Prunus mume [ume]
ref|NP_001151074.1|  elongation factor 1-alpha                          528   0.0      
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        528   0.0      Salsola komarovii
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         528   0.0      Medicago truncatula
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          528   0.0      Populus euphratica
ref|XP_003591959.1|  Elongation factor 1-alpha                          532   0.0      
ref|XP_003588821.1|  Elongation factor 1-alpha                          528   0.0      
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             527   0.0      Phaseolus vulgaris [French bean]
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          526   0.0      Amborella trichopoda
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             526   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_001105565.1|  elongation factor alpha5                           526   0.0      
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        526   0.0      Suaeda japonica
gb|AGD99674.1|  eukaryotic elongation factor 1A                         525   0.0      Salicornia bigelovii
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          525   0.0      Cicer arietinum [garbanzo]
gb|ADK73624.1|  elongation factor 1 alpha                               520   0.0      Origanum vulgare
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    524   0.0      
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    523   0.0      
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                523   0.0      
gb|ABD66517.1|  EF-1 alpha                                              523   0.0      
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    522   0.0      
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             522   0.0      
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             522   0.0      
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             521   0.0      
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             521   0.0      
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                521   0.0      
ref|XP_003604587.1|  Elongation factor 1-alpha                          521   0.0      
gb|KHG15275.1|  Elongation factor 1-alpha                               520   0.0      
gb|EMS52529.1|  Elongation factor 1-alpha                               521   0.0      
gb|EMS59091.1|  Elongation factor 1-alpha                               522   0.0      
gb|AER42621.1|  elongation factor 1 alpha                               520   0.0      
gb|EMS49772.1|  Elongation factor 1-alpha                               520   0.0      
gb|AGI78242.1|  elongation factor 1 alpha                               520   0.0      
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    536   0.0      
emb|CAC27139.1|  translation elongation factor-1 alpha                  519   1e-180   
gb|EMT12343.1|  Elongation factor 1-alpha                               518   2e-180   
gb|AHA84124.1|  elongation factor 1-alpha                               518   2e-180   
ref|XP_002892424.1|  T6D22.2                                            536   3e-180   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    517   6e-180   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    517   7e-180   
gb|ACN41180.1|  unknown                                                 517   7e-180   
gb|ABK25072.1|  unknown                                                 517   9e-180   
gb|ACN40081.1|  unknown                                                 517   9e-180   
gb|AIZ74328.1|  translation elongation factor 1-alpha                   517   1e-179   
gb|AAF79822.1|AC026875_2  T6D22.2                                       535   1e-179   
gb|ACN40740.1|  unknown                                                 516   2e-179   
ref|NP_001104938.1|  elongation factor 1 alpha                          515   4e-179   
gb|ABK24265.1|  unknown                                                 515   4e-179   
gb|AFJ04514.1|  elongation factor 1-alpha                               514   5e-179   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    515   6e-179   
gb|ABF00115.1|  elongation factor 1-alpha                               514   1e-178   
ref|NP_001105934.1|  elongation factor alpha7                           514   2e-178   
gb|ABK24843.1|  unknown                                                 513   2e-178   
gb|EMS65134.1|  Elongation factor 1-alpha                               520   2e-178   
gb|ABR17675.1|  unknown                                                 513   4e-178   
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 513   4e-178   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    533   7e-178   
ref|XP_003618775.1|  Elongation factor 1-alpha                          530   2e-177   
gb|EMT09703.1|  Elongation factor 1-alpha                               521   3e-177   
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 510   5e-177   
ref|NP_001104939.1|  elongation factor alpha6                           509   8e-177   
ref|XP_001753181.1|  predicted protein                                  507   6e-176   
ref|XP_001766482.1|  predicted protein                                  507   6e-176   
gb|AEE98364.1|  elongation factor 1-alpha                               507   7e-176   
ref|XP_001763201.1|  predicted protein                                  506   1e-175   
ref|XP_001753167.1|  predicted protein                                  506   3e-175   
ref|XP_001763194.1|  predicted protein                                  505   4e-175   
ref|XP_001753059.1|  predicted protein                                  504   1e-174   
gb|AHZ58493.1|  translation elongation factor alpha                     503   2e-174   
gb|AAO61852.1|  translation elongation factor-1 alpha                   501   2e-174   
dbj|BAK08744.1|  elongation factor 1-alpha                              497   5e-172   
gb|AGZ15393.1|  elongation factor 1-alpha                               491   1e-171   
dbj|BAK08819.1|  elongation factor 1-alpha                              496   2e-171   
gb|ABQ81936.1|  elongation factor 1-alpha                               494   6e-171   
dbj|BAK08818.1|  elongation factor 1-alpha                              494   1e-170   
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     491   5e-170   
gb|ACT36602.1|  elongation factor 1 alpha                               486   7e-169   
gb|EEE58429.1|  hypothetical protein OsJ_09630                          488   8e-169   
gb|ABD66072.1|  elongation factor 1-alpha                               481   2e-168   
gb|AFN42763.1|  elongation factor 1-alpha                               479   5e-168   
gb|AFB18314.1|  translation elongation factor-1 alpha                   481   2e-166   
gb|AAR82894.1|  elongation factor 1-alpha                               476   8e-164   
gb|KDP29082.1|  hypothetical protein JCGZ_16471                         466   1e-162   
dbj|BAG80668.1|  elongation factor 1 alpha                              469   8e-162   
emb|CDX88757.1|  BnaA03g08920D                                          469   8e-162   
gb|ACL97366.1|  elongation factor-1 alpha                               467   1e-160   
gb|ACL97363.1|  elongation factor-1 alpha                               465   8e-160   
ref|XP_002538647.1|  elongation factor 1-alpha, putative                458   3e-159   
gb|ADD71925.1|  translation elongation factor 1 alpha                   462   1e-158   
gb|ABQ81935.1|  elongation factor 1-alpha                               462   1e-158   
ref|XP_005650451.1|  translation elongation factor                      463   1e-158   
emb|CAJ38380.1|  translation elongation factor 1 alpha                  451   5e-157   
gb|AGV54654.1|  elongation factor 1-alpha                               457   4e-156   
gb|AAD28440.1|  elongation factor 1-alpha                               457   5e-156   
gb|ACL97367.1|  elongation factor-1 alpha                               456   5e-156   
gb|AGZ90153.1|  elongation factor 1-alpha                               447   2e-155   
gb|AIM46989.1|  translation elongation factor 1-alpha                   455   3e-155   
gb|AAV92325.1|  translation elongation factor-1 alpha                   447   4e-155   
gb|ACA24136.1|  eukaryotic elongation factor 1-alpha                    451   6e-155   
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       453   2e-154   
gb|ACO50110.1|  elongation factor 1 alpha                               452   2e-154   
gb|AIC33038.1|  elongation factor 1-alpha                               444   5e-154   
gb|ADC68236.1|  elongation factor 1-alpha                               443   8e-154   
emb|CAA65453.1|  elongation factor                                      442   2e-153   
gb|AAD03711.1|  elongation translation factor 1 alpha                   449   7e-153   
gb|ADK90073.1|  elongation factor 1 alpha                               448   1e-152   
gb|KJB76560.1|  hypothetical protein B456_012G094600                    447   2e-152   
emb|CAB65347.1|  translation elongation factor 1 alpha                  447   2e-152   
ref|XP_002904717.1|  translation elongation factor 1-alpha, putative    447   3e-152   
gb|EPR57682.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         441   6e-152   
gb|ACO50115.1|  elongation factor 1 alpha                               446   9e-152   
emb|CCI49302.1|  unnamed protein product                                446   1e-151   
gb|AIM46986.1|  translation elongation factor 1-alpha                   446   1e-151   
gb|EPR56707.1|  elongation factor 1-alpha                               439   2e-151   
gb|ACL97369.1|  elongation factor-1 alpha                               442   3e-151   
emb|CCA22726.1|  PREDICTED: hypothetical protein                        443   7e-151   
ref|XP_822464.1|  elongation factor 1-alpha                             439   1e-150   
gb|ACO50114.1|  elongation factor 1 alpha                               442   2e-150   
ref|XP_003879714.1|  elongation factor 1-alpha, related                 442   2e-150   
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     442   2e-150   
gb|ETO75704.1|  elongation factor 1-alpha                               439   3e-150   
gb|ACL97368.1|  elongation factor-1 alpha                               439   3e-150   
gb|ACO50117.1|  elongation factor 1 alpha                               442   3e-150   
ref|XP_008606624.1|  elongation factor 1-alpha 1                        441   7e-150   
gb|ESL11451.1|  elongation factor 1-alpha (EF-1-alpha)                  435   8e-150   
gb|ESL05607.1|  elongation factor 1-alpha (EF-1-alpha)                  437   1e-149   
gb|ETP16791.1|  elongation factor 1-alpha                               439   1e-149   
ref|XP_002369268.1|  elongation factor 1-alpha, putative                440   1e-149   
emb|CCC51155.1|  putative elongation factor 1-alpha                     441   1e-149   
ref|XP_009833124.1|  elongation factor 1-alpha                          440   2e-149   
sp|P14963.1|EF1A_EUGGR  RecName: Full=Elongation factor 1-alpha; ...    439   2e-149   
ref|XP_008905681.1|  elongation factor 1-alpha                          439   3e-149   
emb|CCC51157.1|  putative EF-1-alpha                                    439   3e-149   
ref|XP_822465.1|  elongation factor 1-alpha                             439   4e-149   
ref|XP_008609205.1|  elongation factor 1-alpha 1                        439   4e-149   
emb|CAL07988.1|  translation elongation factor 1 alpha                  431   5e-149   
gb|KFG30129.1|  elongation factor 1-alpha                               432   5e-149   
emb|CDI83049.1|  elongation factor 1-alpha, putative                    439   6e-149   
ref|XP_008873087.1|  elongation factor 1-alpha                          439   6e-149   
ref|XP_009520546.1|  hypothetical protein PHYSODRAFT_354062             438   7e-149   
emb|CDJ59653.1|  elongation factor 1-alpha, putative                    438   8e-149   
gb|ACO50116.1|  elongation factor 1 alpha                               438   9e-149   
gb|AAX40342.1|  elongation factor 1-alpha                               437   1e-148   
gb|AAX40412.1|  elongation factor 1-alpha                               438   1e-148   
ref|XP_001426931.1|  hypothetical protein                               437   1e-148   
gb|AAX40361.1|  elongation factor 1-alpha                               437   2e-148   
gb|ADK90074.1|  elongation factor 1 alpha                               437   2e-148   
gb|AAU47272.1|  elongation factor alpha G5                              437   3e-148   
emb|CCC93414.1|  putative hexokinase                                    434   3e-148   
gb|ACO50109.1|  elongation factor 1 alpha                               430   4e-148   
gb|AAX40346.1|  elongation factor 1-alpha                               436   4e-148   
gb|AAX40369.1|  elongation factor 1-alpha                               436   4e-148   
gb|AAX40345.1|  elongation factor 1-alpha                               436   4e-148   
gb|ESL05580.1|  elongation factor 1-alpha (EF-1-alpha)                  436   4e-148   
gb|AAX40350.1|  elongation factor 1-alpha                               436   5e-148   
gb|AAC01751.1|  elongation factor 1-alpha                               436   5e-148   
dbj|BAH36864.1|  elongation factor1-alpha                               431   6e-148   
gb|AAX40352.1|  elongation factor 1-alpha                               436   7e-148   
gb|AAX40370.1|  elongation factor 1-alpha                               435   9e-148   
gb|EKG06689.1|  elongation factor 1-alpha (ef-1-alpha), putative        437   9e-148   
gb|AAX40363.1|  elongation factor 1-alpha                               435   9e-148   
gb|AFC75715.1|  translation elongation factor 1 alpha                   436   9e-148   
gb|AAX40383.1|  elongation factor 1-alpha                               435   1e-147   
gb|ACI02318.1|  elongation factor alpha G5                              435   1e-147   
ref|XP_819439.1|  elongation factor 1-alpha (EF-1-alpha)                436   1e-147   
ref|XP_806829.1|  elongation factor 1-alpha (EF-1-alpha)                436   1e-147   
gb|EKF38338.1|  elongation factor 1-alpha (ef-1-alpha), putative        436   1e-147   
gb|AAX09599.1|  elongation factor 1 alpha                               431   1e-147   
gb|AAX40353.1|  elongation factor 1-alpha                               435   1e-147   
ref|XP_009313968.1|  elongation factor 1-alpha                          435   1e-147   
ref|XP_804708.1|  elongation factor 1-alpha (EF-1-alpha)                435   2e-147   
gb|AIM46992.1|  translation elongation factor 1-alpha                   435   2e-147   
gb|AAX40373.1|  elongation factor 1-alpha                               434   2e-147   
gb|AFC75714.1|  translation elongation factor 1 alpha                   435   2e-147   
ref|XP_010730917.1|  PREDICTED: elongation factor 1-alpha 1             435   2e-147   
gb|KFH42761.1|  Elongation factor 1-alpha-like protein                  435   2e-147   
ref|XP_804709.1|  elongation factor 1-alpha (EF-1-alpha)                435   2e-147   
ref|XP_008905546.1|  elongation factor 1-alpha                          441   2e-147   
gb|AAX09602.1|  elongation factor 1 alpha                               430   3e-147   
gb|ACO50111.1|  elongation factor 1 alpha                               434   3e-147   
gb|ESL10875.1|  elongation factor 1-alpha (EF-1-alpha)                  436   3e-147   
gb|ABW20463.1|  elongation factor 1-alpha                               432   3e-147   
gb|EJY71473.1|  Elongation factor 1-alpha                               434   3e-147   
gb|AAH80974.1|  LOC493206 protein                                       434   4e-147   
gb|AED86978.1|  elongation factor-1                                     434   4e-147   
emb|CCC93415.1|  unnamed protein product                                434   4e-147   
ref|XP_010248287.1|  PREDICTED: elongation factor 1-alpha               431   5e-147   
gb|AHI45318.1|  elongation factor 1 alpha                               434   5e-147   
ref|XP_003873865.1|  elongation factor 1-alpha                          434   5e-147   
ref|XP_001464664.1|  elongation factor 1-alpha                          434   5e-147   
gb|ESL09377.1|  elongation factor 1-alpha                               434   6e-147   
gb|EMF17352.1|  translation elongation factor 1-alpha                   434   6e-147   
gb|AAX40378.1|  elongation factor 1-alpha                               433   6e-147   
gb|AAX40351.1|  elongation factor 1-alpha                               433   6e-147   
gb|AAX40376.1|  elongation factor 1-alpha                               433   7e-147   
sp|Q07051.1|EF1A_EIMBO  RecName: Full=Elongation factor 1-alpha; ...    429   8e-147   
emb|CAA40028.1|  42Sp48                                                 428   9e-147   
gb|ESL06743.1|  elongation factor 1-alpha                               436   1e-146   
gb|AFK73419.1|  elongation factor 1-alpha                               432   1e-146   
ref|XP_804710.1|  elongation factor 1-alpha (EF-1-alpha)                426   2e-146   
ref|XP_007567352.1|  PREDICTED: elongation factor 1-alpha 1             432   2e-146   
ref|NP_989301.1|  eukaryotic translation elongation factor 1 alph...    432   2e-146   
gb|KHN88882.1|  Elongation factor 1-alpha                               432   2e-146   
emb|CCX11704.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    427   2e-146   
ref|XP_005805806.1|  PREDICTED: elongation factor 1-alpha 1-like        432   2e-146   
ref|XP_001563777.1|  elongation factor 1-alpha                          432   2e-146   
ref|XP_001682258.1|  elongation factor 1-alpha                          432   3e-146   
sp|P86933.1|EF1A_TRYBB  RecName: Full=Elongation factor 1-alpha; ...    432   3e-146   
gb|EJW86012.1|  translation elongation factor EF-1                      431   3e-146   
gb|EWC48307.1|  elongation factor 1-alpha                               432   3e-146   
ref|XP_003380597.1|  elongation factor 1-alpha                          434   4e-146   
gb|AAX09600.1|  elongation factor 1 alpha                               427   4e-146   
emb|CDH51795.1|  elongation factor 1-alpha                              431   4e-146   
gb|EWM21485.1|  translation elongation factor 1                         431   5e-146   
gb|EPR59423.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         431   5e-146   
ref|NP_001079602.1|  elongation factor 1-alpha, oocyte form             432   5e-146   
gb|AAX09601.1|  elongation factor 1 alpha                               430   6e-146   
ref|XP_010697699.1|  elongation factor 1-alpha                          431   6e-146   
gb|KEH40223.1|  GTP-binding elongation factor Tu family protein         431   7e-146   
gb|AET50884.1|  hypothetical protein                                    431   8e-146   
ref|XP_007061563.1|  PREDICTED: elongation factor 1-alpha 1             431   8e-146   
gb|ABQ41396.1|  elongation factor 1A                                    429   1e-145   
sp|P27592.1|EF1A_ONCVO  RecName: Full=Elongation factor 1-alpha; ...    431   1e-145   
gb|AEV12206.1|  elongation factor 1-alpha                               427   1e-145   
gb|EFQ26666.1|  translation elongation factor EF-1                      431   1e-145   
emb|CBY85304.1|  eukaryotic translation elongation factor 1 alpha 1     429   1e-145   
ref|XP_003392396.1|  elongation factor 1-alpha                          432   1e-145   
ref|XP_004622541.1|  PREDICTED: elongation factor 1-alpha-like          427   1e-145   
gb|AAX40413.1|  elongation factor 1-alpha                               430   1e-145   
emb|CBJ32893.1|  EEF1A2, eukaryotic translation elongation factor...    430   1e-145   
ref|XP_001893409.1|  elongation factor 1-alpha                          431   2e-145   
emb|CDS13811.1|  Putative Elongation factor 1-alpha (Fragment)          430   2e-145   
gb|KEH43146.1|  elongation factor Tu (EF-Tu) GTP-binding family p...    429   2e-145   
emb|CDQ04680.1|  Protein Bm5196, isoform a                              429   2e-145   
emb|CDH48285.1|  elongation factor 1-alpha                              430   2e-145   
ref|XP_008404506.1|  PREDICTED: elongation factor 1-alpha 1             430   2e-145   
gb|AAA52367.1|  elongation factor 1-alpha                               425   2e-145   



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/273 (98%), Positives = 272/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/273 (97%), Positives = 271/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/273 (97%), Positives = 271/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_007015467.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33086.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  63   KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  122

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  123  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  182

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  183  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  242

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  243  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  302

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  303  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  335



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/273 (97%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/273 (97%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 271/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|ABF94276.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94277.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=449

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/273 (97%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  166  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  225

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  226  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  285

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  286  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  345

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  346  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  405

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  406  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  438



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/273 (96%), Positives = 271/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/273 (97%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 271/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 271/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA++FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/273 (97%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/273 (96%), Positives = 271/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA+SFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASSFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/273 (97%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EP RPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPNRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AFW76429.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=293

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  10   KARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  69

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  70   NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMH  129

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  130  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  189

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  190  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  249

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  250  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  282



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 271/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA+SFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASSFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 271/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD +
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQL  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPSG  436



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            ++ KRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NDAKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|KJB53395.1| hypothetical protein B456_009G4199001 [Gossypium raimondii]
Length=300

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  17   KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  76

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  77   NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  136

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  137  HEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  196

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  197  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  256

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  257  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  289



>gb|KJB53396.1| hypothetical protein B456_009G4199001, partial [Gossypium raimondii]
Length=322

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  39   KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  98

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  99   NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  158

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  159  HEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  218

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  219  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  278

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  279  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  311



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 271/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARY+EIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/273 (97%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AGT16628.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=399

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  116  KARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  175

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  176  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  235

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  236  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  295

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  296  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  355

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  356  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGM+VTF P+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMLVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNVDKK+P+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKEPSG  436



>ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  10   KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  69

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE+KSVEMH
Sbjct  70   NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEIKSVEMH  129

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  130  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  189

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  190  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  249

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  250  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 271/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD +
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQL  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM+VTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMLVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AGH55661.1| elongation factor 1-alpha, partial [Atropa belladonna]
Length=333

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVG NPDK+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  51   KARYDEIVKEVSSYLKKVGXNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  110

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  111  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  170

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  171  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  230

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFA +LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  231  GYAPVLDCHTSHIAVKFAXILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETF  290

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  291  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  323



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAQ90154.1| putative translation elongation factor protein [Solanum tuberosum]
Length=287

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  3    KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  62

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  63   NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  122

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  123  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  182

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  183  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  242

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  243  AEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  275



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  158  KARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  217

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  218  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  277

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  278  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  337

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  338  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  397

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  398  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  430



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEA+QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMI+RSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIDRSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+L+PGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KDP29084.1| hypothetical protein JCGZ_16473 [Jatropha curcas]
Length=399

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  116  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  175

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  176  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  235

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  236  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  295

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  296  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  355

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  356  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD++
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMV  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRP DKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPLDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKD +G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDASG  436



>gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya]
Length=334

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDLI
Sbjct  51   KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLI  110

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVY+IGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  111  NEPKRPSDKPLRLPLQDVYRIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  170

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  171  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  230

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  231  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  290

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  291  SQYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  323



>ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=348

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  63   KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  122

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  123  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  182

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  183  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  242

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  243  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  302

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  303  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  335



>ref|XP_002539209.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23174.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  10   KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  69

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE+KSVEMH
Sbjct  70   NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEIKSVEMH  129

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  130  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  189

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  190  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  249

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  250  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_008783723.1| PREDICTED: elongation factor 1-alpha isoform X2 [Phoenix dactylifera]
Length=293

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  10   KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  69

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  70   QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMH  129

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  130  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  189

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  190  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  249

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  250  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM+VTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMLVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001275420.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABB16975.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  116  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  175

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  176  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  235

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  236  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  295

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  296  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  355

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  356  AEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPM+VETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMLVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGLIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+LQEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAKGA++FTSQVIIMNHPGQIGN
Sbjct  284  HESLQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGASNFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEA+QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+LQEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAKGA++FTSQVIIMNHPGQIGN
Sbjct  284  HESLQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGASNFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+RY+EIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KSRYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPL DVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLLDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ABB02622.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  116  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  175

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEV+SVEMH
Sbjct  176  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVQSVEMH  235

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  236  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  295

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  296  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  355

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  356  AEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+L+PGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELL+KIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELLSKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE+KSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEIKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>emb|CDX70032.1| BnaA10g23810D [Brassica napus]
Length=344

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  59   KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  118

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  119  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  178

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  179  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  238

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  239  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  298

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  299  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  331



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHT HIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTCHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|NP_001275481.1| elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB16996.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/274 (95%), Positives = 271/274 (99%), Gaps = 1/274 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  H-EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIG  422
            H EALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIG
Sbjct  284  HHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIG  343

Query  421  NGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVET  242
            NGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVET
Sbjct  344  NGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVET  403

Query  241  FSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            F+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  404  FAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  437



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE++QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HESMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/273 (96%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDW+KGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWHKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+RY+EIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KSRYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFQELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB48746.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=400

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  116  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  175

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  176  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  235

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDD AK AA+FTSQVIIMNHPGQIGN
Sbjct  236  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDLAKEAANFTSQVIIMNHPGQIGN  295

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  296  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  355

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  356  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD++
Sbjct  164  KARYDEIVKEVSSYIKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMV  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGM+VTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMLVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  436



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTE+KSVEMH
Sbjct  224  LEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEIKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAATFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LK GMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKSGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE LQEALPGDNVGFNVKNVAVKDLKRGYVASNSK+DPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HETLQEALPGDNVGFNVKNVAVKDLKRGYVASNSKEDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|KGN47308.1| hypothetical protein Csa_6G290890 [Cucumis sativus]
Length=295

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  10   KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  69

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  70   QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  129

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EA+PGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  130  HESLPEAVPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  189

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  190  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  249

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  250  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_006304901.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
 gb|EOA37799.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
Length=325

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  40   KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  99

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  100  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGLIKPGMVVTFAPTGLTTEVKSVEMH  159

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  160  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  219

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  220  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  279

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  280  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  312



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  143  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  202

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  203  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  262

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  263  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  322

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  323  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  382

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  383  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  415



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVK +ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKVSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  142  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  201

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  202  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  261

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  262  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  321

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  322  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  381

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  382  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  414



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPG+VVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGIVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            ++YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  AQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB48747.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=427

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  143  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  202

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  203  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  262

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDD AK AA+FTSQVIIMNHPGQIGN
Sbjct  263  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDLAKEAANFTSQVIIMNHPGQIGN  322

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  323  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  382

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  383  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  415



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+RY+EIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KSRYEEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAH56641.1| elongation factor 1a, partial [Nelumbo nucifera]
Length=355

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 265/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  83   KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  142

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LK GMVVTFGPSGLTTEVKSVEMH
Sbjct  143  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKAGMVVTFGPSGLTTEVKSVEMH  202

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE LQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  203  HETLQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  262

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  263  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  322

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  323  SEYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  355



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAK A+SFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKEASSFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  436



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTE+KSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEIKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSK+DPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKEDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVAS SKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASGSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SGYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+L+PGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG++KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGLIKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EA+PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALPEAVPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQ IIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQGIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  SEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AASF SQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAASFASQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGM+VTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMLVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKD+KRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDIKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  175  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  234

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  235  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  294

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  295  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  354

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  355  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  414

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  415  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  447



>gb|KGN61480.1| hypothetical protein Csa_2G139820 [Cucumis sativus]
Length=330

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  47   KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  106

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  107  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  166

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  167  HESLPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  226

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRS KELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  227  GYAPVLDCHTSHIAVKFAEILTKIDRRSAKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  286

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  287  STYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  319



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EV+SY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVASYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+RYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD +
Sbjct  164  KSRYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQV  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  LEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK A SFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAGSFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAF63516.1|AF242732_1 translation elongation factor 1a [Capsicum annuum]
Length=447

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  163  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  222

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKP RLPL+DVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  223  NEPKRPSDKPFRLPLKDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  282

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  283  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  342

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDR SGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  343  GYAPVLDCHTSHIAVKFGEILTKIDRWSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  402

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +E PPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  403  AENPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  435



>emb|CAA06245.1| elongation factor 1-alpha (EF1-a) [Cicer arietinum]
Length=326

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  43   KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  102

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPL+LPLQDVYKIGGIGTVP+GRVETGV+KPG++VTFGP+GLTTEVKSVEMH
Sbjct  103  NEPKRPSDKPLKLPLQDVYKIGGIGTVPIGRVETGVIKPGVIVTFGPTGLTTEVKSVEMH  162

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  163  HEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  222

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  223  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETF  282

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  283  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  315



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+R+DEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KSRFDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  LEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+P+KPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPSKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>emb|CAD60652.1| elongation factor [Solanum tuberosum]
Length=447

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV E+SSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEISSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNL+WYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLEWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEA PGDNVGFNVKNVAVKDLKRG+VASNSK+DP K AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKEDPTKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SSYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY++KVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLEKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +E KRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NELKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE+EPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEREPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K RY+EIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KGRYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  185  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  244

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  245  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  304

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  305  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  364

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  365  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  424

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  425  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  457



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGLIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEA+QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIG 
Sbjct  284  HEAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGQ  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE+EPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEREPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EV SY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDL 
Sbjct  164  KARYDEIVKEVCSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLS  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP++KPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AIM48895.1| elongation factor 1-alpha, partial [Cinnamomum camphora]
Length=432

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  155  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  214

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  215  QEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMH  274

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKD+KRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  275  HEALQEALPGDNVGFNVKNVAVKDIKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  334

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  335  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  394

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  395  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  427



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPG++VTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGVIVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EA+PGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLPEAVPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERST LDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTTLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CDY58828.1| BnaAnng15460D [Brassica napus]
Length=568

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  142  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  201

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  202  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  261

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  262  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  321

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  322  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  381

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  382  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  414



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARY+EIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYEEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIVKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SGYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKD+KRGYVASNS DDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDIKRGYVASNSXDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KAR DEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARSDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF PSGL TEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLPTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKK PTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKHPTG  436



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG +KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGFIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSV+MH
Sbjct  224  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVKMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLPEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALLEASPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_004138964.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
 ref|XP_004162426.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=447

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRS KELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSAKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  STYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  STYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG24249.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=401

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  116  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  175

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  176  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  235

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  236  HESLPEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  295

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  296  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  355

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  356  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG +KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGFIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG +KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGFIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KK+GYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKIGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  436



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+RY+ IV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KSRYEVIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARY+EIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KGN51227.1| hypothetical protein Csa_5G495940 [Cucumis sativus]
Length=344

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 265/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+RYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  59   KSRYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  118

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF PSGLTTEVKSVEMH
Sbjct  119  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPSGLTTEVKSVEMH  178

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  179  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  238

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  239  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  298

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK V+KKD +G
Sbjct  299  SAYPPLGRFAVRDMRQTVAVGVIKAVEKKDASG  331



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG +KPGM+VTFGP+GLTTEVKSVEMH
Sbjct  224  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGFIKPGMIVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE LQEA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HETLQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHT HIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTCHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD++
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMV  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+F SQVIIMNHPGQIGN
Sbjct  284  HESLVEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFISQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARY+EIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYEEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMLKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASN KDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNPKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KI FVPISGFEGDNMI+RSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIAFVPISGFEGDNMIDRSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALPEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE L EA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HETLTEAHPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRP DKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPLDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  AEYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGIVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/273 (93%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K RY+EIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KGRYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDAI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKD+KRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN
Sbjct  284  HEALSEALPGDNVGFNVKNVAVKDIKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMMPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EV SY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVYSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRL LQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLALQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KA YDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KACYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKN AVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNFAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|KEH43533.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=347

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K RYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  63   KGRYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  122

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTF P+GLTTEVKSVEMH
Sbjct  123  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPTGLTTEVKSVEMH  182

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  183  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  242

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETF
Sbjct  243  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETF  302

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  303  SEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  335



>gb|KGN51228.1| Elongation factor 1-alpha [Cucumis sativus]
Length=402

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+RYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD +
Sbjct  117  KSRYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQV  176

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  177  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPTGLTTEVKSVEMH  236

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQVIIM HPGQIGN
Sbjct  237  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMKHPGQIGN  296

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  297  GYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  356

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  357  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  389



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLPEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMV M PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVMMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERST+LDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTSLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVVKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERS NLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSINLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKP MVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPAMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALVEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFNEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KK+PTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKEPTG  436



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGALKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKD +G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDASG  436



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+RY+EIV EVSSY+KKVGYNP+KI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KSRYEEIVKEVSSYLKKVGYNPEKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  436



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERS NLDWYKGP LLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSNNLDWYKGPNLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+P+KPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMVPSKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP DKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPLDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|ABB72813.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GL TEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLPTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT+QVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDC  SHIAVKFAE+LTKIDRRSGKELEKE KFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCTLSHIAVKFAEILTKIDRRSGKELEKEAKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERS NLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSNNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIVKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008233357.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
Length=447

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSK+DPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKEDPAREAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFNEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=446

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGALKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GY PVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYTPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKD +G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDASG  436



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KAR+DEIV EVSSY+KKVGYNPDK+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I
Sbjct  164  KARFDEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AEI29162.1| EF1a-like protein [Phalaenopsis hybrid cultivar]
Length=398

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERS+NLDWYKGPTLLEALDLI
Sbjct  115  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSSNLDWYKGPTLLEALDLI  174

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRP DKPLRLPLQDVYKIGGIGTVPVGRVETG LKPG+VVTFGP+GLTTEVKSVEMH
Sbjct  175  QEPKRPXDKPLRLPLQDVYKIGGIGTVPVGRVETGXLKPGIVVTFGPTGLTTEVKSVEMH  234

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  235  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  294

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  295  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  354

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  355  AEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  387



>ref|XP_010669657.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
 ref|XP_010669662.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 270/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARY+EIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRG+VAS+SK+DPAK AA+FT+QVIIMNHPGQIGN
Sbjct  284  HESLPEALPGDNVGFNVKNVAVKDLKRGFVASDSKNDPAKEAANFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_009380678.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380679.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380680.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVV+FGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVSFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+P+KPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPSKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            + YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  AAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRP DKPLRLPLQ+VYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPLDKPLRLPLQNVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  AEYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 265/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EA PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGN
Sbjct  284  HESLTEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+RYDEIV EVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KSRYDEIVKEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKGVEKKDPSG  436



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGD+GMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDSGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_004163381.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha-like 
[Cucumis sativus]
Length=449

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+ KVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLXKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EA+PGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLPEAVPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AHB86963.1| elongation factor 1-alpha [Sedum alfredii]
Length=447

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTFGP+GLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMVPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_003558459.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003577316.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003581689.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228997.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228998.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
Length=447

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDK+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMIVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGIVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            + YPPLGRFAVRDMRQTVAVGVIK V+KKDPTG
Sbjct  404  AMYPPLGRFAVRDMRQTVAVGVIKGVEKKDPTG  436



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARY+EIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYEEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRL LQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLALQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K RY+EIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KGRYEEIVKEVSSYIKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  VEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/273 (94%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EV+ Y+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVALYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  LEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  STYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            +ARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  RARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEA+QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+F +QVIIMNHPGQIG 
Sbjct  284  HEAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFIAQVIIMNHPGQIGQ  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMTPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTV V VIK+VDKKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVTVSVIKSVDKKDPTG  436



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 265/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARY+EI  EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYEEITKEVSSYIKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHT HIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTCHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  436



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KAR+DEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARFDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HESLPEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEA PGDNVGFNVKNVAVKDLKRG+VASNSK+DPAK AA+FTSQVIIMNHPGQI N
Sbjct  284  HEALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKEDPAKEAANFTSQVIIMNHPGQISN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+P+KPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPSKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGI15328.1| elongation factor 1 [Aegiceras corniculatum]
Length=449

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EV+SY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD +
Sbjct  164  KARYDEIVKEVASYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQV  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK A+SFTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEASSFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMNPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            S YPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  404  SAYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_002279598.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN66350.1| hypothetical protein VITISV_044270 [Vitis vinifera]
Length=447

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+RYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I
Sbjct  164  KSRYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L E LPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQIGN
Sbjct  284  HESLVEGLPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+ TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEITTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AGV54713.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 264/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTF PSGLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
             EYPP GRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  FEYPPFGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG LKPGM+VTF P+GLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTLKPGMLVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+LQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIG 
Sbjct  284  HESLQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGQ  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEMLTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
             E PPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  WESPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002312029.1| ADR12-2 family protein [Populus trichocarpa]
 gb|EEE89396.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/272 (93%), Positives = 265/272 (97%), Gaps = 0/272 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPG VVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGTVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHT HIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTCHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPT  143
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKD +
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDAS  435



>gb|AAF99703.1| elongation factor [Saccharum officinarum]
Length=448

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/273 (95%), Positives = 266/273 (97%), Gaps = 1/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  166  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  225

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  226  TEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  285

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFTSQV IMNHPGQIGN
Sbjct  286  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQV-IMNHPGQIGN  344

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKE KFLKNGDAGMVKM+PTKPMVVETF
Sbjct  345  GYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEAKFLKNGDAGMVKMIPTKPMVVETF  404

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVG+IK+V+KKDPTG
Sbjct  405  SEYPPLGRFAVRDMRQTVAVGIIKSVEKKDPTG  437



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/273 (94%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARY+EIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEA+ EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIG 
Sbjct  284  HEAMLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGQ  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010669658.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGR+ETGVLKPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRIETGVLKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRG+VAS+SK+DPAK AA+FT+QVIIMNHPGQIGN
Sbjct  284  HESLPEALPGDNVGFNVKNVAVKDLKRGFVASDSKNDPAKEAANFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  AEYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 265/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSD+PLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  SEPKRPSDEPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EA PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVIIMNHPGQIGN
Sbjct  284  HESLTEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_007218005.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
 gb|EMJ19204.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
Length=447

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/273 (93%), Positives = 268/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERS+NLDWYKGPTLLEALDLI
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSSNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRP+DKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFNEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002311107.1| ADR12-2 family protein [Populus trichocarpa]
 gb|ABK93463.1| unknown [Populus trichocarpa]
 gb|EEE88474.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/272 (93%), Positives = 265/272 (97%), Gaps = 0/272 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPG VVTFGP+GLTTEVKSVEMH
Sbjct  224  QEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGTVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHT HIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTCHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPT  143
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKD +
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDAS  435



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/273 (93%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K+RY+EIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KSRYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGPSGLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPSGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            +EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  AEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEI+ EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGM+VTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMLVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 265/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
             EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  SEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EA PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT+QVII+NHPGQIGN
Sbjct  284  HESLTEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVIIINHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_008380544.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
Length=447

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/273 (93%), Positives = 267/273 (98%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EVSSY+KKVGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KARYDEIVKEVSSYLKKVGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIVKPGMVVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT+QVIIMNHPGQI N
Sbjct  284  HEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVIIMNHPGQISN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAV+F E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKMLPTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVRFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMLPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010669660.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669661.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 269/273 (99%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARY+EIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI
Sbjct  164  KARYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGM+VTFGP+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMLVTFGPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE+L EALPGDNVGFNVKNVAVKDLKRG+VAS+SK+DPAK AA+F +QVIIMNHPGQIGN
Sbjct  284  HESLPEALPGDNVGFNVKNVAVKDLKRGFVASDSKNDPAKEAANFIAQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 266/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            K RYDEIV EVSSY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  164  KGRYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  223

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTF P+GLTTEVKSVEMH
Sbjct  224  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPTGLTTEVKSVEMH  283

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FTSQVIIMNHPGQIGN
Sbjct  284  HEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGN  343

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+PTKPMVVETF
Sbjct  344  GYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMIPTKPMVVETF  403

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  404  SEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  436



>ref|NP_001183947.1| uncharacterized protein LOC100502553 [Zea mays]
 gb|ACF84684.1| unknown [Zea mays]
Length=399

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/273 (93%), Positives = 264/273 (97%), Gaps = 0/273 (0%)
 Frame = -2

Query  958  KARYDEIVXEVSSYMKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI  779
            KARYDEIV EV SY+KKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I
Sbjct  116  KARYDEIVKEVGSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQI  175

Query  778  HEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMH  599
            +EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTF P+GLTTEVKSVEMH
Sbjct  176  NEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVTFAPTGLTTEVKSVEMH  235

Query  598  HEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVIIMNHPGQIGN  419
            HE +QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT+QVIIMNHPGQIGN
Sbjct  236  HETMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTAQVIIMNHPGQIGN  295

Query  418  GYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVETF  239
            GYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE  PKFLKNGDAG VKM+PTKPMVVETF
Sbjct  296  GYAPVLDCHTSHIAVKFSELLTKIDRRSGKELESAPKFLKNGDAGFVKMIPTKPMVVETF  355

Query  238  SEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  140
            SEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  356  SEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2249171514945