BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038G09

Length=881
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587099.1|  PREDICTED: tRNA dimethylallyltransferase 9         297   7e-94   Nicotiana tomentosiformis
ref|XP_009760198.1|  PREDICTED: tRNA dimethylallyltransferase 9         295   3e-93   Nicotiana sylvestris
ref|XP_004294141.2|  PREDICTED: tRNA dimethylallyltransferase 9         295   5e-93   Fragaria vesca subsp. vesca
emb|CBI20214.3|  unnamed protein product                                291   9e-92   Vitis vinifera
ref|XP_002283012.1|  PREDICTED: tRNA dimethylallyltransferase 9         290   2e-91   Vitis vinifera
ref|XP_006358948.1|  PREDICTED: tRNA dimethylallyltransferase 9-l...    288   3e-90   Solanum tuberosum [potatoes]
gb|KDP32503.1|  hypothetical protein JCGZ_14706                         288   3e-90   Jatropha curcas
ref|XP_004251888.1|  PREDICTED: tRNA dimethylallyltransferase 9         287   5e-90   Solanum lycopersicum
gb|KHG00135.1|  tRNA dimethylallyltransferase 9 -like protein           285   2e-89   Gossypium arboreum [tree cotton]
ref|XP_008386239.1|  PREDICTED: tRNA dimethylallyltransferase 9         285   3e-89   
ref|XP_007213909.1|  hypothetical protein PRUPE_ppa005482mg             284   5e-89   Prunus persica
ref|XP_008226503.1|  PREDICTED: tRNA dimethylallyltransferase 9         284   8e-89   Prunus mume [ume]
ref|XP_009340250.1|  PREDICTED: tRNA dimethylallyltransferase 9         283   3e-88   Pyrus x bretschneideri [bai li]
ref|XP_011006723.1|  PREDICTED: tRNA dimethylallyltransferase 9         281   5e-88   Populus euphratica
ref|XP_008382074.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    274   2e-87   
ref|XP_007021669.1|  Isopentenyltransferase 9 isoform 1                 278   9e-87   Theobroma cacao [chocolate]
gb|EYU45006.1|  hypothetical protein MIMGU_mgv1a0264152mg               273   1e-86   Erythranthe guttata [common monkey flower]
ref|XP_010060666.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    279   1e-86   
gb|KCW67467.1|  hypothetical protein EUGRSUZ_F01210                     278   3e-86   Eucalyptus grandis [rose gum]
ref|XP_010675404.1|  PREDICTED: tRNA dimethylallyltransferase 9         276   5e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011082747.1|  PREDICTED: tRNA dimethylallyltransferase 9         276   6e-86   Sesamum indicum [beniseed]
emb|CDP05986.1|  unnamed protein product                                276   1e-85   Coffea canephora [robusta coffee]
ref|XP_002300421.2|  hypothetical protein POPTR_0001s38570g             275   1e-85   
ref|XP_002524264.1|  ATP binding protein, putative                      275   2e-85   Ricinus communis
ref|XP_004137218.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    276   3e-85   Cucumis sativus [cucumbers]
ref|XP_010279079.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    274   4e-85   Nelumbo nucifera [Indian lotus]
ref|XP_010060664.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    275   5e-85   
gb|KJB61644.1|  hypothetical protein B456_009G372500                    273   9e-85   Gossypium raimondii
gb|KJB61645.1|  hypothetical protein B456_009G372500                    273   1e-84   Gossypium raimondii
ref|XP_008451715.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    273   2e-84   Cucumis melo [Oriental melon]
ref|XP_008451716.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    273   2e-84   
gb|KDO48346.1|  hypothetical protein CISIN_1g012837mg                   268   5e-84   Citrus sinensis [apfelsine]
emb|CDX70907.1|  BnaC03g09910D                                          271   8e-84   
emb|CDX88863.1|  BnaA03g07860D                                          271   1e-83   
gb|KDO48344.1|  hypothetical protein CISIN_1g012837mg                   268   8e-83   Citrus sinensis [apfelsine]
ref|XP_006485669.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    268   8e-83   Citrus sinensis [apfelsine]
ref|XP_006451734.1|  hypothetical protein CICLE_v10008222mg             268   1e-82   Citrus clementina [clementine]
ref|XP_006451735.1|  hypothetical protein CICLE_v10008222mg             268   1e-82   
ref|XP_006400569.1|  hypothetical protein EUTSA_v10013462mg             267   3e-82   Eutrema salsugineum [saltwater cress]
ref|XP_009131765.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    265   1e-81   Brassica rapa
gb|KEH38634.1|  tRNA dimethylallyltransferase                           265   2e-81   Medicago truncatula
gb|AFK38918.1|  unknown                                                 258   3e-81   Medicago truncatula
gb|KFK26250.1|  hypothetical protein AALP_AA8G222700                    264   4e-81   Arabis alpina [alpine rockcress]
ref|XP_010454298.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    261   9e-81   Camelina sativa [gold-of-pleasure]
ref|XP_002873979.1|  ATIPT9                                             263   1e-80   
gb|AAM63091.1|  IPP transferase-like protein                            263   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851043.1|  tRNA isopentenyltransferase AtIPT9                    263   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126411.1|  PREDICTED: tRNA dimethylallyltransferase 9         263   2e-80   Brassica rapa
ref|XP_010493097.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    260   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006594736.1|  PREDICTED: tRNA dimethylallyltransferase 9-l...    258   3e-80   
ref|XP_010454297.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    261   4e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010493096.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    261   5e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010420835.1|  PREDICTED: tRNA dimethylallyltransferase 9-l...    259   5e-80   
ref|XP_009394407.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    260   7e-80   
ref|XP_008811501.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    261   1e-79   Phoenix dactylifera
ref|XP_008811491.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    261   1e-79   Phoenix dactylifera
ref|XP_008811509.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    261   1e-79   Phoenix dactylifera
ref|XP_008811484.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    261   1e-79   Phoenix dactylifera
ref|XP_009394389.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    260   1e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008811477.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    261   1e-79   
ref|XP_008811471.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    261   1e-79   
ref|XP_010941327.1|  PREDICTED: tRNA dimethylallyltransferase 9         260   2e-79   Elaeis guineensis
ref|XP_010420834.1|  PREDICTED: tRNA dimethylallyltransferase 9-l...    259   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_003543220.1|  PREDICTED: tRNA dimethylallyltransferase 9-l...    258   5e-79   Glycine max [soybeans]
ref|XP_010520596.1|  PREDICTED: tRNA dimethylallyltransferase 9         258   1e-78   Tarenaya hassleriana [spider flower]
ref|XP_006287693.1|  hypothetical protein CARUB_v10000903mg             257   2e-78   Capsella rubella
ref|XP_004489048.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    257   2e-78   Cicer arietinum [garbanzo]
ref|NP_001190344.1|  tRNA isopentenyltransferase AtIPT9                 256   5e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007149408.1|  hypothetical protein PHAVU_005G067800g             255   1e-77   Phaseolus vulgaris [French bean]
ref|NP_568390.2|  tRNA isopentenyltransferase AtIPT9                    251   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006852479.1|  hypothetical protein AMTR_s00021p00131420          251   7e-76   Amborella trichopoda
gb|KDO48345.1|  hypothetical protein CISIN_1g012837mg                   246   1e-74   Citrus sinensis [apfelsine]
ref|XP_006451736.1|  hypothetical protein CICLE_v10008222mg             245   6e-74   
ref|XP_003563223.2|  PREDICTED: tRNA dimethylallyltransferase 9         236   2e-70   Brachypodium distachyon [annual false brome]
ref|XP_006656524.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    232   4e-69   Oryza brachyantha
ref|NP_001058651.2|  Os06g0729800                                       229   3e-68   
dbj|BAD62118.1|  putative tRNA isopentenyltransferase                   228   4e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002437643.1|  hypothetical protein SORBIDRAFT_10g031125          226   6e-67   
dbj|BAJ89736.1|  predicted protein                                      226   1e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001127753.1|  isopentenyl transferase                            225   2e-66   
ref|XP_008647277.1|  PREDICTED: isopentenyl transferase isoform X1      225   2e-66   
gb|EMS61041.1|  tRNA dimethylallyltransferase 9                         223   1e-65   Triticum urartu
gb|EMT06411.1|  tRNA Delta(2)-isopentenylpyrophosphate transferase      223   2e-65   
ref|XP_002463348.1|  hypothetical protein SORBIDRAFT_02g042160          219   2e-64   
ref|XP_004963310.1|  PREDICTED: tRNA dimethylallyltransferase 9-like    220   3e-64   Setaria italica
gb|AGT16524.1|  isopentenyl transferase                                 219   7e-64   Saccharum hybrid cultivar R570
gb|EPS66580.1|  hypothetical protein M569_08195                         207   4e-60   Genlisea aurea
ref|XP_010108266.1|  tRNA dimethylallyltransferase 9                    205   1e-58   
ref|XP_002970127.1|  hypothetical protein SELMODRAFT_410898             194   2e-54   
ref|XP_002985201.1|  hypothetical protein SELMODRAFT_424359             192   7e-54   
ref|XP_001782787.1|  predicted protein                                  161   3e-41   
dbj|BAG68561.1|  isopentenyl transferase                                154   1e-39   Physcomitrella patens
gb|ABP88738.1|  tRNA-isopentenyltransferase                             153   9e-39   Physcomitrella patens
gb|AGC04674.1|  tRNA-isopentenyltransferase                             149   2e-37   Physcomitrella patens
ref|XP_010279080.1|  PREDICTED: tRNA dimethylallyltransferase 9 i...    146   3e-37   Nelumbo nucifera [Indian lotus]
gb|AGC04673.1|  tRNA-isopentenyltransferase                             146   3e-36   Physcomitrella patens
ref|XP_001780492.1|  predicted protein                                  147   3e-36   
dbj|BAG68564.1|  isopentenyl transferase                                137   7e-35   Physcomitrella patens
ref|XP_001767747.1|  predicted protein                                  141   1e-34   
ref|XP_001754594.1|  predicted protein                                  138   2e-33   
ref|XP_005643818.1|  isopentenyl transferase                            131   5e-32   Coccomyxa subellipsoidea C-169
ref|XP_001763870.1|  predicted protein                                  131   1e-30   
dbj|BAG68563.1|  isopentenyl transferase                                122   1e-28   Physcomitrella patens
ref|XP_003080095.1|  tRNA isopentenyltransferase 9 / IPP transfer...    122   2e-28   
emb|CEF98535.1|  tRNA isopentenyltransferase                            122   2e-28   Ostreococcus tauri
ref|XP_001771407.1|  predicted protein                                  120   1e-26   
ref|XP_002500269.1|  predicted protein                                  110   2e-24   Micromonas commoda
ref|WP_042103588.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    108   1e-23   
ref|XP_005539056.1|  tRNA isopentenyltransferase                        110   1e-23   Cyanidioschyzon merolae strain 10D
ref|XP_007513069.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    108   4e-23   Bathycoccus prasinos
gb|KIY99342.1|  tRNA dimethylallyltransferase                           108   1e-22   Monoraphidium neglectum
ref|WP_042239754.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    105   2e-22   
ref|WP_039384140.1|  tRNA delta(2)-isopentenylpyrophosphate trans...    105   2e-22   Neochlamydia sp. TUME1
gb|KIC76632.1|  tRNA dimethylallyltransferase                           105   2e-22   Neochlamydia sp. TUME1
ref|XP_005702562.1|  tRNA dimethylallyltransferase isoform 1            103   6e-22   Galdieria sulphuraria
gb|KIC73229.1|  tRNA dimethylallyltransferase                           103   6e-22   Neochlamydia sp. EPS4
ref|XP_001418572.1|  predicted protein                                  103   8e-22   Ostreococcus lucimarinus CCE9901
ref|XP_005708068.1|  tRNA dimethylallyltransferase isoform 2            103   8e-22   Galdieria sulphuraria
ref|XP_007021670.1|  Isopentenyltransferase 9 isoform 2                 102   2e-21   
ref|XP_003061927.1|  predicted protein                                  100   5e-21   Micromonas pusilla CCMP1545
ref|XP_002949722.1|  hypothetical protein VOLCADRAFT_90025              102   7e-21   Volvox carteri f. nagariensis
ref|XP_005702563.1|  tRNA dimethylallyltransferase isoform 2          99.8    1e-20   Galdieria sulphuraria
ref|XP_005708069.1|  tRNA dimethylallyltransferase isoform 1          99.8    2e-20   Galdieria sulphuraria
gb|EKE08074.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    96.3    5e-20   uncultured bacterium
gb|KDD75968.1|  IPP transferase                                       98.2    7e-20   Helicosporidium sp. ATCC 50920
ref|WP_032125950.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.7    1e-19   Candidatus Protochlamydia
emb|CCB92254.1|  trNA dimethylallyltransferase                        95.5    2e-19   Waddlia chondrophila 2032/99
ref|WP_041018636.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  96.3    2e-19   
gb|ADI38731.1|  tRNA delta-2-isopentenylpyrophosphate transferase     95.9    2e-19   Waddlia chondrophila WSU 86-1044
ref|WP_041941869.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.9    2e-19   
emb|CDR35057.1|  tRNA dimethylallyltransferase                        95.9    2e-19   Criblamydia sequanensis CRIB-18
ref|WP_006340845.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.5    3e-19   Parachlamydia acanthamoebae
gb|KIC71336.1|  tRNA dimethylallyltransferase                         95.5    4e-19   Candidatus Protochlamydia amoebophila
ref|WP_011175793.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    4e-19   Candidatus Protochlamydia amoebophila
ref|WP_039359474.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    4e-19   Candidatus Protochlamydia
ref|WP_042282692.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  95.1    4e-19   
gb|KIA77950.1|  tRNA dimethylallyltransferase                         95.1    4e-19   Parachlamydia acanthamoebae
ref|XP_005843467.1|  hypothetical protein CHLNCDRAFT_55198            95.9    8e-19   Chlorella variabilis
ref|XP_011398588.1|  tRNA dimethylallyltransferase                    93.2    2e-18   Auxenochlorella protothecoides
emb|CDZ80405.1|  tRNA dimethylallyltransferase                        89.0    7e-17   Candidatus Rubidus massiliensis
ref|WP_041419427.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  87.4    1e-16   
emb|CCB89591.1|  tRNA dimethylallyltransferase                        87.4    2e-16   Simkania negevensis Z
gb|EWM22660.1|  trna dimethylallyltransferase 9                       84.7    5e-15   Nannochloropsis gaditana
ref|XP_001771357.1|  predicted protein                                84.7    9e-15   
emb|CDP18385.1|  unnamed protein product                              77.4    1e-14   Coffea canephora [robusta coffee]
ref|XP_009033241.1|  hypothetical protein AURANDRAFT_61466            79.7    3e-13   Aureococcus anophagefferens
ref|XP_002289575.1|  predicted protein                                79.0    4e-13   Thalassiosira pseudonana CCMP1335
ref|WP_039232526.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  77.8    4e-13   Quasibacillus thermotolerans
ref|XP_005831647.1|  hypothetical protein GUITHDRAFT_139595           77.4    1e-12   Guillardia theta CCMP2712
ref|WP_026867636.1|  hypothetical protein                             76.3    1e-12   Jeotgalicoccus marinus
ref|WP_019138303.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  75.1    3e-12   Peptoniphilus timonensis
ref|WP_021170642.1|  tRNA dimethylallyltransferase                    74.7    4e-12   Sporomusa
ref|WP_029071130.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  74.3    5e-12   Kandleria vitulina
ref|WP_031588514.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  74.3    5e-12   Kandleria vitulina
ref|WP_009646516.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  74.3    6e-12   Selenomonas sp. CM52
ref|WP_019124440.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  73.6    1e-11   Peptoniphilus grossensis
ref|WP_026651178.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  73.6    1e-11   Butyrivibrio proteoclasticus
ref|XP_002673426.1|  predicted protein                                74.3    1e-11   Naegleria gruberi strain NEG-M
ref|WP_009145914.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  73.2    1e-11   Phascolarctobacterium succinatutens
ref|WP_027436413.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  73.2    1e-11   Lachnospiraceae bacterium AB2028
ref|WP_021720023.1|  tRNA dimethylallyltransferase                    73.2    2e-11   
ref|WP_006192177.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  73.2    2e-11   Selenomonas sputigena
ref|WP_027396120.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  72.8    2e-11   Anaerovibrio lipolyticus
ref|WP_027406444.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  72.8    2e-11   Anaerovibrio sp. RM50
ref|WP_015262297.1|  tRNA dimethylallyltransferase                    72.4    3e-11   Desulfitobacterium dichloroeliminans
ref|WP_043904210.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  72.4    3e-11   Parageobacillus genomosp. 1
ref|WP_036085506.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  72.0    3e-11   Listeria booriae
ref|WP_017435038.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  72.4    3e-11   Bacillaceae
ref|WP_029281153.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  72.0    4e-11   
ref|WP_029565656.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  72.0    4e-11   
ref|XP_011403813.1|  PREDICTED: tRNA dimethylallyltransferase 9-like  72.8    4e-11   
ref|WP_033169130.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  72.0    4e-11   Selenomonas sp. ND2010
ref|WP_019542098.1|  hypothetical protein                             72.0    4e-11   Selenomonas bovis
ref|WP_009441886.1|  tRNA dimethylallyltransferase                    72.0    5e-11   Selenomonas sp. oral taxon 138
ref|WP_003677310.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  71.6    6e-11   Lactobacillus coryniformis
ref|WP_009214871.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  71.6    6e-11   Oribacterium sp. oral taxon 078
ref|WP_029540539.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  71.6    6e-11   Selenomonas ruminantium
gb|EJW02995.1|  hypothetical protein EDEG_02639                       71.2    6e-11   Edhazardia aedis USNM 41457
gb|KGP68458.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    70.9    7e-11   
ref|WP_010011053.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  71.2    7e-11   Lactobacillus coryniformis
ref|WP_026487830.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  71.2    7e-11   Butyrivibrio sp. XBB1001
ref|WP_007288351.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  71.2    8e-11   Thermosinus carboxydivorans
emb|CDI69493.1|  tRNA dimethylallyltransferase (Dime thylallyl di...  71.2    9e-11   Lactobacillus fermentum L930BB
ref|WP_003683781.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.9    9e-11   Lactobacillus fermentum
dbj|GAK08955.1|  tRNA delta(2)-isopentenylpyrophosphate transferase   70.5    9e-11   Geomicrobium sp. JCM 19038
ref|WP_015639231.1|  tRNA Delta(2)-isopentenylpyrophosphate trans...  70.9    9e-11   Lactobacillus
ref|WP_014562542.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.9    9e-11   Lactobacillus fermentum
ref|WP_031556857.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.9    9e-11   Lachnospiraceae bacterium FD2005
ref|WP_021349189.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.9    9e-11   Lactobacillus fermentum
ref|WP_029505954.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.9    9e-11   Lachnospiraceae bacterium AC2012
ref|WP_013877177.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.9    1e-10   Parageobacillus thermoglucosidasius
ref|WP_027432968.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.9    1e-10   Lachnospiraceae bacterium MD2004
ref|WP_040353778.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.9    1e-10   
ref|WP_021774291.1|  tRNA dimethylallyltransferase                    70.9    1e-10   Oribacterium sp. oral taxon 078
ref|WP_039205603.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.9    1e-10   Anaerovibrio lipolyticus
emb|CCQ98517.1|  tRNA dimethylallyltransferase                        70.9    1e-10   [Clostridium] ultunense Esp
ref|WP_023510047.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.9    1e-10   Sporolactobacillus laevolacticus
ref|WP_034658493.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.9    1e-10   
ref|WP_021718557.1|  tRNA dimethylallyltransferase                    70.9    1e-10   
ref|WP_027215856.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.5    1e-10   Butyrivibrio fibrisolvens
ref|WP_005398122.1|  tRNA dimethylallyltransferase                    70.5    2e-10   Helcococcus kunzii
ref|WP_027218383.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.5    2e-10   Butyrivibrio fibrisolvens
ref|WP_019850479.1|  tRNA dimethylallyltransferase                    70.5    2e-10   Desulfitobacterium sp. PCE1
ref|WP_009330586.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.5    2e-10   Bacillus sp. 2_A_57_CT2
ref|WP_016459580.1|  tRNA dimethylallyltransferase                    70.1    2e-10   Acidaminococcus sp. HPA0509
ref|WP_039944259.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.1    2e-10   
ref|WP_019381817.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.1    2e-10   Bacillus oceanisediminis
ref|WP_014794023.1|  tRNA dimethylallyltransferase                    70.1    2e-10   Desulfitobacterium dehalogenans
ref|WP_022223151.1|  tRNA dimethylallyltransferase                    70.1    2e-10   
ref|WP_027204115.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.1    2e-10   Butyrivibrio
ref|WP_003251543.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  70.1    2e-10   Bacillaceae
ref|WP_027205748.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.1    2e-10   Butyrivibrio fibrisolvens
ref|WP_026515890.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.1    2e-10   Butyrivibrio sp. MC2021
ref|WP_022753896.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  69.7    2e-10   Butyrivibrio fibrisolvens
ref|WP_026668537.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.1    2e-10   Butyrivibrio sp. AE3009
ref|WP_031584720.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.1    2e-10   Selenomonas bovis
ref|WP_006695649.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  70.1    2e-10   Selenomonas noxia
ref|WP_040284514.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  69.3    3e-10   Tessaracoccus massiliensis
ref|WP_012739228.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  69.3    3e-10   [Eubacterium] eligens
ref|WP_036101723.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  69.3    3e-10   Listeria riparia
ref|WP_012391462.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  69.3    3e-10   Lactobacillus fermentum
ref|WP_035330692.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  69.7    3e-10   Bacillus firmus
ref|WP_028584511.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  69.3    4e-10   Desulfobulbus mediterraneus
ref|WP_036065259.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  69.3    4e-10   Listeria grandensis
ref|WP_025951152.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  69.3    4e-10   Geobacillus
ref|WP_021716304.1|  tRNA dimethylallyltransferase                    68.2    4e-10   
gb|EUJ24809.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    69.3    4e-10   Listeria grandensis FSL F6-0971
ref|XP_006358949.1|  PREDICTED: tRNA dimethylallyltransferase 9-l...  69.7    4e-10   Solanum tuberosum [potatoes]
ref|WP_019107145.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  68.9    4e-10   Peptoniphilus senegalensis
gb|KIL73665.1|  tRNA dimethylallyltransferase                         68.9    5e-10   Bacillus badius
ref|WP_022791389.1|  transposase                                      68.9    5e-10   Weissella halotolerans
ref|WP_005835646.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  68.9    5e-10   Bacillales
ref|WP_041100150.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  68.9    5e-10   Bacillus badius
ref|WP_009015655.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  68.9    5e-10   Acidaminococcus intestini
ref|WP_027322432.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  68.9    6e-10   Bacillus sp. URHB0009
gb|KIL80673.1|  tRNA dimethylallyltransferase                         68.6    6e-10   Bacillus badius
ref|WP_021870602.1|  tRNA dimethylallyltransferase                    68.2    7e-10   
ref|WP_009616762.1|  tRNA dimethylallyltransferase                    68.6    7e-10   Desulfosporosinus sp. OT
ref|WP_041113123.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  68.6    7e-10   Bacillus badius
ref|WP_040220801.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  68.6    7e-10   Collinsella sp. MS5
ref|WP_022387376.1|  tRNA dimethylallyltransferase                    68.6    8e-10   
ref|WP_004165698.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  68.2    8e-10   Pediococcus acidilactici
ref|WP_025021832.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  68.2    8e-10   Lactobacillus hayakitensis
ref|WP_015739879.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  68.2    9e-10   Ammonifex degensii
ref|WP_008879547.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  68.2    1e-09   Geobacillus thermodenitrificans
ref|WP_011887177.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  68.2    1e-09   Geobacillus thermodenitrificans
ref|WP_005916569.1|  tRNA dimethylallyltransferase, miaA              67.8    1e-09   Pediococcus acidilactici
ref|WP_029760505.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Geobacillus
ref|WP_007786918.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Brevibacillus sp. CF112
ref|WP_025846031.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Brevibacillus agri
ref|WP_006694425.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Selenomonas noxia
ref|WP_033017285.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Geobacillus
ref|WP_020959437.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Geobacillus genomosp. 3
ref|WP_028977708.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Sporolactobacillus terrae
ref|WP_021933006.1|  tRNA dimethylallyltransferase                    67.8    1e-09   
ref|WP_020756044.1|  TRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Geobacillus
ref|WP_042382102.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Geobacillus kaustophilus
ref|WP_007956511.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Pelosinus fermentans
ref|WP_013145694.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  67.8    1e-09   Geobacillus
ref|WP_011230811.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  67.8    1e-09   Geobacillus
ref|WP_027714539.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Desulfuromonas sp. TF
ref|WP_008841393.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  67.8    1e-09   Pediococcus acidilactici
ref|WP_004165217.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.4    1e-09   Pediococcus acidilactici
ref|WP_024085329.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Bacillus amyloliquefaciens group
emb|CCC56131.1|  tRNA dimethylallyltransferase                        67.4    1e-09   Weissella thailandensis fsh4-2
ref|WP_008341649.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    1e-09   Alicyclobacillus acidocaldarius
ref|WP_028307274.1|  hypothetical protein                             67.8    2e-09   Desulfitibacter alkalitolerans
ref|WP_033829006.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.8    2e-09   Bacillus andreraoultii
ref|WP_005539953.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.4    2e-09   Johnsonella ignava
ref|WP_002831435.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.4    2e-09   Pediococcus acidilactici
ref|WP_024864741.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.4    2e-09   Butyrivibrio sp. FCS014
ref|WP_015863547.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.4    2e-09   Geobacillus sp. WCH70
ref|WP_044639771.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.4    2e-09   Risungbinella massiliensis
ref|WP_022783864.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.4    2e-09   Lachnospiraceae bacterium NK4A179
gb|AEH50708.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    67.0    2e-09   Pseudothermotoga thermarum DSM 5069
ref|WP_003672483.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.0    2e-09   Lactobacillus reuteri
ref|WP_009345879.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.7    2e-09   
ref|WP_044731654.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.0    2e-09   Geobacillus kaustophilus
ref|WP_026767567.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.0    2e-09   Selenomonas ruminantium
ref|WP_013523444.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  67.0    2e-09   
ref|WP_041446376.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.0    2e-09   
ref|WP_034986578.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.0    2e-09   
ref|WP_033120123.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.0    2e-09   
ref|WP_021737125.1|  tRNA dimethylallyltransferase                    67.0    3e-09   
ref|WP_027408788.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.0    3e-09   
ref|WP_026509332.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.0    3e-09   
ref|WP_015050481.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.0    3e-09   
ref|WP_028243759.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.0    3e-09   
gb|AGC72136.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    67.0    3e-09   
ref|WP_022098565.1|  tRNA dimethylallyltransferase                    67.0    3e-09   
ref|WP_034759926.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  67.0    3e-09   
ref|WP_033012149.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  66.6    3e-09   
ref|WP_007934336.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  66.6    3e-09   
ref|WP_029733875.1|  hypothetical protein                             66.6    3e-09   
ref|WP_022312491.1|  tRNA dimethylallyltransferase                    66.6    3e-09   
ref|WP_044384231.1|  tRNA dimethylallyltransferase                    67.0    3e-09   
ref|WP_027427589.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  66.6    3e-09   
ref|WP_016414331.1|  tRNA dimethylallyltransferase                    65.5    4e-09   
ref|WP_006305981.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  66.6    4e-09   
ref|WP_026506035.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  66.2    4e-09   
ref|WP_013238772.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  66.2    4e-09   
ref|WP_028236210.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  66.6    4e-09   
ref|WP_016301314.1|  tRNA dimethylallyltransferase                    66.6    4e-09   
ref|WP_035380136.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  66.2    4e-09   
ref|WP_044744158.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  66.2    4e-09   
ref|WP_009656441.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  66.6    4e-09   
ref|WP_036719091.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  66.2    4e-09   
ref|WP_022517462.1|  tRNA dimethylallyltransferase                    66.2    4e-09   
ref|WP_010753070.1|  tRNA dimethylallyltransferase                    66.2    4e-09   
gb|ERT67730.1|  tRNA dimethylallyltransferase                         66.2    5e-09   
ref|WP_019879486.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    5e-09   
ref|WP_026566589.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  66.2    5e-09   
gb|EID50267.1|  tRNA dimethylallyltransferase                         66.2    5e-09   
ref|WP_026559265.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.9    5e-09   
gb|EUJ36416.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    66.2    5e-09   
ref|WP_027889629.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  66.2    5e-09   
ref|WP_036062409.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.9    6e-09   
ref|WP_044337300.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.9    6e-09   
ref|WP_026508690.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.9    6e-09   
ref|WP_003154065.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.9    6e-09   
ref|WP_020156152.1|  hypothetical protein                             65.9    6e-09   
ref|WP_002833528.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.9    7e-09   
ref|WP_036755518.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    7e-09   
ref|WP_021918871.1|  tRNA dimethylallyltransferase                    65.9    7e-09   
ref|WP_041093372.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    7e-09   
ref|WP_011698775.1|  tRNA dimethylallyltransferase                    65.9    7e-09   
ref|WP_013624931.1|  tRNA dimethylallyltransferase                    65.9    7e-09   
ref|WP_002839108.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.9    7e-09   
ref|WP_022106609.1|  tRNA dimethylallyltransferase                    65.5    7e-09   
ref|WP_037287492.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    7e-09   
ref|WP_028329823.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    7e-09   
ref|WP_031410271.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    7e-09   
ref|WP_035112538.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    7e-09   
ref|WP_044504122.1|  tRNA dimethylallyltransferase                    65.5    8e-09   
ref|WP_012283610.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    8e-09   
ref|WP_002838371.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    8e-09   
ref|WP_041283253.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    9e-09   
ref|WP_010942643.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    9e-09   
ref|WP_042456655.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    9e-09   
ref|WP_013637921.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    9e-09   
ref|XP_004356040.1|  putative isopentenyltransferase                  65.9    9e-09   
ref|WP_005956433.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    9e-09   
ref|WP_026583336.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    9e-09   
ref|WP_041845208.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.5    9e-09   
ref|WP_021985498.1|  tRNA dimethylallyltransferase                    65.5    1e-08   
ref|WP_019034582.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
gb|KIO58884.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    65.5    1e-08   
ref|WP_044037425.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
gb|KIO70970.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    65.1    1e-08   
ref|WP_039639109.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  65.5    1e-08   
ref|WP_012469065.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
ref|WP_034769974.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
gb|KIR65675.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    65.1    1e-08   
ref|WP_016407333.1|  tRNA dimethylallyltransferase                    65.1    1e-08   
ref|WP_015509056.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
gb|AEG14918.1|  tRNA dimethylallyltransferase                         65.5    1e-08   
ref|WP_020311231.1|  MULTISPECIES: tRNA dimethylallyltransferase      65.1    1e-08   
ref|WP_034601879.1|  tRNA dimethylallyltransferase                    65.1    1e-08   
ref|WP_021959586.1|  tRNA dimethylallyltransferase                    65.1    1e-08   
ref|WP_043964204.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
ref|WP_025086934.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
ref|WP_022501790.1|  tRNA dimethylallyltransferase                    65.1    1e-08   
gb|KIO74218.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    65.1    1e-08   
ref|WP_022328910.1|  tRNA dimethylallyltransferase                    65.1    1e-08   
ref|WP_022291597.1|  tRNA dimethylallyltransferase                    64.7    1e-08   
ref|WP_027717245.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
ref|WP_034285747.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
ref|WP_007121723.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
ref|WP_036721720.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
ref|WP_009728105.1|  tRNA dimethylallyltransferase                    65.1    1e-08   
ref|WP_029321416.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
ref|WP_034540498.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.7    1e-08   
ref|WP_039945797.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.7    1e-08   
ref|WP_014464240.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  65.1    1e-08   
ref|WP_003717309.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.7    1e-08   
ref|WP_023440269.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.7    1e-08   
ref|WP_002836397.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.7    2e-08   
ref|WP_012938557.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.7    2e-08   
ref|WP_024094599.1|  tRNA dimethylallyltransferase MiaA               64.7    2e-08   
ref|WP_027724509.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.7    2e-08   
ref|WP_014935884.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_033935196.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_022553311.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  64.3    2e-08   
ref|WP_016379126.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_013114941.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_023482834.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_040513253.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_019253076.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_035766106.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
gb|ENH96676.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    64.3    2e-08   
dbj|GAK01656.1|  LOW QUALITY PROTEIN: tRNA dimethylallyltransferase   64.3    2e-08   
ref|WP_014417832.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  64.3    2e-08   
ref|WP_044801457.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_017417822.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_043021118.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_022047040.1|  tRNA dimethylallyltransferase                    64.3    2e-08   
ref|WP_004824153.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    2e-08   
ref|WP_010632769.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_028394465.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_036094169.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  64.3    2e-08   
ref|WP_012810827.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_032874989.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  64.3    2e-08   
ref|WP_022513843.1|  tRNA dimethylallyltransferase                    63.9    2e-08   
emb|CBJ48350.1|  putative tRNA isopentenyltransferase                 64.7    2e-08   
ref|WP_006003027.1|  tRNA isopentenyltransferase                      63.9    3e-08   
ref|WP_012670215.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_037354415.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_021493647.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
gb|EFM39113.1|  tRNA dimethylallyltransferase [ [                     62.4    3e-08   
ref|WP_035167272.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_007611596.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  63.9    3e-08   
ref|WP_016280823.1|  tRNA dimethylallyltransferase                    63.9    3e-08   
ref|WP_032871538.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_020955854.1|  tRNA isopentenylpyrophosphate transferase        63.9    3e-08   
ref|WP_015388203.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  63.9    3e-08   
ref|WP_038463924.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_025284767.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_015239900.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_007410375.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  63.9    3e-08   
ref|WP_015891653.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_032861264.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
gb|AHK49269.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    63.9    3e-08   
ref|WP_044745316.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_029973434.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  63.9    3e-08   
ref|WP_016496714.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_035156911.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_019119215.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_014356584.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_022297636.1|  tRNA dimethylallyltransferase                    63.9    3e-08   
ref|WP_038123513.1|  tRNA dimethylallyltransferase                    63.9    3e-08   
ref|WP_003675695.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_033227957.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_010718714.1|  tRNA dimethylallyltransferase                    63.9    3e-08   
ref|WP_035343862.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_027112409.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_022488318.1|  tRNA dimethylallyltransferase                    63.9    3e-08   
ref|WP_038670673.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_003575364.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  63.5    3e-08   
ref|WP_035286662.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.9    3e-08   
ref|WP_034438475.1|  hypothetical protein                             63.5    4e-08   
ref|WP_022424193.1|  tRNA dimethylallyltransferase                    63.5    4e-08   
emb|CCK22786.1|  tRNA dimethylallyltransferase                        63.5    4e-08   
ref|WP_003598953.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  63.5    4e-08   
ref|WP_037573964.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_016383063.1|  tRNA delta(2)-isopentenylpyrophosphatetransf...  63.5    4e-08   
ref|WP_003755366.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_039120851.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_003579506.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_034867320.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_034698953.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_042542438.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
gb|KGG50088.1|  tRNA dimethylallyltransferase                         63.9    4e-08   
ref|WP_035169284.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_029453071.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_035663710.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
gb|KDP13300.1|  tRNA delta(2)-isopentenylpyrophosphate transferase    63.5    4e-08   
dbj|GAE34694.1|  tRNA delta(2)-isopentenylpyrophosphate transferase   63.5    4e-08   
ref|WP_021685115.1|  tRNA dimethylallyltransferase                    63.5    4e-08   
dbj|GAN33148.1|  tRNA isopentenylpyrophosphate transferase            63.5    4e-08   
ref|WP_003605308.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_022254969.1|  tRNA dimethylallyltransferase                    63.5    4e-08   
ref|WP_005225164.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_035627490.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_009381821.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_006774745.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_041077013.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    4e-08   
ref|WP_034548786.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    4e-08   
ref|WP_019227017.1|  MULTISPECIES: tRNA dimethylallyltransferase      63.2    4e-08   
ref|WP_034142240.1|  tRNA dimethylallyltransferase                    63.5    4e-08   
ref|WP_026760298.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    5e-08   
ref|WP_013172755.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    5e-08   
ref|WP_016743402.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.5    5e-08   
ref|WP_003664038.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    5e-08   
ref|WP_022364671.1|  tRNA dimethylallyltransferase                    63.5    5e-08   
ref|WP_044746912.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    5e-08   
ref|WP_005383267.1|  tRNA dimethylallyltransferase                    63.2    5e-08   
ref|WP_021955138.1|  tRNA dimethylallyltransferase                    63.2    5e-08   
ref|WP_026528920.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    5e-08   
ref|WP_014487555.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    5e-08   
ref|WP_013352351.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  63.2    5e-08   
ref|WP_035178562.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    5e-08   
ref|WP_020004444.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    5e-08   
ref|WP_021802075.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    5e-08   
ref|WP_012858354.1|  tRNA dimethylallyltransferase                    63.2    5e-08   
gb|EGS30201.1|  tRNA dimethylallyltransferase                         60.8    5e-08   
ref|WP_036078782.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    5e-08   
ref|WP_010747466.1|  tRNA dimethylallyltransferase                    63.2    5e-08   
ref|WP_019252485.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    5e-08   
ref|WP_035154695.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    5e-08   
ref|WP_015944193.1|  tRNA dimethylallyltransferase                    63.2    6e-08   
ref|XP_004342118.1|  isopentenyltransferase                           63.2    6e-08   
ref|WP_035153136.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    6e-08   
ref|WP_034298953.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    6e-08   
ref|WP_014262610.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  63.2    6e-08   
ref|WP_014903300.1|  tRNA dimethylallyltransferase                    63.2    6e-08   
ref|WP_015274151.1|  tRNA-delta(2)-isopentenylpyrophosphate trans...  63.2    6e-08   
ref|WP_026666763.1|  MULTISPECIES: tRNA delta(2)-isopentenylpyrop...  63.2    6e-08   
ref|WP_008724554.1|  miaA, tR delta(2)-isopentenylpyrophosphate t...  62.8    6e-08   
ref|WP_011736796.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  62.8    6e-08   
ref|WP_003668437.1|  tRNA delta(2)-isopentenylpyrophosphate trans...  62.8    6e-08   



>ref|XP_009587099.1| PREDICTED: tRNA dimethylallyltransferase 9 [Nicotiana tomentosiformis]
Length=463

 Score =   297 bits (760),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 173/207 (84%), Gaps = 0/207 (0%)
 Frame = -1

Query  881  GVtdtsdissstDGLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSE  702
            GV D +D+ +S D LQQS +KDL+YDFLC FL+T RLDLYRSIDFRCEDMLL   G+LSE
Sbjct  245  GVADAADVKNSADKLQQSNKKDLEYDFLCYFLSTNRLDLYRSIDFRCEDMLLGTDGILSE  304

Query  701  ARGLLDLGLLPNSNSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAK  522
            AR LLDLGLLPNSNSA+RAIGYRQAMEYLL CRE G  +S  DF+ FLSEFQKASRNFAK
Sbjct  305  ARWLLDLGLLPNSNSATRAIGYRQAMEYLLRCREYGSWNSAGDFYEFLSEFQKASRNFAK  364

Query  521  RQLTWFRNEPLYHWIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEM  342
            RQ+TWFRNE +Y WIDA +P+  VL FI DSY SQ GHL+VP+SL +KK+I + R+VAE+
Sbjct  365  RQMTWFRNEQIYEWIDACKPLEKVLSFICDSYSSQEGHLQVPESLRMKKDIRNPRQVAEL  424

Query  341  KTYRPRNQHFIGREDCTPVLNWIQSIY  261
            K YR RN+HFIGREDC+ VL+WI+++Y
Sbjct  425  KAYRTRNRHFIGREDCSDVLDWIKTMY  451



>ref|XP_009760198.1| PREDICTED: tRNA dimethylallyltransferase 9 [Nicotiana sylvestris]
Length=463

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -1

Query  881  GVtdtsdissstDGLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSE  702
            GV D +D+ +S D LQ S +KDL+YDFLC FL+T RLDLYRSIDFRCEDMLL   G+LSE
Sbjct  245  GVADVADVKNSADKLQLSNKKDLEYDFLCYFLSTNRLDLYRSIDFRCEDMLLGTDGILSE  304

Query  701  ARGLLDLGLLPNSNSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAK  522
            AR LLDLGLLPNSNSA+RAIGYRQAMEYLL CRE G  +S  DF+ FLSEFQKASRNFAK
Sbjct  305  ARWLLDLGLLPNSNSATRAIGYRQAMEYLLRCREYGSWNSAGDFYEFLSEFQKASRNFAK  364

Query  521  RQLTWFRNEPLYHWIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEM  342
            RQ+TWFRNE +Y W+DAS+P+  VL FI DSY SQ GHL+VP+SL +KK+I + R+VAE+
Sbjct  365  RQMTWFRNEQIYEWLDASKPLEKVLSFICDSYSSQEGHLQVPESLRMKKDIRNPRQVAEL  424

Query  341  KTYRPRNQHFIGREDCTPVLNWIQSIYA  258
            K YR RN+HFIGREDC  VL+WI++IY 
Sbjct  425  KAYRTRNRHFIGREDCADVLDWIRTIYG  452



>ref|XP_004294141.2| PREDICTED: tRNA dimethylallyltransferase 9 [Fragaria vesca subsp. 
vesca]
Length=463

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            +++ K K+LDYDF+C FL+ QR+DLYR+ID+RCEDM+L + G+LSEAR LLD+GLLPNSN
Sbjct  259  VEEVKSKELDYDFICFFLSNQRVDLYRAIDWRCEDMVLGSDGILSEARWLLDVGLLPNSN  318

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CREQGGSSSPR+F+ F+++FQKASRNFAKRQLTWFRNE +YHW
Sbjct  319  SATRAIGYRQAMEYLLLCREQGGSSSPREFYNFVTQFQKASRNFAKRQLTWFRNEHIYHW  378

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DAS+P+ SVL+FI D+YH +SG+  VP+SL +KKE+SSRRE +E+K+YR +N+HFI RE
Sbjct  379  LDASKPLDSVLNFICDAYHDKSGNWVVPESLKMKKELSSRREESELKSYRTKNRHFIRRE  438

Query  299  DCTPVLNWIQ  270
            DC+ +L+WIQ
Sbjct  439  DCSDILDWIQ  448



>emb|CBI20214.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   291 bits (744),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G +++K K+LD++F+C FL++QRL+LYRSID RCEDMLL + G+LSEAR LLD GLLPNS
Sbjct  238  GSKENKSKELDFEFICFFLSSQRLELYRSIDLRCEDMLLGSDGILSEARWLLDNGLLPNS  297

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYL+ CREQGG SSP++F+AFLSEFQKASRNFAKRQ+TWFRNE +YH
Sbjct  298  NSATRAIGYRQAMEYLVTCREQGGRSSPQEFYAFLSEFQKASRNFAKRQMTWFRNELIYH  357

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W+DASRP+  VL+FI+D+Y+ Q+G L VPKSLS+KK++S+ RE+ E+K YR +N+HFI R
Sbjct  358  WLDASRPLEMVLNFIHDAYYDQTGKLVVPKSLSMKKDMSNNREIKELKAYRTKNRHFINR  417

Query  302  EDCTPVLNWI  273
            EDC+ +L+WI
Sbjct  418  EDCSDILDWI  427



>ref|XP_002283012.1| PREDICTED: tRNA dimethylallyltransferase 9 [Vitis vinifera]
Length=447

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G +++K K+LD++F+C FL++QRL+LYRSID RCEDMLL + G+LSEAR LLD GLLPNS
Sbjct  253  GSKENKSKELDFEFICFFLSSQRLELYRSIDLRCEDMLLGSDGILSEARWLLDNGLLPNS  312

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYL+ CREQGG SSP++F+AFLSEFQKASRNFAKRQ+TWFRNE +YH
Sbjct  313  NSATRAIGYRQAMEYLVTCREQGGRSSPQEFYAFLSEFQKASRNFAKRQMTWFRNELIYH  372

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W+DASRP+  VL+FI+D+Y+ Q+G L VPKSLS+KK++S+ RE+ E+K YR +N+HFI R
Sbjct  373  WLDASRPLEMVLNFIHDAYYDQTGKLVVPKSLSMKKDMSNNREIKELKAYRTKNRHFINR  432

Query  302  EDCTPVLNWI  273
            EDC+ +L+WI
Sbjct  433  EDCSDILDWI  442



>ref|XP_006358948.1| PREDICTED: tRNA dimethylallyltransferase 9-like isoform X1 [Solanum 
tuberosum]
Length=450

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 161/195 (83%), Gaps = 0/195 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQQ++ KDLDYDFLC FL+T R+DLYRSIDFRCEDMLL   G+LSEA  LLD+GLLPNSN
Sbjct  250  LQQNEIKDLDYDFLCYFLSTNRIDLYRSIDFRCEDMLLGADGILSEAGWLLDVGLLPNSN  309

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CRE GG SS  DF+ FLSEFQK SRNFAKRQ+TWFRNE +Y W
Sbjct  310  SATRAIGYRQAMEYLLRCRENGGWSSAGDFYEFLSEFQKGSRNFAKRQMTWFRNEQIYEW  369

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            IDAS+P+  VL FI DSY+SQ GHL++P+SL ++K+I + R+ AE+KTYR  N+HFIG E
Sbjct  370  IDASKPLEKVLSFICDSYNSQDGHLQMPESLRMRKDIRNHRQAAELKTYRTINRHFIGHE  429

Query  299  DCTPVLNWIQSIYAR  255
            DC  VL+WI+  Y +
Sbjct  430  DCVDVLDWIKKTYGQ  444



>gb|KDP32503.1| hypothetical protein JCGZ_14706 [Jatropha curcas]
Length=455

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            +Q K KDLDY+F+C FL++ RLDLYRSID+RCEDMLL   G+LSEA+ LLD+GLLPNSNS
Sbjct  257  EQVKPKDLDYEFVCFFLSSPRLDLYRSIDYRCEDMLLGTDGILSEAKWLLDMGLLPNSNS  316

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A+RAIGYRQAMEYLL CREQGG SS  DF+ FLSEFQKASRNFAKRQ+TWFRNE +YHW+
Sbjct  317  ATRAIGYRQAMEYLLNCREQGGRSSAGDFYGFLSEFQKASRNFAKRQMTWFRNEHIYHWL  376

Query  476  DASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRED  297
            +AS+P+  VL+FIYD+YH Q+G+L VP+SL +KK+IS  RE+ ++KTYR +N+HF+ R D
Sbjct  377  NASKPLEKVLNFIYDAYHDQTGNLIVPESLQMKKDISDHREILQLKTYRTKNRHFVSRND  436

Query  296  CTPVLNWIQS  267
            C+ +L+W+ +
Sbjct  437  CSDILDWVST  446



>ref|XP_004251888.1| PREDICTED: tRNA dimethylallyltransferase 9 [Solanum lycopersicum]
Length=449

 Score =   287 bits (734),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 161/195 (83%), Gaps = 0/195 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQQ++ KDLDYDFLC FL+T R+DLYRSIDFRCEDMLL   G+LSEAR LLD+GLLPNSN
Sbjct  249  LQQNEIKDLDYDFLCYFLSTSRIDLYRSIDFRCEDMLLGADGILSEARWLLDVGLLPNSN  308

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CRE GG SS  DF  FLSEFQK SRNFAKRQ+TWFRNE +Y W
Sbjct  309  SATRAIGYRQAMEYLLRCREDGGWSSAGDFHDFLSEFQKESRNFAKRQMTWFRNEQIYEW  368

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            IDAS+P+  VL FI DSY+SQ GHL++P+SL ++K+I + R+ A +KTYR  N+HFIG E
Sbjct  369  IDASKPLEKVLSFICDSYNSQDGHLQMPESLRMRKDIRNHRQAAVLKTYRTINRHFIGHE  428

Query  299  DCTPVLNWIQSIYAR  255
            DC  VL+WI+ IY +
Sbjct  429  DCVDVLDWIKKIYGQ  443



>gb|KHG00135.1| tRNA dimethylallyltransferase 9 -like protein [Gossypium arboreum]
Length=446

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 164/191 (86%), Gaps = 2/191 (1%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            L+Q K KDLDY+F+C FL++ RLDLYR ID RCE ML +  G+LSEAR LLD GLLPNSN
Sbjct  252  LEQHKVKDLDYEFICFFLSSPRLDLYRLIDLRCEHMLSD--GILSEARWLLDTGLLPNSN  309

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLLYCREQGG SS RDF+ FLSEFQKASRNFAKRQLTWFRNE +YHW
Sbjct  310  SATRAIGYRQAMEYLLYCREQGGMSSTRDFYYFLSEFQKASRNFAKRQLTWFRNEHIYHW  369

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            ++ASRP+  VL+FIY++Y+ QSG L VP+SL +KK++S++RE AE+K YR +N+HF+ RE
Sbjct  370  LNASRPLDKVLNFIYNAYNDQSGTLHVPESLQMKKDMSNKREAAELKAYRAKNRHFVHRE  429

Query  299  DCTPVLNWIQS  267
            DC+ +L+WI+S
Sbjct  430  DCSDILDWIRS  440



>ref|XP_008386239.1| PREDICTED: tRNA dimethylallyltransferase 9 [Malus domestica]
Length=465

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            +++ K K+LDYDF+C FL+++R+DLY+SID+RCEDML  + G+LSEA  LLD GLLPNSN
Sbjct  261  VEEVKSKELDYDFICFFLSSKRVDLYKSIDYRCEDMLSGSDGILSEANWLLDSGLLPNSN  320

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CR+QGGSS+ R+F+ FLSEFQKASRNFAKRQLTWFRNE +YHW
Sbjct  321  SATRAIGYRQAMEYLLMCRQQGGSSA-REFYNFLSEFQKASRNFAKRQLTWFRNEHIYHW  379

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DAS+P+ +VLDFIYD+YH  S  L VP+SL +KKE++S REVAE+K YRP+N+HFI RE
Sbjct  380  LDASQPLETVLDFIYDAYHENSELLVVPESLRMKKELTSHREVAELKAYRPKNRHFIRRE  439

Query  299  DCTPVLNWIQ  270
            DC+ +L+WI+
Sbjct  440  DCSDILDWIR  449



>ref|XP_007213909.1| hypothetical protein PRUPE_ppa005482mg [Prunus persica]
 gb|EMJ15108.1| hypothetical protein PRUPE_ppa005482mg [Prunus persica]
Length=458

 Score =   284 bits (727),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            +++ K K+LDYDF+C FL+++R+DLYRSID RCEDML  + G+LSEAR LLD GLLPNSN
Sbjct  261  VEEVKSKELDYDFICFFLSSKRVDLYRSIDCRCEDMLSGSDGILSEARWLLDSGLLPNSN  320

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEY+L CR+QGGSS PR+FF FLSEFQKASRNFAKRQLTWFRNE +YHW
Sbjct  321  SATRAIGYRQAMEYILMCRQQGGSS-PREFFNFLSEFQKASRNFAKRQLTWFRNESIYHW  379

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DAS+P+ +VL+FIYD+YH +S +L VP+SL +KKE+SSRRE +E+K YR +N+HF+ RE
Sbjct  380  LDASKPLETVLNFIYDAYHDKSENLVVPESLRMKKELSSRREESELKGYRTQNRHFVRRE  439

Query  299  DCTPVLNWIQ  270
            DC+ +L+WI+
Sbjct  440  DCSDILDWIR  449



>ref|XP_008226503.1| PREDICTED: tRNA dimethylallyltransferase 9 [Prunus mume]
Length=456

 Score =   284 bits (726),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            +++ K K+LDYDF+C FL+++R+DLYRSID RCEDML  + G+LSEAR LLD GLLPNSN
Sbjct  261  VEEVKSKELDYDFICFFLSSKRVDLYRSIDCRCEDMLSGSDGILSEARWLLDCGLLPNSN  320

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CR+QGGSS PR+FF FLSEFQKASRNFAKRQLTWFRNE +YHW
Sbjct  321  SATRAIGYRQAMEYLLMCRQQGGSS-PREFFNFLSEFQKASRNFAKRQLTWFRNESIYHW  379

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DAS+P+ +VL+FIYD++H +S +L VP+SL +KKE+SSRRE +E+K YR +N+HF+ RE
Sbjct  380  LDASKPLETVLNFIYDAHHDKSENLVVPESLRMKKELSSRREESELKGYRTQNRHFVRRE  439

Query  299  DCTPVLNWIQ  270
            DC+ +L+WI+
Sbjct  440  DCSDILDWIR  449



>ref|XP_009340250.1| PREDICTED: tRNA dimethylallyltransferase 9 [Pyrus x bretschneideri]
Length=465

 Score =   283 bits (723),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            +++ K K+LDYDF+C FL+++R+DLY+SID+RCEDML  + G+LSEA  LLD GLLPNSN
Sbjct  261  VEEVKSKELDYDFICFFLSSKRVDLYKSIDYRCEDMLSGSDGILSEANWLLDSGLLPNSN  320

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CR+QGG+S+ R+F+ FLSEFQKASRNFAKRQLTWFRNE +YHW
Sbjct  321  SATRAIGYRQAMEYLLMCRQQGGTSA-REFYNFLSEFQKASRNFAKRQLTWFRNEHIYHW  379

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DAS+P  +VLDFIYD+YH  S  L VP+SL +KKE++S REVAE+K YRP+N+HFI RE
Sbjct  380  LDASQPWETVLDFIYDAYHENSEILVVPESLRMKKELTSHREVAELKAYRPKNRHFIRRE  439

Query  299  DCTPVLNWIQ  270
            DC+ +L+WI+
Sbjct  440  DCSDILDWIR  449



>ref|XP_011006723.1| PREDICTED: tRNA dimethylallyltransferase 9 [Populus euphratica]
 ref|XP_011006725.1| PREDICTED: tRNA dimethylallyltransferase 9 [Populus euphratica]
 ref|XP_011006726.1| PREDICTED: tRNA dimethylallyltransferase 9 [Populus euphratica]
Length=445

 Score =   281 bits (720),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = -1

Query  818  DLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIG  639
            DLDY+F+C FL++ RLDLY+SID+RCEDML  + G+LSEA+ LLD GLLPNSNSA+RAIG
Sbjct  253  DLDYEFICFFLSSPRLDLYKSIDYRCEDMLAGSNGILSEAKWLLDEGLLPNSNSATRAIG  312

Query  638  YRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRPM  459
            YRQAMEYLL CRE GGSSS  DF+AFLSEFQKASRNFAKRQ+TWFRNE +YHW+DAS+P+
Sbjct  313  YRQAMEYLLRCREDGGSSSAGDFYAFLSEFQKASRNFAKRQMTWFRNEHIYHWLDASKPL  372

Query  458  GSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVLN  279
              VL+F+YD+YH Q+G L VP+SL +KK+++SRREV ++K YR +N+HF+ R DC+ +L+
Sbjct  373  EMVLNFVYDAYHDQTGSLVVPESLRMKKDMTSRREVLQLKAYRTKNRHFVSRNDCSDILD  432

Query  278  WIQSIYAR  255
            WI++   +
Sbjct  433  WIRTTQGK  440



>ref|XP_008382074.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Malus domestica]
Length=265

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++ K K+LDYDF C FL+++R+DLY+SID+RCEDML  + G+LSEA  LLD GLLP SNS
Sbjct  62   EEVKSKELDYDFJCFFLSSKRVDLYKSIDYRCEDMLSGSDGILSEANWLLDSGLLPXSNS  121

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A+R IGYRQAMEYLL CR+QG  S PR+F+ FLSEFQKASRNFAKRQLTWFRNE +Y+W+
Sbjct  122  ATRGIGYRQAMEYLLMCRQQG-VSFPREFYNFLSEFQKASRNFAKRQLTWFRNEHIYNWL  180

Query  476  DASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRED  297
            DAS+P+ +VLDFIYD+YH  + +L VP+SL +KKE++S REVAE+K YRP+N HFI RED
Sbjct  181  DASKPLETVLDFIYDAYHENTENLVVPESLRMKKELTSHREVAELKAYRPKNWHFIRRED  240

Query  296  CTPVLNWIQ  270
            C+ +L+WI+
Sbjct  241  CSDILDWIR  249



>ref|XP_007021669.1| Isopentenyltransferase 9 isoform 1 [Theobroma cacao]
 gb|EOY13194.1| Isopentenyltransferase 9 isoform 1 [Theobroma cacao]
Length=449

 Score =   278 bits (712),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            +Q   KDLDY+F+C FL++ RLDLYR ID RCE ML E  G+LSEAR LLD+GL PNSNS
Sbjct  257  EQDTVKDLDYEFICFFLSSPRLDLYRLIDLRCEHMLSETDGILSEARWLLDMGLQPNSNS  316

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A+RAIGYRQAMEYLL CREQGG SS RD + FLSEFQKASRNFAKRQLTWFRNE +YHW+
Sbjct  317  ATRAIGYRQAMEYLLRCREQGGMSSTRDVYYFLSEFQKASRNFAKRQLTWFRNEHIYHWL  376

Query  476  DASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRED  297
            +ASRP+  VL+F+YD+Y+ +SG L VP+SL +KK++S+RRE +E+K Y  RN+HF+ RED
Sbjct  377  NASRPLEKVLNFVYDAYNDESGTLDVPESLKMKKDVSNRREASELKAYHTRNRHFVNRED  436

Query  296  CTPVLNWIQ  270
            C+ +L+WI+
Sbjct  437  CSDILDWIR  445



>gb|EYU45006.1| hypothetical protein MIMGU_mgv1a0264152mg, partial [Erythranthe 
guttata]
Length=282

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            KDLDYDF+C FL+TQRLDLYRSIDFRCEDMLL++ G+LSEA  LLDLGL+PNSNSASRAI
Sbjct  89   KDLDYDFICFFLSTQRLDLYRSIDFRCEDMLLDD-GILSEANWLLDLGLMPNSNSASRAI  147

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYRQAMEYLL  REQ G SS +DF+ FL+ FQKASRNFAKRQLTWFRNEP+Y WIDAS+P
Sbjct  148  GYRQAMEYLLISREQRGCSSSKDFYYFLTNFQKASRNFAKRQLTWFRNEPVYQWIDASKP  207

Query  461  MGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVL  282
            M  V++FI D+Y  Q+G LKVP+SL + K+IS+++EV  +K YR +N+HF  REDC  ++
Sbjct  208  MEQVVNFICDAYEDQTGELKVPRSLYMDKDISNQKEVRLLKAYRTKNRHFSSREDCDGII  267

Query  281  NWIQ  270
            +W++
Sbjct  268  DWVR  271



>ref|XP_010060666.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Eucalyptus 
grandis]
Length=498

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
             L++ + KDLDYDF+C FL++ R+DLYRS+D RCEDMLL N G+L+EAR LLD GLLPNS
Sbjct  295  ALEEIRSKDLDYDFICFFLSSPRIDLYRSLDLRCEDMLLGNDGILAEARWLLDEGLLPNS  354

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYL++CR+  G +S RDF AFLS FQKASRNFAKRQ+TWFRNE +YH
Sbjct  355  NSATRAIGYRQAMEYLMWCRQHEGRTSARDFLAFLSNFQKASRNFAKRQMTWFRNEHIYH  414

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W+DAS+P+  VLD I  +YH Q+G L VP++L +KKEIS RRE AE+K Y  +N+HFI R
Sbjct  415  WLDASKPLEKVLDCICHAYHDQTGELNVPEALRMKKEISGRREDAELKAYHTKNRHFISR  474

Query  302  EDCTPVLNWIQ  270
            EDC+ +L+WI+
Sbjct  475  EDCSDILDWIR  485



>gb|KCW67467.1| hypothetical protein EUGRSUZ_F01210 [Eucalyptus grandis]
Length=498

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
             L++ + KDLDYDF+C FL++ R+DLYRS+D RCEDMLL N G+L+EAR LLD GLLPNS
Sbjct  295  ALEEIRSKDLDYDFICFFLSSPRIDLYRSLDLRCEDMLLGNDGILAEARWLLDEGLLPNS  354

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYL++CR+  G +S RDF AFLS FQKASRNFAKRQ+TWFRNE +YH
Sbjct  355  NSATRAIGYRQAMEYLMWCRQHEGRTSARDFLAFLSNFQKASRNFAKRQMTWFRNEHIYH  414

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W+DAS+P+  VLD I  +YH Q+G L VP++L +KKEIS RRE AE+K Y  +N+HFI R
Sbjct  415  WLDASKPLEKVLDCICHAYHDQTGELNVPEALRMKKEISGRREDAELKAYHTKNRHFISR  474

Query  302  EDCTPVLNWIQ  270
            EDC+ +L+WI+
Sbjct  475  EDCSDILDWIR  485



>ref|XP_010675404.1| PREDICTED: tRNA dimethylallyltransferase 9 [Beta vulgaris subsp. 
vulgaris]
Length=446

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G+Q S+  DLDYDFLC FL++ RLDLYRSID RCEDML  + G+L+EA+ LLD+GLLPNS
Sbjct  253  GMQGSQLDDLDYDFLCFFLSSPRLDLYRSIDLRCEDMLSGSGGILAEAKWLLDIGLLPNS  312

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQ MEYLL C EQ G SS ++FF FL+EFQKASRNFAKRQ+TW+RNEP+YH
Sbjct  313  NSATRAIGYRQGMEYLLRCGEQEGHSSAKEFFFFLTEFQKASRNFAKRQMTWYRNEPIYH  372

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W+DAS+P+  VL+FI+D+YH Q   L VP+SL +KK++S+RRE AE+K YR +N++F+ R
Sbjct  373  WLDASKPLEKVLNFIHDAYHDQDTTLTVPESLRMKKDVSNRRETAELKAYRTKNRNFVTR  432

Query  302  EDCTPVLNWIQS  267
            EDC  +L WI++
Sbjct  433  EDCADILTWIRT  444



>ref|XP_011082747.1| PREDICTED: tRNA dimethylallyltransferase 9 [Sesamum indicum]
Length=464

 Score =   276 bits (707),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
              +S  K+LDYDF+C FL+TQRLDLYRSIDFRCEDMLL++ G+LSEA+ LLDLGLLPNSN
Sbjct  265  FNESTSKNLDYDFICFFLSTQRLDLYRSIDFRCEDMLLDD-GLLSEAKWLLDLGLLPNSN  323

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAM+YLL  REQGG SS ++FF FLSEFQKASRNFAKRQLTWFRNEP+Y W
Sbjct  324  SATRAIGYRQAMDYLLMAREQGGWSSAKEFFNFLSEFQKASRNFAKRQLTWFRNEPIYQW  383

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            IDAS+P+ +VL FI D Y   +G LKVP+SL ++K+IS+ +EV  +K YR +N+HFI RE
Sbjct  384  IDASKPLENVLRFICDVYDDDTGKLKVPRSLCMEKDISNLKEVRLLKAYRTKNRHFISRE  443

Query  299  DCTPVLNWIQ  270
            DC  +L+W++
Sbjct  444  DCNGILDWVR  453



>emb|CDP05986.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            GLQ+   K LDY FLC FL+TQRLDLYRSIDFRCEDML  + G+LSEA  LLDLGLLPNS
Sbjct  259  GLQEDNSKKLDYGFLCFFLSTQRLDLYRSIDFRCEDMLSGDDGLLSEASWLLDLGLLPNS  318

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYLL CREQ G SS RDF+ FLS FQKASRNFAKRQLTWFRNE +Y 
Sbjct  319  NSATRAIGYRQAMEYLLCCREQDGQSSARDFYTFLSAFQKASRNFAKRQLTWFRNEHIYQ  378

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            WIDAS+ +  VL  I+DSYH ++G+L+VP SL++ K++S+R+E +++K YR +N+ FI R
Sbjct  379  WIDASKSLEKVLKLIHDSYHDETGNLEVPDSLAMHKDVSNRKEASQLKAYRTKNRQFIQR  438

Query  302  EDCTPVLNWIQ  270
            EDC+ +L+WI+
Sbjct  439  EDCSHILDWIR  449



>ref|XP_002300421.2| hypothetical protein POPTR_0001s38570g [Populus trichocarpa]
 gb|EEE85226.2| hypothetical protein POPTR_0001s38570g [Populus trichocarpa]
Length=445

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 160/191 (84%), Gaps = 0/191 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            L  +   DLDY+F+C FL++ RLDLY+SID+RCEDM+  + G+L+EA+ LLD GLLPNSN
Sbjct  246  LDVNSSGDLDYEFICFFLSSPRLDLYKSIDYRCEDMVAGSNGILTEAKWLLDEGLLPNSN  305

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CRE GG SS  DF+AFLSEFQKASRNFAKRQ+TWFRNE +YHW
Sbjct  306  SATRAIGYRQAMEYLLRCREDGGRSSAGDFYAFLSEFQKASRNFAKRQMTWFRNEHIYHW  365

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DAS+P+  VL+F+YD+YH Q+G   VP+S+ +KK+++SRREV ++K YR +N+HF+ R 
Sbjct  366  LDASKPLEMVLNFVYDAYHDQTGSFVVPESIRMKKDMTSRREVLQLKAYRTKNRHFVSRN  425

Query  299  DCTPVLNWIQS  267
            DC+ VL+WI++
Sbjct  426  DCSDVLDWIRT  436



>ref|XP_002524264.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF38103.1| ATP binding protein, putative [Ricinus communis]
Length=446

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            K KDLDYDF+C FL++ RLDLYRSID+RCEDML    G+LSEA+ LLD+GLLPNSNSA+R
Sbjct  253  KPKDLDYDFICFFLSSPRLDLYRSIDYRCEDMLSGTDGILSEAKWLLDMGLLPNSNSATR  312

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
            AIGYRQAMEYLL CR+QGG SS  +F+AFLSEFQKASRNFAKRQ+TWFRNE +YHW++AS
Sbjct  313  AIGYRQAMEYLLQCRQQGGRSSAGEFYAFLSEFQKASRNFAKRQMTWFRNEHIYHWLNAS  372

Query  467  RPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTP  288
            RP+  VL+FIYD+YH Q+G L VP+SL + K  S++RE  ++KTYR +N+HF+ R DC+ 
Sbjct  373  RPLEKVLNFIYDAYHDQTGSLVVPESLRMNK--SNQRENLQLKTYRTKNRHFVSRNDCSD  430

Query  287  VLNWIQS  267
            +L+WI++
Sbjct  431  ILDWIRT  437



>ref|XP_004137218.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Cucumis sativus]
 ref|XP_004156518.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Cucumis sativus]
 gb|KGN53595.1| hypothetical protein Csa_4G083690 [Cucumis sativus]
Length=482

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            K+LDY+F+C FL++ RL+LYRSIDFRCEDM+L + G+LSEA  LL+ GLLPNS+SA++AI
Sbjct  287  KELDYEFICFFLSSPRLNLYRSIDFRCEDMILGSDGILSEATWLLNSGLLPNSSSATKAI  346

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYRQAMEYLL CR+QGG SSP +F+AFLSEFQKASRNFAKRQLTWFRNE +YHW+DAS+P
Sbjct  347  GYRQAMEYLLRCRQQGGRSSPEEFYAFLSEFQKASRNFAKRQLTWFRNERIYHWLDASKP  406

Query  461  MGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVL  282
            + + L+F+YD+YHS+SG++ VP+SL +K++ SS RE +EMK YR RN++F+ R+DC  VL
Sbjct  407  LENALNFVYDAYHSESGNISVPESLRMKRDGSSYREASEMKAYRTRNRYFVKRQDCADVL  466

Query  281  NWI---QSIY  261
            +WI   QS+Y
Sbjct  467  DWIGRTQSVY  476



>ref|XP_010279079.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Nelumbo 
nucifera]
Length=455

 Score =   274 bits (701),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 162/196 (83%), Gaps = 0/196 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            L ++  +DLDYDF+C FL++ RLDLYR ID RCEDML+   G+L+EA  LLD GLLPNSN
Sbjct  257  LGENLSEDLDYDFICFFLSSPRLDLYRLIDLRCEDMLMGRDGILAEATWLLDTGLLPNSN  316

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYL+ CR+Q G SS +DF+AFLSEFQK+SRNFAKRQ+TWFRNE +YHW
Sbjct  317  SATRAIGYRQAMEYLVKCRQQQGHSSAQDFYAFLSEFQKSSRNFAKRQITWFRNELIYHW  376

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DASRP+  +L+FI+D+YH Q+G++ VP+SL+ KK+ISS RE++E+K YR +N+HF+ RE
Sbjct  377  LDASRPLEKILNFIFDAYHDQTGNVVVPESLNFKKDISSHREISELKAYRTKNRHFVRRE  436

Query  299  DCTPVLNWIQSIYARE  252
            DC  +L+WI+     E
Sbjct  437  DCYVILDWIRRTQTME  452



>ref|XP_010060664.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010060665.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Eucalyptus 
grandis]
Length=499

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLE-NYGVLSEARGLLDLGLLPN  666
             L++ + KDLDYDF+C FL++ R+DLYRS+D RCEDMLL  N G+L+EAR LLD GLLPN
Sbjct  295  ALEEIRSKDLDYDFICFFLSSPRIDLYRSLDLRCEDMLLAGNDGILAEARWLLDEGLLPN  354

Query  665  SNSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLY  486
            SNSA+RAIGYRQAMEYL++CR+  G +S RDF AFLS FQKASRNFAKRQ+TWFRNE +Y
Sbjct  355  SNSATRAIGYRQAMEYLMWCRQHEGRTSARDFLAFLSNFQKASRNFAKRQMTWFRNEHIY  414

Query  485  HWIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIG  306
            HW+DAS+P+  VLD I  +YH Q+G L VP++L +KKEIS RRE AE+K Y  +N+HFI 
Sbjct  415  HWLDASKPLEKVLDCICHAYHDQTGELNVPEALRMKKEISGRREDAELKAYHTKNRHFIS  474

Query  305  REDCTPVLNWIQ  270
            REDC+ +L+WI+
Sbjct  475  REDCSDILDWIR  486



>gb|KJB61644.1| hypothetical protein B456_009G372500 [Gossypium raimondii]
Length=446

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            L+Q K KDLDY+F+C FL++ RLDLYR ID RCE ML +  G+LSEAR LL+ GLLPNSN
Sbjct  252  LEQHKVKDLDYEFICFFLSSPRLDLYRLIDLRCEHMLSD--GILSEARWLLETGLLPNSN  309

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL+CREQGG SS RDF+ FLSEFQKASRNFAKRQ+TWFRNE +YHW
Sbjct  310  SATRAIGYRQAMEYLLHCREQGGISSTRDFYYFLSEFQKASRNFAKRQVTWFRNERIYHW  369

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            ++ASRP+  VL+FI ++Y+ QSG L VP+ L +KK +S++RE AE+K YR +N+HF+ RE
Sbjct  370  LNASRPLDKVLNFICNAYNDQSGTLHVPELLQMKKYMSNKREAAELKAYRAKNRHFVHRE  429

Query  299  DCTPVLNWIQS  267
            DC+ +L+WI+S
Sbjct  430  DCSDILDWIRS  440



>gb|KJB61645.1| hypothetical protein B456_009G372500 [Gossypium raimondii]
Length=447

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            L+Q K KDLDY+F+C FL++ RLDLYR ID RCE ML +  G+LSEAR LL+ GLLPNSN
Sbjct  252  LEQHKVKDLDYEFICFFLSSPRLDLYRLIDLRCEHMLSD--GILSEARWLLETGLLPNSN  309

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL+CREQGG SS RDF+ FLSEFQKASRNFAKRQ+TWFRNE +YHW
Sbjct  310  SATRAIGYRQAMEYLLHCREQGGISSTRDFYYFLSEFQKASRNFAKRQVTWFRNERIYHW  369

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            ++ASRP+  VL+FI ++Y+ QSG L VP+ L +KK +S++RE AE+K YR +N+HF+ RE
Sbjct  370  LNASRPLDKVLNFICNAYNDQSGTLHVPELLQMKKYMSNKREAAELKAYRAKNRHFVHRE  429

Query  299  DCTPVLNWIQS  267
            DC+ +L+WI+S
Sbjct  430  DCSDILDWIRS  440



>ref|XP_008451715.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Cucumis 
melo]
Length=482

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            K+LDY+F+C FL++ RL+LY+SIDFRCEDM+L + G+LSEA  LL+ GLLPNSNSA++AI
Sbjct  287  KELDYEFICFFLSSPRLNLYKSIDFRCEDMILGSDGILSEATWLLNSGLLPNSNSATKAI  346

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYRQAMEYLL CR+QGG SSP +F+AFLSEFQKASRNFAKRQLTWFRNE +YHW+DAS+P
Sbjct  347  GYRQAMEYLLRCRQQGGRSSPEEFYAFLSEFQKASRNFAKRQLTWFRNERIYHWLDASKP  406

Query  461  MGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVL  282
            + + L+FIYD+YH+ SG++ VP SL ++ ++SSRR+ +EMK+Y+ RN++F+ R+DC  VL
Sbjct  407  LENALNFIYDAYHNGSGNISVPDSLRMESDVSSRRKASEMKSYQTRNRYFVRRQDCADVL  466

Query  281  NWI---QSIY  261
            +WI   QS+Y
Sbjct  467  DWIGRTQSVY  476



>ref|XP_008451716.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Cucumis 
melo]
Length=479

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 164/190 (86%), Gaps = 3/190 (2%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            K+LDY+F+C FL++ RL+LY+SIDFRCEDM+L + G+LSEA  LL+ GLLPNSNSA++AI
Sbjct  284  KELDYEFICFFLSSPRLNLYKSIDFRCEDMILGSDGILSEATWLLNSGLLPNSNSATKAI  343

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYRQAMEYLL CR+QGG SSP +F+AFLSEFQKASRNFAKRQLTWFRNE +YHW+DAS+P
Sbjct  344  GYRQAMEYLLRCRQQGGRSSPEEFYAFLSEFQKASRNFAKRQLTWFRNERIYHWLDASKP  403

Query  461  MGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVL  282
            + + L+FIYD+YH+ SG++ VP SL ++ ++SSRR+ +EMK+Y+ RN++F+ R+DC  VL
Sbjct  404  LENALNFIYDAYHNGSGNISVPDSLRMESDVSSRRKASEMKSYQTRNRYFVRRQDCADVL  463

Query  281  NWI---QSIY  261
            +WI   QS+Y
Sbjct  464  DWIGRTQSVY  473



>gb|KDO48346.1| hypothetical protein CISIN_1g012837mg [Citrus sinensis]
Length=352

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G   +  KDLDYDF+C FL++ RLDLYRSID RCEDML  + G+LSEA  LLD GLLPNS
Sbjct  147  GASDTNPKDLDYDFMCFFLSSHRLDLYRSIDLRCEDMLPGSDGILSEAAWLLDEGLLPNS  206

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYLL CR+QGG+SS  +F+AFL+EFQKASRNFAKRQLTWFRNE +YH
Sbjct  207  NSATRAIGYRQAMEYLLRCRQQGGTSSTGEFYAFLAEFQKASRNFAKRQLTWFRNERIYH  266

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W++A+RP+ +VL++I  +YH  +G L VP  L ++++ SS REV+E+K+YR RN+HFI R
Sbjct  267  WLNAARPLENVLNYIITAYHDSTGTLVVPDYLQIRRDSSSSREVSELKSYRTRNRHFISR  326

Query  302  EDCTPVLNWIQ  270
             DC  +L+WI+
Sbjct  327  GDCCNILDWIK  337



>emb|CDX70907.1| BnaC03g09910D [Brassica napus]
Length=463

 Score =   271 bits (693),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+DLYRSIDFRCEDML    GVLSEAR LLDLGLLPN+ SA
Sbjct  260  QNIETDLDYDFLCFFLSSPRIDLYRSIDFRCEDMLSGADGVLSEARWLLDLGLLPNTGSA  319

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYL  CR+QGG SSP +F+ FL++FQ+ SRNFAKRQ+TWFR EP+YHW++
Sbjct  320  TRAIGYRQAMEYLSKCRQQGGVSSPGEFYWFLNKFQQVSRNFAKRQMTWFRCEPMYHWLN  379

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+ ++LDFIYD+Y  ++  L VP S+ + KE+ + RE   +K YRPRN+HF+GREDC
Sbjct  380  ASKPLDTILDFIYDAYEKETETLVVPDSIRMSKEMRNSREANALKAYRPRNRHFVGREDC  439

Query  293  TPVLNWIQS  267
            + VL WI+S
Sbjct  440  SSVLEWIRS  448



>emb|CDX88863.1| BnaA03g07860D [Brassica napus]
Length=463

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ + DLDYDFLC FL++ R+DLYRSIDFRCEDML    GVLSEAR LLDLGLLPN++SA
Sbjct  260  QNIQTDLDYDFLCFFLSSPRIDLYRSIDFRCEDMLSGANGVLSEARWLLDLGLLPNTSSA  319

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYL  CR+QGG SSP +F+ FL++FQ+ SRNFAKRQ+TWFR EP+YHW++
Sbjct  320  TRAIGYRQAMEYLSKCRQQGGVSSPGEFYWFLNKFQQVSRNFAKRQMTWFRCEPMYHWLN  379

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+ ++LDFIYD+Y  ++  L VP S+ + KE+ + RE   +K YRPRN+HF+GREDC
Sbjct  380  ASKPLDTILDFIYDAYEKEAETLVVPDSIRMNKEMRNSREANALKAYRPRNRHFVGREDC  439

Query  293  TPVLNWIQS  267
            + VL WI+S
Sbjct  440  SSVLEWIRS  448



>gb|KDO48344.1| hypothetical protein CISIN_1g012837mg [Citrus sinensis]
Length=455

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G   +  KDLDYDF+C FL++ RLDLYRSID RCEDML  + G+LSEA  LLD GLLPNS
Sbjct  250  GASDTNPKDLDYDFMCFFLSSHRLDLYRSIDLRCEDMLPGSDGILSEAAWLLDEGLLPNS  309

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYLL CR+QGG+SS  +F+AFL+EFQKASRNFAKRQLTWFRNE +YH
Sbjct  310  NSATRAIGYRQAMEYLLRCRQQGGTSSTGEFYAFLAEFQKASRNFAKRQLTWFRNERIYH  369

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W++A+RP+ +VL++I  +YH  +G L VP  L ++++ SS REV+E+K+YR RN+HFI R
Sbjct  370  WLNAARPLENVLNYIITAYHDSTGTLVVPDYLQIRRDSSSSREVSELKSYRTRNRHFISR  429

Query  302  EDCTPVLNWIQ  270
             DC  +L+WI+
Sbjct  430  GDCCNILDWIK  440



>ref|XP_006485669.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Citrus sinensis]
Length=455

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G   +  KDLDYDF+C FL++ RLDLYRSID RCEDML  + G+LSEA  LLD GLLPNS
Sbjct  250  GASDTNPKDLDYDFMCFFLSSHRLDLYRSIDLRCEDMLPGSDGILSEAAWLLDEGLLPNS  309

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYLL CR+QGG+SS  +F+AFL+EFQKASRNFAKRQLTWFRNE +YH
Sbjct  310  NSATRAIGYRQAMEYLLRCRQQGGTSSTGEFYAFLAEFQKASRNFAKRQLTWFRNERIYH  369

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W++A+RP+ +VL++I  +YH  +G L VP  L ++++ SS REV+E+K+YR RN+HFI R
Sbjct  370  WLNAARPLENVLNYIITAYHDSTGTLVVPDYLQIRRDSSSSREVSELKSYRTRNRHFISR  429

Query  302  EDCTPVLNWIQ  270
             DC  +L+WI+
Sbjct  430  GDCCNILDWIK  440



>ref|XP_006451734.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
 gb|ESR64974.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
Length=455

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G   +  KDLDYDF+C FL++ RLDLYRSID RCEDML  + G+LSEA  LLD GLLPNS
Sbjct  250  GASDTNPKDLDYDFMCFFLSSHRLDLYRSIDLRCEDMLPGSDGILSEAAWLLDEGLLPNS  309

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYLL CR+QGG+SS  +F+AFL+EFQKASRNFAKRQLTWFRNE +YH
Sbjct  310  NSATRAIGYRQAMEYLLRCRQQGGTSSTGEFYAFLAEFQKASRNFAKRQLTWFRNEHIYH  369

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W++A+RP+ +VL++I  +YH  +G L VP  L ++++ SS REV+E+K+YR RN+HFI R
Sbjct  370  WLNAARPLENVLNYIITAYHDSTGTLVVPDYLQMRRDSSSSREVSELKSYRTRNRHFISR  429

Query  302  EDCTPVLNWIQ  270
             DC  +L+WI+
Sbjct  430  GDCCNILDWIK  440



>ref|XP_006451735.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
 gb|ESR64975.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
Length=456

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 156/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G   +  KDLDYDF+C FL++ RLDLYRSID RCEDML  + G+LSEA  LLD GLLPNS
Sbjct  251  GASDTNPKDLDYDFMCFFLSSHRLDLYRSIDLRCEDMLPGSDGILSEAAWLLDEGLLPNS  310

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYLL CR+QGG+SS  +F+AFL+EFQKASRNFAKRQLTWFRNE +YH
Sbjct  311  NSATRAIGYRQAMEYLLRCRQQGGTSSTGEFYAFLAEFQKASRNFAKRQLTWFRNEHIYH  370

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W++A+RP+ +VL++I  +YH  +G L VP  L ++++ SS REV+E+K+YR RN+HFI R
Sbjct  371  WLNAARPLENVLNYIITAYHDSTGTLVVPDYLQMRRDSSSSREVSELKSYRTRNRHFISR  430

Query  302  EDCTPVLNWIQ  270
             DC  +L+WI+
Sbjct  431  GDCCNILDWIK  441



>ref|XP_006400569.1| hypothetical protein EUTSA_v10013462mg [Eutrema salsugineum]
 gb|ESQ42022.1| hypothetical protein EUTSA_v10013462mg [Eutrema salsugineum]
Length=466

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ + DLDYDFLC FL++ R+DLYRSIDFRCEDML    GVLSEAR LLDLGLLPN+NS+
Sbjct  262  QNIQTDLDYDFLCFFLSSPRVDLYRSIDFRCEDMLSGADGVLSEARWLLDLGLLPNTNSS  321

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLL CR QG  SSP +F++FL++FQ+ASRNFAKRQ+TWFR EP+YHW++
Sbjct  322  TRAIGYRQAMEYLLKCRRQGCVSSPGEFYSFLNKFQQASRNFAKRQMTWFRCEPMYHWLN  381

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+ ++L FIYD+Y +++  L VP SL + K++ + RE   +K YRPRN+HF+ REDC
Sbjct  382  ASKPLDTILKFIYDAYENEAETLMVPDSLRMNKDVRNSREANALKAYRPRNRHFVRREDC  441

Query  293  TPVLNWIQS  267
            + VL WI+S
Sbjct  442  SSVLEWIRS  450



>ref|XP_009131765.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Brassica rapa]
Length=463

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ + DLDYDFLC FL++ R+DLYRSID RCEDML    GVLSEAR LLDLGLLPN++SA
Sbjct  260  QNVQTDLDYDFLCFFLSSPRIDLYRSIDLRCEDMLSGADGVLSEARWLLDLGLLPNTSSA  319

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYL  CR+QGG SSP +F+ FL++FQ+ SRNFAKRQ+TWFR EP+YHW++
Sbjct  320  TRAIGYRQAMEYLSKCRQQGGVSSPGEFYWFLNKFQQVSRNFAKRQMTWFRCEPMYHWLN  379

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+ ++L+FIYD+Y  ++  L VP S+ + KE+ + RE   +K YRPRN+HF+GREDC
Sbjct  380  ASKPLDTILEFIYDAYEKEAETLVVPDSIRMNKEMRNSREANALKAYRPRNRHFVGREDC  439

Query  293  TPVLNWIQS  267
            + VL WI++
Sbjct  440  SSVLEWIRN  448



>gb|KEH38634.1| tRNA dimethylallyltransferase [Medicago truncatula]
Length=449

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
             ++++    LDYDF+C FL++ RLDLY+SID+RCEDM+L   G+LSEA+ L+D+GL PNS
Sbjct  255  AMKETNSAKLDYDFMCFFLSSDRLDLYKSIDYRCEDMILGGDGLLSEAQWLIDIGLHPNS  314

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NS ++AIGYRQAM+YL+ CREQGG SS  +F+ FLSEFQKASRNFAKRQLTWFRNE +YH
Sbjct  315  NSPTKAIGYRQAMDYLIGCREQGGQSSAGEFYRFLSEFQKASRNFAKRQLTWFRNERIYH  374

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W+DAS+P+ +VL+FI+D+YH+Q+G+L VP+ L + ++I++ R  A++K YR RN+HF+  
Sbjct  375  WLDASKPLETVLNFIHDAYHNQNGNLFVPEHLRMSRDITNPRIAAKLKAYRTRNRHFVNG  434

Query  302  EDCTPVLNWIQ  270
            EDC P+L WIQ
Sbjct  435  EDCYPILEWIQ  445



>gb|AFK38918.1| unknown [Medicago truncatula]
Length=279

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 157/191 (82%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
             ++++    LDYDF+C FL++ RLDLY+SID+RCEDM+L   G+LSEA+ L+D+GL PNS
Sbjct  85   AMKETNSAKLDYDFMCFFLSSDRLDLYKSIDYRCEDMILGGDGLLSEAQWLIDIGLHPNS  144

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NS ++AIGYRQAM+YL+ CREQGG SS  +F+ FLSEFQKASRNFAKRQLT FRNE +YH
Sbjct  145  NSPTKAIGYRQAMDYLIGCREQGGQSSAGEFYRFLSEFQKASRNFAKRQLTRFRNERIYH  204

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W+DAS+P+ +VL+FI+D+YH+Q+G+L VP+ L + ++I++ R  A++K YR RN+HF+  
Sbjct  205  WLDASKPLETVLNFIHDAYHNQNGNLFVPEHLRMSRDITNPRIAAKLKAYRTRNRHFVNG  264

Query  302  EDCTPVLNWIQ  270
            EDC P+L WIQ
Sbjct  265  EDCYPILEWIQ  275



>gb|KFK26250.1| hypothetical protein AALP_AA8G222700 [Arabis alpina]
Length=458

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ + DLDYDFLC FL++ R+DLYRSIDFRCEDM+    G+LSEAR LLD+G+ PN+NSA
Sbjct  254  QNIQTDLDYDFLCFFLSSPRVDLYRSIDFRCEDMVKGADGLLSEARWLLDIGMRPNTNSA  313

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLL CR+ GG SSP DF+ FL+ FQ+ASRNFAKRQ+TWFR EP+YHW++
Sbjct  314  TRAIGYRQAMEYLLSCRQYGGVSSPGDFYGFLNRFQQASRNFAKRQMTWFRYEPMYHWLN  373

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+ ++L+FIYD+Y +++  L VP S+ + K++ + RE   +K+YRPRN+HF+ REDC
Sbjct  374  ASKPLDTILEFIYDAYENETETLVVPDSVRMNKDVRNSREADALKSYRPRNRHFVRREDC  433

Query  293  TPVLNWIQS  267
            + VL WI+S
Sbjct  434  SSVLEWIRS  442



>ref|XP_010454298.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Camelina 
sativa]
Length=395

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML    GVLSEAR LLD+GLLPN+N A
Sbjct  192  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGPNGVLSEARWLLDIGLLPNTNPA  251

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLLYC   GG SSPRDF+ FL+ FQ ASRNFAKRQ+TWFR EP+YHW++
Sbjct  252  TRAIGYRQAMEYLLYCSRYGGESSPRDFYGFLNRFQTASRNFAKRQMTWFRCEPIYHWLN  311

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+  +L  IYD+Y +++  L++P+SL + K++   RE +E+K YR RN+ F+ REDC
Sbjct  312  ASKPLDMILQCIYDAYENETDTLEIPESLRMSKDVLDSREASELKIYRSRNRQFVTREDC  371

Query  293  TPVLNWIQS  267
              VL WI+S
Sbjct  372  ASVLEWIRS  380



>ref|XP_002873979.1| ATIPT9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50238.1| ATIPT9 [Arabidopsis lyrata subsp. lyrata]
Length=463

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML    GVLSEAR LLDLGLLPN+N A
Sbjct  260  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGPNGVLSEARWLLDLGLLPNTNPA  319

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLL CR   G SSPR+F+ FL++FQ ASRNFAKRQ+TWFR EP+YHW++
Sbjct  320  TRAIGYRQAMEYLLKCRRYDGESSPREFYGFLNKFQTASRNFAKRQMTWFRCEPMYHWLN  379

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+ S+L  IYD+Y S+   +++P+SL + K++   RE +E+K YR +N+HF+ REDC
Sbjct  380  ASKPLDSILQCIYDAYESEGETVEIPESLRMSKDVRDSREASELKLYRSKNRHFVRREDC  439

Query  293  TPVLNWIQS  267
             PVL WI+S
Sbjct  440  DPVLEWIRS  448



>gb|AAM63091.1| IPP transferase-like protein [Arabidopsis thaliana]
Length=463

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML    GVLSEAR LLDLGLLPNSN A
Sbjct  260  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGPNGVLSEARWLLDLGLLPNSNPA  319

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLL CR   G SSPR+F+AFL++FQ ASRNFAKRQ+TWFR EP+YHW++
Sbjct  320  TRAIGYRQAMEYLLQCRRYEGESSPREFYAFLNKFQTASRNFAKRQMTWFRCEPMYHWLN  379

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+ S+L  IYD+Y S++  +++P+SL + K++   RE +E+K YR +N+HF+ REDC
Sbjct  380  ASKPLDSILQCIYDAYESEAEMVEIPESLRMSKDVRDSREASELKGYRSKNRHFVRREDC  439

Query  293  TPVLNWIQS  267
            + VL WI+S
Sbjct  440  SSVLEWIRS  448



>ref|NP_851043.1| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
 sp|Q9C5J6.1|IPT9_ARATH RecName: Full=tRNA dimethylallyltransferase 9; AltName: Full=Isopentenyl-diphosphate: 
tRNA isopentenyltransferase 9; Short=AtIPT9; 
Short=IPP transferase 9; Short=IPPT 9 [Arabidopsis 
thaliana]
 gb|AAK25918.1|AF360208_1 putative IPP transferase [Arabidopsis thaliana]
 gb|AAK64114.1| putative IPP transferase [Arabidopsis thaliana]
 gb|AED92782.1| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
Length=463

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML    GVLSEAR LLDLGLLPNSN A
Sbjct  260  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGPNGVLSEARWLLDLGLLPNSNPA  319

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLL CR   G SSPR+F+AFL++FQ ASRNFAKRQ+TWFR EP+YHW++
Sbjct  320  TRAIGYRQAMEYLLQCRRYEGESSPREFYAFLNKFQTASRNFAKRQMTWFRCEPMYHWLN  379

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+ S+L  IYD+Y S++  +++P+SL + K++   RE +E+K YR +N+HF+ REDC
Sbjct  380  ASKPLDSILQCIYDAYESEAEMVEIPESLRMSKDVRDSREASELKGYRSKNRHFVRREDC  439

Query  293  TPVLNWIQS  267
            + VL WI+S
Sbjct  440  SSVLEWIRS  448



>ref|XP_009126411.1| PREDICTED: tRNA dimethylallyltransferase 9 [Brassica rapa]
Length=464

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+DLYRSIDFRCEDML    GVL+EAR LLDLGLLPN++SA
Sbjct  260  QNIETDLDYDFLCFFLSSPRVDLYRSIDFRCEDMLSGANGVLTEARWLLDLGLLPNTSSA  319

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYL  CR Q G SSP +F+ FL++FQ+ASRNFAKRQ+TWFR EP+YHW++
Sbjct  320  TRAIGYRQAMEYLSKCRRQRGVSSPGEFYGFLNKFQQASRNFAKRQMTWFRCEPMYHWLN  379

Query  473  ASRPMGSVLDFIYDSYHSQSGH-LKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRED  297
            ASRP+ ++L+FIYD+Y  +    L VP SL + K++ + RE   +K YRPRN+HF+GRED
Sbjct  380  ASRPLDTILEFIYDAYEKEGETLLVVPDSLRMNKDLRNSREANALKGYRPRNRHFVGRED  439

Query  296  CTPVLNWIQS  267
            C+ VL WI S
Sbjct  440  CSSVLEWISS  449



>ref|XP_010493097.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Camelina 
sativa]
Length=395

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML    GVLSEAR LLD+GLLPN+N A
Sbjct  192  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGPNGVLSEARWLLDIGLLPNTNPA  251

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLLYC   GG SSPRDF+ FL+ FQ ASRNFAKRQ+TWFR EP+YHW++
Sbjct  252  TRAIGYRQAMEYLLYCSRYGGESSPRDFYGFLNRFQTASRNFAKRQMTWFRCEPIYHWLN  311

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+  +L  IYD+Y +++  L++P+SL + K++   RE +E+K YR RN+ F+ REDC
Sbjct  312  ASKPLDMILQCIYDAYENETETLEIPESLRMSKDVLDSREASELKIYRSRNRQFVTREDC  371

Query  293  TPVLNWIQS  267
              VL WI+S
Sbjct  372  ASVLEWIRS  380



>ref|XP_006594736.1| PREDICTED: tRNA dimethylallyltransferase 9-like isoform X2 [Glycine 
max]
Length=357

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
             ++++   +LDY+F+C FL++ RLDLY+SID+RCEDMLL   G+LSEA+ LLD GL PNS
Sbjct  163  AMEKTNSSELDYEFMCFFLSSHRLDLYKSIDYRCEDMLLGRDGILSEAQWLLDTGLHPNS  222

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA++AIGYRQAMEYL  CREQGG SS  +F+ FL EFQKASRNFAKRQLTWFRNE +Y 
Sbjct  223  NSATKAIGYRQAMEYLQRCREQGGHSSVEEFYKFLFEFQKASRNFAKRQLTWFRNENIYQ  282

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W+DAS+P+ ++LDFI+ +YH  +G + VP+ L + ++IS+ R+ A++K YR RN+HF+  
Sbjct  283  WLDASKPLETILDFIHGAYHDWNGSILVPEDLRMSRDISNHRQAAQLKAYRTRNRHFVNG  342

Query  302  EDCTPVLNWIQ  270
            EDCT +LNWI+
Sbjct  343  EDCTHILNWIR  353



>ref|XP_010454297.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Camelina 
sativa]
Length=462

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML    GVLSEAR LLD+GLLPN+N A
Sbjct  259  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGPNGVLSEARWLLDIGLLPNTNPA  318

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLLYC   GG SSPRDF+ FL+ FQ ASRNFAKRQ+TWFR EP+YHW++
Sbjct  319  TRAIGYRQAMEYLLYCSRYGGESSPRDFYGFLNRFQTASRNFAKRQMTWFRCEPIYHWLN  378

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+  +L  IYD+Y +++  L++P+SL + K++   RE +E+K YR RN+ F+ REDC
Sbjct  379  ASKPLDMILQCIYDAYENETDTLEIPESLRMSKDVLDSREASELKIYRSRNRQFVTREDC  438

Query  293  TPVLNWIQS  267
              VL WI+S
Sbjct  439  ASVLEWIRS  447



>ref|XP_010493096.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Camelina 
sativa]
Length=462

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML    GVLSEAR LLD+GLLPN+N A
Sbjct  259  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGPNGVLSEARWLLDIGLLPNTNPA  318

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLLYC   GG SSPRDF+ FL+ FQ ASRNFAKRQ+TWFR EP+YHW++
Sbjct  319  TRAIGYRQAMEYLLYCSRYGGESSPRDFYGFLNRFQTASRNFAKRQMTWFRCEPIYHWLN  378

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+  +L  IYD+Y +++  L++P+SL + K++   RE +E+K YR RN+ F+ REDC
Sbjct  379  ASKPLDMILQCIYDAYENETETLEIPESLRMSKDVLDSREASELKIYRSRNRQFVTREDC  438

Query  293  TPVLNWIQS  267
              VL WI+S
Sbjct  439  ASVLEWIRS  447



>ref|XP_010420835.1| PREDICTED: tRNA dimethylallyltransferase 9-like isoform X2 [Camelina 
sativa]
Length=395

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML    GVLSEAR LLD+GLLPN+N A
Sbjct  192  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGPNGVLSEARWLLDIGLLPNTNPA  251

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLLYC   GG SSPRDF  FL+ FQ ASRNFAKRQ+TWFR EP+YHW++
Sbjct  252  TRAIGYRQAMEYLLYCSRYGGESSPRDFHVFLNRFQTASRNFAKRQMTWFRCEPIYHWLN  311

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+  +L  IYD+Y +++  L++P+SL + K++   RE +E+K YR RN+ F+ REDC
Sbjct  312  ASKPLDMILQCIYDAYENETETLEIPESLRMSKDVLDSREASELKLYRSRNRQFVTREDC  371

Query  293  TPVLNWIQS  267
              VL WI+S
Sbjct  372  ASVLEWIRS  380



>ref|XP_009394407.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394416.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394424.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   260 bits (665),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            KDLDY+F+C FLT  R+DLYRSID RCEDML+E  G+LSEA  LLD+GL PN NSA+RAI
Sbjct  250  KDLDYNFICFFLTGPRIDLYRSIDLRCEDMLMETEGLLSEASWLLDIGLHPNMNSATRAI  309

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYRQAMEYLL CREQGG S+P +F AFLSEFQKASRNFAKRQ+TWFRNE +Y+W+DASRP
Sbjct  310  GYRQAMEYLLSCREQGGRSTPEEFRAFLSEFQKASRNFAKRQITWFRNELIYYWLDASRP  369

Query  461  MGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVL  282
               V+DFI D+YH Q+G L VP+SL +KK  + R+E  E+K+YR + + F   +DC  V+
Sbjct  370  FEEVIDFICDAYHDQTGRLVVPESLKMKKHTNGRQETYELKSYRAQVKLFSRDQDCDHVM  429

Query  281  NWIQSIYAR  255
            NWI+S   R
Sbjct  430  NWIRSTQRR  438



>ref|XP_008811501.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X5 [Phoenix 
dactylifera]
Length=473

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ++  KDLDY+F+C+FL++ R+ LYRSID RCE+ML++  G+LSE+  LLD+GL PN N
Sbjct  274  LQENPAKDLDYEFICLFLSSPRVALYRSIDLRCEEMLMDPEGLLSESSWLLDIGLRPNMN  333

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CREQGG SSP +F+AFL EFQKASRNFAKRQ+TWFRNE +Y+W
Sbjct  334  SATRAIGYRQAMEYLLSCREQGGKSSPEEFYAFLYEFQKASRNFAKRQMTWFRNELIYNW  393

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DASRP   V+DFI ++Y+ QSG L VP+SL +KK+ + +RE  E+K+YR +N+ FIG  
Sbjct  394  LDASRPFEKVIDFICNAYYDQSGALVVPESLKMKKDNNGQRETYELKSYRTKNKLFIGDL  453

Query  299  DCTPVLNWIQ  270
            DC  VLNWI+
Sbjct  454  DCHHVLNWIR  463



>ref|XP_008811491.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X4 [Phoenix 
dactylifera]
Length=476

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ++  KDLDY+F+C+FL++ R+ LYRSID RCE+ML++  G+LSE+  LLD+GL PN N
Sbjct  274  LQENPAKDLDYEFICLFLSSPRVALYRSIDLRCEEMLMDPEGLLSESSWLLDIGLRPNMN  333

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CREQGG SSP +F+AFL EFQKASRNFAKRQ+TWFRNE +Y+W
Sbjct  334  SATRAIGYRQAMEYLLSCREQGGKSSPEEFYAFLYEFQKASRNFAKRQMTWFRNELIYNW  393

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DASRP   V+DFI ++Y+ QSG L VP+SL +KK+ + +RE  E+K+YR +N+ FIG  
Sbjct  394  LDASRPFEKVIDFICNAYYDQSGALVVPESLKMKKDNNGQRETYELKSYRTKNKLFIGDL  453

Query  299  DCTPVLNWIQ  270
            DC  VLNWI+
Sbjct  454  DCHHVLNWIR  463



>ref|XP_008811509.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X6 [Phoenix 
dactylifera]
Length=471

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ++  KDLDY+F+C+FL++ R+ LYRSID RCE+ML++  G+LSE+  LLD+GL PN N
Sbjct  274  LQENPAKDLDYEFICLFLSSPRVALYRSIDLRCEEMLMDPEGLLSESSWLLDIGLRPNMN  333

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CREQGG SSP +F+AFL EFQKASRNFAKRQ+TWFRNE +Y+W
Sbjct  334  SATRAIGYRQAMEYLLSCREQGGKSSPEEFYAFLYEFQKASRNFAKRQMTWFRNELIYNW  393

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DASRP   V+DFI ++Y+ QSG L VP+SL +KK+ + +RE  E+K+YR +N+ FIG  
Sbjct  394  LDASRPFEKVIDFICNAYYDQSGALVVPESLKMKKDNNGQRETYELKSYRTKNKLFIGDL  453

Query  299  DCTPVLNWIQ  270
            DC  VLNWI+
Sbjct  454  DCHHVLNWIR  463



>ref|XP_008811484.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X3 [Phoenix 
dactylifera]
Length=479

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ++  KDLDY+F+C+FL++ R+ LYRSID RCE+ML++  G+LSE+  LLD+GL PN N
Sbjct  274  LQENPAKDLDYEFICLFLSSPRVALYRSIDLRCEEMLMDPEGLLSESSWLLDIGLRPNMN  333

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CREQGG SSP +F+AFL EFQKASRNFAKRQ+TWFRNE +Y+W
Sbjct  334  SATRAIGYRQAMEYLLSCREQGGKSSPEEFYAFLYEFQKASRNFAKRQMTWFRNELIYNW  393

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DASRP   V+DFI ++Y+ QSG L VP+SL +KK+ + +RE  E+K+YR +N+ FIG  
Sbjct  394  LDASRPFEKVIDFICNAYYDQSGALVVPESLKMKKDNNGQRETYELKSYRTKNKLFIGDL  453

Query  299  DCTPVLNWIQ  270
            DC  VLNWI+
Sbjct  454  DCHHVLNWIR  463



>ref|XP_009394389.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394398.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=463

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            KDLDY+F+C FLT  R+DLYRSID RCEDML+E  G+LSEA  LLD+GL PN NSA+RAI
Sbjct  275  KDLDYNFICFFLTGPRIDLYRSIDLRCEDMLMETEGLLSEASWLLDIGLHPNMNSATRAI  334

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYRQAMEYLL CREQGG S+P +F AFLSEFQKASRNFAKRQ+TWFRNE +Y+W+DASRP
Sbjct  335  GYRQAMEYLLSCREQGGRSTPEEFRAFLSEFQKASRNFAKRQITWFRNELIYYWLDASRP  394

Query  461  MGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVL  282
               V+DFI D+YH Q+G L VP+SL +KK  + R+E  E+K+YR + + F   +DC  V+
Sbjct  395  FEEVIDFICDAYHDQTGRLVVPESLKMKKHTNGRQETYELKSYRAQVKLFSRDQDCDHVM  454

Query  281  NWIQSIYAR  255
            NWI+S   R
Sbjct  455  NWIRSTQRR  463



>ref|XP_008811477.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Phoenix 
dactylifera]
Length=490

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ++  KDLDY+F+C+FL++ R+ LYRSID RCE+ML++  G+LSE+  LLD+GL PN N
Sbjct  272  LQENPAKDLDYEFICLFLSSPRVALYRSIDLRCEEMLMDPEGLLSESSWLLDIGLRPNMN  331

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CREQGG SSP +F+AFL EFQKASRNFAKRQ+TWFRNE +Y+W
Sbjct  332  SATRAIGYRQAMEYLLSCREQGGKSSPEEFYAFLYEFQKASRNFAKRQMTWFRNELIYNW  391

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DASRP   V+DFI ++Y+ QSG L VP+SL +KK+ + +RE  E+K+YR +N+ FIG  
Sbjct  392  LDASRPFEKVIDFICNAYYDQSGALVVPESLKMKKDNNGQRETYELKSYRTKNKLFIGDL  451

Query  299  DCTPVLNWIQ  270
            DC  VLNWI+
Sbjct  452  DCHHVLNWIR  461



>ref|XP_008811471.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X1 [Phoenix 
dactylifera]
Length=492

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ++  KDLDY+F+C+FL++ R+ LYRSID RCE+ML++  G+LSE+  LLD+GL PN N
Sbjct  274  LQENPAKDLDYEFICLFLSSPRVALYRSIDLRCEEMLMDPEGLLSESSWLLDIGLRPNMN  333

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA+RAIGYRQAMEYLL CREQGG SSP +F+AFL EFQKASRNFAKRQ+TWFRNE +Y+W
Sbjct  334  SATRAIGYRQAMEYLLSCREQGGKSSPEEFYAFLYEFQKASRNFAKRQMTWFRNELIYNW  393

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            +DASRP   V+DFI ++Y+ QSG L VP+SL +KK+ + +RE  E+K+YR +N+ FIG  
Sbjct  394  LDASRPFEKVIDFICNAYYDQSGALVVPESLKMKKDNNGQRETYELKSYRTKNKLFIGDL  453

Query  299  DCTPVLNWIQ  270
            DC  VLNWI+
Sbjct  454  DCHHVLNWIR  463



>ref|XP_010941327.1| PREDICTED: tRNA dimethylallyltransferase 9 [Elaeis guineensis]
Length=470

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q++  KDLDY+F+C+FL++ R+ LYRSID RCE+ML++  G+LSEA  LLD+GL PN NS
Sbjct  274  QENPAKDLDYEFICLFLSSPRVALYRSIDLRCEEMLMDPEGLLSEASWLLDIGLHPNMNS  333

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A+RAIGYRQAMEYLL CREQGG SSP +F+AFL EFQKASRNFAKRQ+TWFRNE +Y W+
Sbjct  334  ATRAIGYRQAMEYLLSCREQGGKSSPEEFYAFLYEFQKASRNFAKRQMTWFRNELIYDWL  393

Query  476  DASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRED  297
            DASRP   V+DFI ++YH QSG L VP+SL +KK+ +  +E  E+K+YR  N+ FIG  D
Sbjct  394  DASRPFEKVIDFICNAYHDQSGELVVPESLKMKKDNNGHQETYELKSYRTNNKLFIGDHD  453

Query  296  CTPVLNWI  273
            C  VLNWI
Sbjct  454  CHHVLNWI  461



>ref|XP_010420834.1| PREDICTED: tRNA dimethylallyltransferase 9-like isoform X1 [Camelina 
sativa]
Length=462

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML    GVLSEAR LLD+GLLPN+N A
Sbjct  259  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGPNGVLSEARWLLDIGLLPNTNPA  318

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLLYC   GG SSPRDF  FL+ FQ ASRNFAKRQ+TWFR EP+YHW++
Sbjct  319  TRAIGYRQAMEYLLYCSRYGGESSPRDFHVFLNRFQTASRNFAKRQMTWFRCEPIYHWLN  378

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+  +L  IYD+Y +++  L++P+SL + K++   RE +E+K YR RN+ F+ REDC
Sbjct  379  ASKPLDMILQCIYDAYENETETLEIPESLRMSKDVLDSREASELKLYRSRNRQFVTREDC  438

Query  293  TPVLNWIQS  267
              VL WI+S
Sbjct  439  ASVLEWIRS  447



>ref|XP_003543220.1| PREDICTED: tRNA dimethylallyltransferase 9-like isoform X1 [Glycine 
max]
 gb|KHN36873.1| tRNA dimethylallyltransferase 9 [Glycine soja]
Length=448

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
             ++++   +LDY+F+C FL++ RLDLY+SID+RCEDMLL   G+LSEA+ LLD GL PNS
Sbjct  254  AMEKTNSSELDYEFMCFFLSSHRLDLYKSIDYRCEDMLLGRDGILSEAQWLLDTGLHPNS  313

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA++AIGYRQAMEYL  CREQGG SS  +F+ FL EFQKASRNFAKRQLTWFRNE +Y 
Sbjct  314  NSATKAIGYRQAMEYLQRCREQGGHSSVEEFYKFLFEFQKASRNFAKRQLTWFRNENIYQ  373

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W+DAS+P+ ++LDFI+ +YH  +G + VP+ L + ++IS+ R+ A++K YR RN+HF+  
Sbjct  374  WLDASKPLETILDFIHGAYHDWNGSILVPEDLRMSRDISNHRQAAQLKAYRTRNRHFVNG  433

Query  302  EDCTPVLNWIQ  270
            EDCT +LNWI+
Sbjct  434  EDCTHILNWIR  444



>ref|XP_010520596.1| PREDICTED: tRNA dimethylallyltransferase 9 [Tarenaya hassleriana]
Length=462

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 152/188 (81%), Gaps = 1/188 (1%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+   DLD++FLC FL++ R+DLYRSIDFRCEDM+  + GVL EA  LLD+GLLPNSNSA
Sbjct  262  QNTPADLDHEFLCFFLSSPRVDLYRSIDFRCEDMVSGSDGVLFEAGSLLDIGLLPNSNSA  321

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLL CR+Q GSS+P +F+ FL+EFQKASRNFAKRQ+TWFRNEP+YHW++
Sbjct  322  TRAIGYRQAMEYLLRCRQQHGSSNPGEFYRFLNEFQKASRNFAKRQMTWFRNEPIYHWLN  381

Query  473  ASRPMGSVLDFIYDSY-HSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRED  297
            AS+PM  +LDFI D+Y   Q+  L VP SL + K+ ++ RE  E+K YRP+N+ FI R+D
Sbjct  382  ASKPMERILDFISDAYEEDQAETLVVPDSLKMSKDTTAGREAYELKAYRPKNRRFIRRDD  441

Query  296  CTPVLNWI  273
            C+ VL WI
Sbjct  442  CSEVLEWI  449



>ref|XP_006287693.1| hypothetical protein CARUB_v10000903mg [Capsella rubella]
 gb|EOA20591.1| hypothetical protein CARUB_v10000903mg [Capsella rubella]
Length=463

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML  + GVLSEA+ LLDLGLLPNSNSA
Sbjct  260  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGSNGVLSEAKWLLDLGLLPNSNSA  319

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGY+QAMEYLL CR  GG SSP +F  FL++FQ ASRNFAKRQ+TWFR EP+YHW+D
Sbjct  320  TRAIGYKQAMEYLLKCRHNGGESSPAEFHGFLNKFQTASRNFAKRQMTWFRGEPMYHWLD  379

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+  +L  IYD+Y S+S  L++P+ L ++K+I   R  +E+K YR  N+HF+ REDC
Sbjct  380  ASKPLDMILQCIYDAYESESEMLEIPEYLRMRKDIRYTRGASELKLYRSINRHFVRREDC  439

Query  293  TPVLNWIQS  267
              VL WI+S
Sbjct  440  ASVLEWIRS  448



>ref|XP_004489048.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Cicer arietinum]
Length=448

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            + +   +LDY+FLC FL++ RLDLY+SID+RCEDMLL   G+LSEA+ LLD GL PNSNS
Sbjct  256  KATNSAELDYEFLCFFLSSDRLDLYKSIDYRCEDMLLGGDGILSEAQWLLDTGLHPNSNS  315

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A++AIGYRQAMEYLL CR+QGG SS  +F+ FLSEFQKASRNFAKRQLTWFRNE +YHWI
Sbjct  316  ATKAIGYRQAMEYLLGCRQQGGQSSAGEFYRFLSEFQKASRNFAKRQLTWFRNERIYHWI  375

Query  476  DASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRED  297
            DAS+P+ +V++FI+D Y   SG L VP  L + ++I++ R  A++K+YR +N+HF+  ED
Sbjct  376  DASKPLETVVNFIHDLYRDGSGSLSVPAYLRMSRDITNPRIAAKLKSYRTKNRHFVTGED  435

Query  296  CTPVLNWIQ  270
            C P+L WI+
Sbjct  436  CLPILEWIK  444



>ref|NP_001190344.1| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
 gb|AED92784.1| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
Length=469

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 154/195 (79%), Gaps = 6/195 (3%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML    GVLSEAR LLDLGLLPNSN A
Sbjct  260  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGPNGVLSEARWLLDLGLLPNSNPA  319

Query  653  SRAIGYRQ------AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEP  492
            +RAIGYRQ      AMEYLL CR   G SSPR+F+AFL++FQ ASRNFAKRQ+TWFR EP
Sbjct  320  TRAIGYRQVNSLFPAMEYLLQCRRYEGESSPREFYAFLNKFQTASRNFAKRQMTWFRCEP  379

Query  491  LYHWIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHF  312
            +YHW++AS+P+ S+L  IYD+Y S++  +++P+SL + K++   RE +E+K YR +N+HF
Sbjct  380  MYHWLNASKPLDSILQCIYDAYESEAEMVEIPESLRMSKDVRDSREASELKGYRSKNRHF  439

Query  311  IGREDCTPVLNWIQS  267
            + REDC+ VL WI+S
Sbjct  440  VRREDCSSVLEWIRS  454



>ref|XP_007149408.1| hypothetical protein PHAVU_005G067800g [Phaseolus vulgaris]
 gb|ESW21402.1| hypothetical protein PHAVU_005G067800g [Phaseolus vulgaris]
Length=445

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G++++   +LDY+F+C FL++ RLDLY+SID+RCEDMLL   G+LSEA+ LLD GL PNS
Sbjct  251  GMEETSSSELDYEFMCFFLSSHRLDLYKSIDYRCEDMLLGRDGILSEAQWLLDTGLHPNS  310

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA++AIGYRQAMEYL  CRE GG SS  +F+ FL EFQKASRNFAKRQLTWFRNE +Y 
Sbjct  311  NSATKAIGYRQAMEYLQSCREHGGQSSVAEFYKFLFEFQKASRNFAKRQLTWFRNEGIYQ  370

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W+DAS+P+ ++L FI  +YH  +G L VP+ L + ++IS+RRE  ++K+YR +N+HF+  
Sbjct  371  WLDASKPLETILSFINGAYHDWNGSLLVPEHLRMSRDISNRREATQLKSYRTKNRHFVKG  430

Query  302  EDCTPVLNWI  273
            EDC+ +LNWI
Sbjct  431  EDCSHILNWI  440



>ref|NP_568390.2| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
 dbj|BAB59048.1| tRNA isopentenyltransferase [Arabidopsis thaliana]
 gb|AED92783.1| tRNA isopentenyltransferase AtIPT9 [Arabidopsis thaliana]
Length=459

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 151/189 (80%), Gaps = 4/189 (2%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ E DLDYDFLC FL++ R+ LYRSIDFRCEDML    GVLSEAR LLDLGLLPNSN A
Sbjct  260  QNIETDLDYDFLCFFLSSPRVALYRSIDFRCEDMLSGPNGVLSEARWLLDLGLLPNSNPA  319

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            +RAIGYRQAMEYLL CR   G SSPR+F+AFL++FQ ASRNFAKRQ+TWFR EP+YHW++
Sbjct  320  TRAIGYRQAMEYLLQCRRYEGESSPREFYAFLNKFQTASRNFAKRQMTWFRCEPMYHWLN  379

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+ S+L  IYD+Y S++  +++P+SL + K++   RE +E+K YR +N+    REDC
Sbjct  380  ASKPLDSILQCIYDAYESEAEMVEIPESLRMSKDVRDSREASELKGYRSKNR----REDC  435

Query  293  TPVLNWIQS  267
            + VL WI+S
Sbjct  436  SSVLEWIRS  444



>ref|XP_006852479.1| hypothetical protein AMTR_s00021p00131420 [Amborella trichopoda]
 gb|ERN13946.1| hypothetical protein AMTR_s00021p00131420 [Amborella trichopoda]
Length=497

 Score =   251 bits (642),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            ++LDY+FLC FL+  R+DLYR ID RCE+ML E+ G+L EA  LLD+GLLPN+NSA+RAI
Sbjct  278  ENLDYEFLCFFLSCPRMDLYRLIDLRCEEMLKESQGILFEASWLLDMGLLPNTNSATRAI  337

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYRQ+MEYLL CR+ GG SS  +F AFLS+FQKASRNFAKRQ+TWFRNE +Y W+DAS+P
Sbjct  338  GYRQSMEYLLNCRQDGGRSSAGEFMAFLSDFQKASRNFAKRQMTWFRNEHIYQWLDASKP  397

Query  461  MGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVL  282
            M +VLDFI  SY  Q+  L VPK L + K++S++REV +MK+Y+ RN+HF+ R+DC  +L
Sbjct  398  METVLDFIVKSYVDQTISLDVPKQLRINKDLSTQREVLDMKSYQTRNRHFVQRDDCARIL  457

Query  281  NWIQ  270
             WI+
Sbjct  458  EWIK  461



>gb|KDO48345.1| hypothetical protein CISIN_1g012837mg [Citrus sinensis]
Length=430

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G   +  KDLDYDF+C FL++ RLDLYRSID RCEDML  + G+LSEA  LLD GLLPNS
Sbjct  250  GASDTNPKDLDYDFMCFFLSSHRLDLYRSIDLRCEDMLPGSDGILSEAAWLLDEGLLPNS  309

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYLL CR+QGG+SS  +F+AFL+EFQKASRNFAKRQLTWFRNE +YH
Sbjct  310  NSATRAIGYRQAMEYLLRCRQQGGTSSTGEFYAFLAEFQKASRNFAKRQLTWFRNERIYH  369

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR  303
            W++A+RP+ +VL++I  +YH  +G L VP  L ++++ SS REV+E+K+YR RN++ + R
Sbjct  370  WLNAARPLENVLNYIITAYHDSTGTLVVPDYLQIRRDSSSSREVSELKSYRTRNRYKLLR  429



>ref|XP_006451736.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
 gb|ESR64976.1| hypothetical protein CICLE_v10008222mg [Citrus clementina]
Length=460

 Score =   245 bits (626),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G   +  KDLDYDF+C FL++ RLDLYRSID RCEDML  + G+LSEA  LLD GLLPNS
Sbjct  250  GASDTNPKDLDYDFMCFFLSSHRLDLYRSIDLRCEDMLPGSDGILSEAAWLLDEGLLPNS  309

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            NSA+RAIGYRQAMEYLL CR+QGG+SS  +F+AFL+EFQKASRNFAKRQLTWFRNE +YH
Sbjct  310  NSATRAIGYRQAMEYLLRCRQQGGTSSTGEFYAFLAEFQKASRNFAKRQLTWFRNEHIYH  369

Query  482  WIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQH  315
            W++A+RP+ +VL++I  +YH  +G L VP  L ++++ SS REV+E+K+YR RN++
Sbjct  370  WLNAARPLENVLNYIITAYHDSTGTLVVPDYLQMRRDSSSSREVSELKSYRTRNRY  425



>ref|XP_003563223.2| PREDICTED: tRNA dimethylallyltransferase 9 [Brachypodium distachyon]
Length=451

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 147/189 (78%), Gaps = 2/189 (1%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            K+LDY FLC+FL   R++LYRSID RCE+ML +  G+LSEA  LLD+GL PN NSASRAI
Sbjct  265  KELDYVFLCIFLACPRVELYRSIDLRCEEMLADTGGLLSEASWLLDIGLHPNMNSASRAI  324

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYRQAMEYLL+CR+ GGSSSP++FF FL++FQ+ SRNF+KRQ+TWFRNE +Y W+DAS+P
Sbjct  325  GYRQAMEYLLHCRQNGGSSSPQEFFEFLTKFQQTSRNFSKRQMTWFRNEKIYQWVDASQP  384

Query  461  MGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVL  282
              +++ FI D+YH     + VP+SL +K+E S   + +++KTYR  N+ F+G EDC  VL
Sbjct  385  FEAIVQFICDAYHGCDA-MVVPESLEMKRE-SCMHKTSDLKTYRSENKVFLGDEDCGHVL  442

Query  281  NWIQSIYAR  255
            +WI+   A+
Sbjct  443  DWIRRTQAK  451



>ref|XP_006656524.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Oryza brachyantha]
Length=418

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 141/190 (74%), Gaps = 2/190 (1%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            K+LDYDFLC+FL   R+DLYRSID RCE+ML +  G+LSEA  LLD+GL P  NSA+ AI
Sbjct  231  KELDYDFLCIFLACPRVDLYRSIDLRCEEMLADTGGLLSEASWLLDIGLSPGMNSATCAI  290

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYRQAMEYLL CR  GGSSSP++FF FL++FQ ASRNF+KRQLTWFRNE +Y W+DAS+P
Sbjct  291  GYRQAMEYLLQCRHNGGSSSPQEFFEFLTKFQTASRNFSKRQLTWFRNEKIYQWVDASQP  350

Query  461  MGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVL  282
              ++  FI D+YH   G   VP SL +K+E S R E  ++KTYR  N+ F G +DC+ VL
Sbjct  351  FDAISQFICDAYH-HCGSRVVPDSLEMKRE-SCRHESRDLKTYRSENRVFRGDDDCSHVL  408

Query  281  NWIQSIYARE  252
            +WI     R+
Sbjct  409  DWITRTQKRK  418



>ref|NP_001058651.2| Os06g0729800 [Oryza sativa Japonica Group]
 dbj|BAE47453.1| prokaryotic tRNA isopentenyltransferase [Oryza sativa Japonica 
Group]
 gb|EAZ02440.1| hypothetical protein OsI_24543 [Oryza sativa Indica Group]
 gb|EEE66431.1| hypothetical protein OsJ_22787 [Oryza sativa Japonica Group]
 dbj|BAF20565.2| Os06g0729800 [Oryza sativa Japonica Group]
Length=417

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 140/187 (75%), Gaps = 2/187 (1%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q  E +LDYDFLC+FL   R++LYRSID RCE+ML +  G+LSEA  LLD+GL P  NSA
Sbjct  227  QPTELELDYDFLCIFLACPRVELYRSIDLRCEEMLADTGGLLSEASWLLDIGLSPGMNSA  286

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            + AIGYRQAMEYLL CR  GGSSSP++F  FL++FQ ASRNF+KRQ+TWFRNE +Y W+D
Sbjct  287  TCAIGYRQAMEYLLQCRHNGGSSSPQEFLEFLTKFQTASRNFSKRQMTWFRNEKIYQWVD  346

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P  ++  FI D+YH ++  L VP SL +K+E S R E  ++KTYR  N+ F G +DC
Sbjct  347  ASQPFDAIAQFICDAYHDRAARL-VPDSLEMKRE-SCRHESRDLKTYRSENRVFRGDDDC  404

Query  293  TPVLNWI  273
              VL+WI
Sbjct  405  CHVLDWI  411



>dbj|BAD62118.1| putative tRNA isopentenyltransferase [Oryza sativa Japonica Group]
Length=487

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 140/187 (75%), Gaps = 2/187 (1%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q  E +LDYDFLC+FL   R++LYRSID RCE+ML +  G+LSEA  LLD+GL P  NSA
Sbjct  297  QPTELELDYDFLCIFLACPRVELYRSIDLRCEEMLADTGGLLSEASWLLDIGLSPGMNSA  356

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            + AIGYRQAMEYLL CR  GGSSSP++F  FL++FQ ASRNF+KRQ+TWFRNE +Y W+D
Sbjct  357  TCAIGYRQAMEYLLQCRHNGGSSSPQEFLEFLTKFQTASRNFSKRQMTWFRNEKIYQWVD  416

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P  ++  FI D+YH ++  L VP SL +K+E S R E  ++KTYR  N+ F G +DC
Sbjct  417  ASQPFDAIAQFICDAYHDRAARL-VPDSLEMKRE-SCRHESRDLKTYRSENRVFRGDDDC  474

Query  293  TPVLNWI  273
              VL+WI
Sbjct  475  CHVLDWI  481



>ref|XP_002437643.1| hypothetical protein SORBIDRAFT_10g031125 [Sorghum bicolor]
 gb|EER89010.1| hypothetical protein SORBIDRAFT_10g031125 [Sorghum bicolor]
Length=403

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 144/186 (77%), Gaps = 2/186 (1%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            + ++LDYDF C+FL + R++LYRSID RCE+ML +  G+LSEA  LLD+GL P  NSA+ 
Sbjct  217  EARELDYDFFCIFLASPRIELYRSIDLRCEEMLADTGGLLSEASWLLDIGLQPRINSATS  276

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
            AIGY+QAMEYLL+CR+ GG S+P++F  FL++FQ+ SRNFAKRQLTWFRNE +YHW+D S
Sbjct  277  AIGYKQAMEYLLHCRQNGGESTPQEFLDFLAKFQRTSRNFAKRQLTWFRNEKIYHWVDGS  336

Query  467  RPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTP  288
            +P  +++ F+ D+YH  S  + VP+SL +K+E S   +  ++KTYR  N+ F+G +DC+ 
Sbjct  337  QPFEALVQFVCDAYHGCSARM-VPESLEMKRE-SCVLKSRDLKTYRSVNRVFLGDDDCSH  394

Query  287  VLNWIQ  270
            VLNWI+
Sbjct  395  VLNWIR  400



>dbj|BAJ89736.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 142/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            + K+LDYDFLC FL   R++LYRSID RCE+ML++  G+LSEA  LLD+GL PN NSA+R
Sbjct  261  ETKELDYDFLCFFLACPRVELYRSIDLRCEEMLVDTGGLLSEASWLLDIGLQPNMNSATR  320

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
            AIGYRQ MEYLL+CR+ GGSSSP +F  FL++FQ+ SRNF++RQ+TWFRNE +Y W+DAS
Sbjct  321  AIGYRQTMEYLLHCRQNGGSSSPEEFLEFLTKFQQTSRNFSRRQMTWFRNEKIYQWVDAS  380

Query  467  RPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTP  288
            +P   ++ FI D+Y+  S  L +P+SL +K+E S      ++KTYR  N+ F+G EDC  
Sbjct  381  QPFEEIVQFICDAYNG-SDALVLPESLEMKRE-SCLHTSKDLKTYRSENRVFLGHEDCRH  438

Query  287  VLNWIQ  270
            +L+WI+
Sbjct  439  ILDWIR  444



>ref|NP_001127753.1| isopentenyl transferase [Zea mays]
 gb|ACF17570.1| isopentenyl transferase [Zea mays]
Length=441

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 146/189 (77%), Gaps = 8/189 (4%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            + ++++YDF C+FL + R++LYRSID RCE+ML++  G+LSEA  LLD+GL P  NSAS 
Sbjct  253  EAREMEYDFFCIFLASPRIELYRSIDLRCEEMLVDTGGLLSEASWLLDIGLQPRMNSASS  312

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
            AIGY+QAMEYLL+CR+ GG S+P++F  FL++FQ+ SRNFAKRQLTWFRNE +YHW+D S
Sbjct  313  AIGYKQAMEYLLHCRQNGGESTPQEFLDFLAKFQRTSRNFAKRQLTWFRNEKIYHWVDGS  372

Query  467  RPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKE---ISSRREVAEMKTYRPRNQHFIGRED  297
            +P  +++ F+ D+YH  S  + VP+SL +K+E   + SR    ++KTYR  N+ F+G +D
Sbjct  373  KPFEALVQFVCDAYHGCSARM-VPESLEMKRENCVLKSR----DLKTYRSMNRVFLGGDD  427

Query  296  CTPVLNWIQ  270
            C+ VLNWI+
Sbjct  428  CSHVLNWIR  436



>ref|XP_008647277.1| PREDICTED: isopentenyl transferase isoform X1 [Zea mays]
 gb|AFW75691.1| isopentenyl transferase [Zea mays]
Length=453

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 146/189 (77%), Gaps = 8/189 (4%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            + ++++YDF C+FL + R++LYRSID RCE+ML++  G+LSEA  LLD+GL P  NSAS 
Sbjct  265  EAREMEYDFFCIFLASPRIELYRSIDLRCEEMLVDTGGLLSEASWLLDIGLQPRMNSASS  324

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
            AIGY+QAMEYLL+CR+ GG S+P++F  FL++FQ+ SRNFAKRQLTWFRNE +YHW+D S
Sbjct  325  AIGYKQAMEYLLHCRQNGGESTPQEFLDFLAKFQRTSRNFAKRQLTWFRNEKIYHWVDGS  384

Query  467  RPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKE---ISSRREVAEMKTYRPRNQHFIGRED  297
            +P  +++ F+ D+YH  S  + VP+SL +K+E   + SR    ++KTYR  N+ F+G +D
Sbjct  385  KPFEALVQFVCDAYHGCSARM-VPESLEMKRENCVLKSR----DLKTYRSMNRVFLGGDD  439

Query  296  CTPVLNWIQ  270
            C+ VLNWI+
Sbjct  440  CSHVLNWIR  448



>gb|EMS61041.1| tRNA dimethylallyltransferase 9 [Triticum urartu]
Length=449

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            K+L+YDFLC FL   R++LYRSID RCE+ML +  G+LSEA  LLD+GL PN NSA+RAI
Sbjct  263  KELEYDFLCFFLACPRVELYRSIDLRCEEMLADTGGLLSEASWLLDVGLQPNMNSATRAI  322

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYRQ MEYL++CR+ GGSSSP +F  FL++FQ+ SRNF++RQ+TWFRNE +Y W+DAS+P
Sbjct  323  GYRQTMEYLVHCRQNGGSSSPEEFLEFLTKFQQTSRNFSRRQMTWFRNEKIYQWVDASQP  382

Query  461  MGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVL  282
               ++ FI D+Y+  S  + +P+SL +K+E S      ++KTYRP N+ F+G E+C  +L
Sbjct  383  FEEIVQFICDAYNG-SDAMVLPESLEMKRE-SCVHTSKDLKTYRPENRVFLGHEECCHIL  440

Query  281  NWIQ  270
            +WI+
Sbjct  441  DWIR  444



>gb|EMT06411.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Aegilops 
tauschii]
Length=450

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 141/184 (77%), Gaps = 2/184 (1%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            K+L+YDFLC FL   R++LYRSID RCE+ML +  G+LSEA  L+D+GL PN NSA+RAI
Sbjct  264  KELEYDFLCFFLACPRVELYRSIDLRCEEMLADTGGLLSEAAWLIDIGLQPNMNSATRAI  323

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYRQ MEYLL+CR+ GGSSSP +F  FL++FQ+ SRNF++RQ+TWFRNE +Y W+DAS+P
Sbjct  324  GYRQTMEYLLHCRQNGGSSSPEEFLEFLTKFQQTSRNFSRRQMTWFRNEKIYQWVDASQP  383

Query  461  MGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVL  282
              +++ FI D+Y+  S  L +P+SL +K+E S      ++KTYR  N+ F+G E+C  VL
Sbjct  384  FEAIVQFICDAYNG-SDALVLPESLEMKRE-SCVHTSKDLKTYRSENKVFLGHEECCHVL  441

Query  281  NWIQ  270
            +WI+
Sbjct  442  DWIR  445



>ref|XP_002463348.1| hypothetical protein SORBIDRAFT_02g042160 [Sorghum bicolor]
 gb|EER99869.1| hypothetical protein SORBIDRAFT_02g042160 [Sorghum bicolor]
Length=389

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 142/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            + +++DYDF C+FL   RL+LYRSID RCE+ML++  G+LSEA  LLD+GL P+ NSA+R
Sbjct  201  EARNMDYDFFCIFLACPRLELYRSIDLRCEEMLVDTCGLLSEASWLLDIGLHPHVNSATR  260

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
            AIGY+QAMEYL++CR+ GG S+ ++F  FL++F+  SRNFA+RQ+TWFRNE +Y W++AS
Sbjct  261  AIGYKQAMEYLMHCRQNGGESTTQEFLEFLAKFKSTSRNFARRQITWFRNEKIYQWVNAS  320

Query  467  RPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTP  288
            +P   ++ FI D+YH  S  + VP+SL +K+E S   E  ++KTYR  N+ F G +DC+ 
Sbjct  321  QPFEVIVQFICDAYHGCSPRM-VPESLEMKRE-SCMLESRDLKTYRSENRVFRGDDDCSH  378

Query  287  VLNWIQ  270
            VLNWI+
Sbjct  379  VLNWIR  384



>ref|XP_004963310.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Setaria italica]
Length=450

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = -1

Query  815  LDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGY  636
            LDYDF C+FL + R++LYR++D RCE+ML +  G+LSEA  LLD+GL PN NSA+RAIGY
Sbjct  266  LDYDFFCIFLASPRIELYRALDLRCEEMLADTGGLLSEASWLLDIGLHPNMNSATRAIGY  325

Query  635  RQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRPMG  456
            +QAMEYLL+CR+ GG S+P++F  FL++FQ  SRNFAKRQLTWFRNE +Y W+DAS+P  
Sbjct  326  KQAMEYLLHCRQNGGESTPQEFLKFLAKFQSTSRNFAKRQLTWFRNERIYQWVDASQPFE  385

Query  455  SVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVLNW  276
             V+ FI ++YH     + VP+SL +K+E S   +  ++KTYR  N+ F G ++C+ VL+W
Sbjct  386  PVVQFICNAYHDPDARV-VPESLEMKRE-SCIHKTQDLKTYRSVNKVFRGDDNCSHVLDW  443

Query  275  IQ  270
            I+
Sbjct  444  IR  445



>gb|AGT16524.1| isopentenyl transferase [Saccharum hybrid cultivar R570]
Length=447

 Score =   219 bits (557),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 142/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            + K+LDYDF C+FL + R++LYRS+D RCE M+ +  G+LSEA  LLD+GL P  NSA+ 
Sbjct  259  EAKELDYDFFCIFLASPRIELYRSVDLRCEKMVADTGGLLSEASWLLDIGLQPRINSATS  318

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
            AIGY+QAMEYLL+CR+ GG S+P++F  FL++FQ+ SRNFAKRQLTWFRNE +YHW++ S
Sbjct  319  AIGYKQAMEYLLHCRQNGGESTPQEFLDFLAKFQRTSRNFAKRQLTWFRNEKIYHWVNVS  378

Query  467  RPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTP  288
            +P  +++ F+ D+YH  S  + VP+SL +K+E S   +  ++KTYR  N+ F+  +DC+ 
Sbjct  379  QPFEALVQFVCDAYHGCSARM-VPESLEMKRE-SCVLKSRDLKTYRSVNRLFLEDDDCSH  436

Query  287  VLNWIQ  270
            VLNWI+
Sbjct  437  VLNWIR  442



>gb|EPS66580.1| hypothetical protein M569_08195, partial [Genlisea aurea]
Length=387

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 131/171 (77%), Gaps = 6/171 (4%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E  LDY+F+C FLTTQR DLYRSID RCE M+L+  G+LSEA+ LLDLGL P+S+SA+RA
Sbjct  221  EGSLDYEFICFFLTTQRPDLYRSIDLRCETMILDG-GILSEAKWLLDLGLFPSSSSATRA  279

Query  644  IGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASR  465
            IGYRQAME+LL  RE     SPR    FLS FQ ASRNFAKRQLTWFRN+P+YHWIDAS+
Sbjct  280  IGYRQAMEFLLMSREVEDWCSPRQVLGFLSRFQTASRNFAKRQLTWFRNDPIYHWIDASK  339

Query  464  PMGSVLDFIYDSY--HSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQ  318
            P+ +V+DFI ++   H +    +VP SL+V+K+    R+V ++K+YR RN+
Sbjct  340  PLETVVDFISEACDDHGRGMIFRVPPSLAVEKD---ERDVRQLKSYRTRNR  387



>ref|XP_010108266.1| tRNA dimethylallyltransferase 9 [Morus notabilis]
 gb|EXC18506.1| tRNA dimethylallyltransferase 9 [Morus notabilis]
Length=444

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 139/187 (74%), Gaps = 9/187 (5%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            K KDL+YDF C FL++QRL+LY+SI +RCEDMLL + G+L+EAR LLD+GLLPNSNSA+R
Sbjct  256  KSKDLEYDFYCFFLSSQRLELYKSISYRCEDMLLGDDGILTEARWLLDIGLLPNSNSATR  315

Query  647  AIGYRQ-AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDA  471
            AIGYRQ A  Y + C+     S P ++   LS       NFAKRQLTWFRNE +YHW+DA
Sbjct  316  AIGYRQKASRYYISCQ-----SCPYEY--ILSMDIVCLGNFAKRQLTWFRNEKIYHWLDA  368

Query  470  SRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCT  291
            S+P+  VL+FIY++Y  +S  L VP+ L ++K+ ++ RE + +K YR RN+HF+ REDC+
Sbjct  369  SKPLDKVLNFIYNAYLDKSETLVVPEWLKMRKD-TNHREASLLKAYRTRNRHFVRREDCS  427

Query  290  PVLNWIQ  270
             +L WI+
Sbjct  428  EILEWIR  434



>ref|XP_002970127.1| hypothetical protein SELMODRAFT_410898 [Selaginella moellendorffii]
 gb|EFJ29251.1| hypothetical protein SELMODRAFT_410898 [Selaginella moellendorffii]
Length=434

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 131/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  818  DLDYDFLCVFLTTQRLDLYRSIDFRCEDMLL-ENY----GVLSEARGLLDLGLLPNSNSA  654
            + DYDFLC FL  +R+DLYR+ID RCE+ML  EN     G+L+EA  LLDL + P S+  
Sbjct  225  ETDYDFLCYFLYRRRIDLYRAIDARCEEMLAAENAESGRGILAEASWLLDLRIQPGSSPP  284

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            SRAIGYRQAMEYL  CR  GG SS   F  FLS FQ+ASRN+A+RQLTWFRNEPL+ WID
Sbjct  285  SRAIGYRQAMEYLNECRCAGGVSSEEHFLKFLSSFQQASRNYARRQLTWFRNEPLFQWID  344

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+  +LDF+ D Y S+   +K+   + +  E  +++E++ +K+Y  +N+ F+    C
Sbjct  345  ASQPLEKILDFLTDDY-SRPADVKIESRVVLSPEAIAKKELSLLKSYVAKNKIFVSSSAC  403

Query  293  T-PVLNWIQ  270
              P+L WI+
Sbjct  404  IPPILEWIK  412



>ref|XP_002985201.1| hypothetical protein SELMODRAFT_424359 [Selaginella moellendorffii]
 gb|EFJ13695.1| hypothetical protein SELMODRAFT_424359 [Selaginella moellendorffii]
Length=426

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 131/189 (69%), Gaps = 7/189 (4%)
 Frame = -1

Query  818  DLDYDFLCVFLTTQRLDLYRSIDFRCEDMLL-ENY----GVLSEARGLLDLGLLPNSNSA  654
            + DYDFLC FL  +R+DLYR+ID RCE+ML  EN     G+L+EA  LLDL + P S+  
Sbjct  217  ETDYDFLCYFLYRRRIDLYRAIDARCEEMLAAENAESGRGILAEASWLLDLRIQPGSSPP  276

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            SRAIGYRQAMEYL  CR  GG SS   F  FLS FQ+ASRN+A+RQLTWFRNEPL+ WID
Sbjct  277  SRAIGYRQAMEYLNECRCAGGVSSEEHFLKFLSSFQQASRNYARRQLTWFRNEPLFQWID  336

Query  473  ASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDC  294
            AS+P+  +LDF+ D + S+   +K+   + +  E  +++E++ +K+Y  +N+ F+    C
Sbjct  337  ASQPLEKILDFLTDDF-SRPADVKIESRVVLSPEAIAKKELSLLKSYVAKNKIFVSSSAC  395

Query  293  T-PVLNWIQ  270
              P+L WI+
Sbjct  396  IPPILEWIK  404



>ref|XP_001782787.1| predicted protein [Physcomitrella patens]
 gb|EDQ52364.1| predicted protein [Physcomitrella patens]
Length=680

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 114/192 (59%), Gaps = 10/192 (5%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E D DYDF C FL   R +LYR ID RCE M+ E  G+L EA  LLDLGLLPN++SASR 
Sbjct  476  EWDYDYDFQCYFLYQNRAELYRWIDLRCEQMIAEPQGLLQEASWLLDLGLLPNTSSASRG  535

Query  644  IGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNE-----PLYHW  480
            IGY++AME+L+ CR  GG ++   F AFLS FQ  SR+  K+QL WFR+        +HW
Sbjct  536  IGYQEAMEFLVECRGTGGITTEEKFLAFLSGFQHVSRSLVKKQLRWFRSSHDSAVKQFHW  595

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEI--SSRREVAEMKTYRPRNQHFIG  306
            IDAS+P   +L+ +   Y  + G+   P  L     +  +S +E   +K Y  +N+ F  
Sbjct  596  IDASQPTDQILEALRAEYLRRPGY---PSELKGSNALIDASYKEGKTLKYYDAKNRIFTS  652

Query  305  REDCTPVLNWIQ  270
                 PVL W++
Sbjct  653  SSTIAPVLRWVK  664



>dbj|BAG68561.1| isopentenyl transferase [Physcomitrella patens]
Length=426

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 118/187 (63%), Gaps = 8/187 (4%)
 Frame = -1

Query  812  DYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            DYDF C FL   R +LY+ +D RCE M  E  G+L EA  LLD GL PNSNSASR+IGY+
Sbjct  215  DYDFHCYFLYQPRSELYQKVDLRCEQMAQE--GLLDEASSLLDSGLQPNSNSASRSIGYQ  272

Query  632  QAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRN----EPLYHWIDASR  465
             AME+L+ CR+  G+++   FF FL EFQ+ SRN+ KRQLTWFRN    E +++WIDA++
Sbjct  273  LAMEFLMECRQVEGAATEERFFLFLEEFQRHSRNYVKRQLTWFRNKGQSEQMFNWIDATQ  332

Query  464  PMGSVLDFIYDSYHSQSGHLK-VPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR-EDCT  291
            P+  ++D +   Y   +  +  V K+ SV  + SS +E   +K YR +N+ F    E   
Sbjct  333  PLEVMVDALAKEYERPNEVVSDVLKAASVVTKESSYKEENLLKRYRTQNRIFTSNSEALK  392

Query  290  PVLNWIQ  270
              L WI+
Sbjct  393  RTLQWIR  399



>gb|ABP88738.1| tRNA-isopentenyltransferase [Physcomitrella patens]
Length=557

 Score =   153 bits (387),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 118/187 (63%), Gaps = 8/187 (4%)
 Frame = -1

Query  812  DYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            DYDF C FL   R +LY+ +D RCE M  E  G+L EA  LLD GL PNSNSASR+IGY+
Sbjct  346  DYDFHCYFLYQPRSELYQKVDLRCEQMAQE--GLLDEASSLLDSGLQPNSNSASRSIGYQ  403

Query  632  QAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRN----EPLYHWIDASR  465
             AME+L+ CR+  G+++   FF FL EFQ+ SRN+ KRQLTWFRN    E +++WIDA++
Sbjct  404  LAMEFLMECRQVEGAATEERFFLFLEEFQRHSRNYVKRQLTWFRNKGQSEQMFNWIDATQ  463

Query  464  PMGSVLDFIYDSYHSQSGHLK-VPKSLSVKKEISSRREVAEMKTYRPRNQHFIGR-EDCT  291
            P+  ++D +   Y   +  +  V K+ SV  + SS +E   +K YR +N+ F    E   
Sbjct  464  PLEVMVDALAKEYERPNEVVSDVLKAASVVTKESSYKEENLLKRYRTQNRIFTSNSEALK  523

Query  290  PVLNWIQ  270
              L WI+
Sbjct  524  RTLQWIR  530



>gb|AGC04674.1| tRNA-isopentenyltransferase [Physcomitrella patens]
Length=503

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 114/192 (59%), Gaps = 10/192 (5%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E D DYDF C FL   R +LY  ID RCE ML +  G+L EA  LLDLGL+P+S+SASR 
Sbjct  300  EWDYDYDFQCYFLYQHRAELYHWIDLRCEQMLADPRGLLQEASWLLDLGLMPDSSSASRG  359

Query  644  IGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNE-----PLYHW  480
            IGY++AME+L+ CR+ GG ++ +    FLS FQ  SR+  K+QLTWFR++       +HW
Sbjct  360  IGYQEAMEFLMECRKAGGMATEKRVLEFLSAFQHVSRSLVKKQLTWFRSDQHSDVKQFHW  419

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSL--SVKKEISSRREVAEMKTYRPRNQHFIG  306
            IDAS+    +L+ +   Y    G+   P  L  S  ++ +S +E   +K Y+  N+ F  
Sbjct  420  IDASQSTEKILEAMRKEYWRPPGY---PSELRGSDDRKHASYKEGKVLKYYKVENRIFTN  476

Query  305  REDCTPVLNWIQ  270
                  VL W++
Sbjct  477  SAAIANVLKWVK  488



>ref|XP_010279080.1| PREDICTED: tRNA dimethylallyltransferase 9 isoform X2 [Nelumbo 
nucifera]
Length=370

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            L ++  +DLDYDF+C FL++ RLDLYR ID RCEDML+   G+L+EA  LLD GLLPNSN
Sbjct  257  LGENLSEDLDYDFICFFLSSPRLDLYRLIDLRCEDMLMGRDGILAEATWLLDTGLLPNSN  316

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASR  534
            SA+RAIGYRQAMEYL+ CR+Q G SS +DF+AFLSEFQK+SR
Sbjct  317  SATRAIGYRQAMEYLVKCRQQQGHSSAQDFYAFLSEFQKSSR  358



>gb|AGC04673.1| tRNA-isopentenyltransferase [Physcomitrella patens]
Length=502

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 110/192 (57%), Gaps = 10/192 (5%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E D DYDF C F    R +LY  ID RCE M+    G+L EA  LLDLGL P+S+ +SR 
Sbjct  300  EWDSDYDFQCYFFYQHRKELYHCIDLRCEQMIANPRGLLQEASWLLDLGLTPDSSFSSRG  359

Query  644  IGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNE-----PLYHW  480
            IGY++AME+L+ CR+ GG S+   F AFLS FQ  SR+  K+QL WFR+        +HW
Sbjct  360  IGYQEAMEFLMECRKAGGRSTEERFLAFLSAFQHVSRSLVKKQLAWFRSNKHSDVKQFHW  419

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEI--SSRREVAEMKTYRPRNQHFIG  306
            IDAS+P   +L+ +   Y  + G+   P  LS   ++  +S  E   ++ Y  +N+ F  
Sbjct  420  IDASQPTDKILEALRKEYWRRPGY---PSELSGSDDVKHASYMEGKILRYYEVKNRIFTN  476

Query  305  REDCTPVLNWIQ  270
                  VL W++
Sbjct  477  PSAIATVLVWVK  488



>ref|XP_001780492.1| predicted protein [Physcomitrella patens]
 gb|EDQ54693.1| predicted protein [Physcomitrella patens]
Length=718

 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 117/199 (59%), Gaps = 19/199 (10%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E D +YDF C FL  QR +LYR ID RCE ML++  G+L EA  LLD+G++P+++SASR 
Sbjct  449  EWDCNYDFQCYFLYQQRAELYRWIDLRCEHMLVDPRGLLQEAAWLLDIGVMPDTSSASRG  508

Query  644  IGYRQ-------------AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWF  504
            IGY++             AME+L+ CR  GG+++   F AFLS FQ  SR+  K+QL WF
Sbjct  509  IGYQEVGFTYHPDHSSIRAMEFLVDCRRTGGNTTEERFLAFLSGFQHISRSLVKKQLKWF  568

Query  503  RNE-----PLYHWIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMK  339
            R++       +HWIDAS+P   +L+ +   Y  + G+    K     KE +S +E   +K
Sbjct  569  RSDQHSDVKQFHWIDASQPTDQILEALRKEYWRRPGYPSELKGSDAMKE-ASYKEGKTLK  627

Query  338  TYRPRNQHFIGREDCTPVL  282
             Y+ +N+ F      +PVL
Sbjct  628  HYKAKNRIFTDSTVISPVL  646



>dbj|BAG68564.1| isopentenyl transferase, partial [Physcomitrella patens]
Length=260

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 89/132 (67%), Gaps = 5/132 (4%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E D DYDF C FL   R +LY  ID RCE ML +  G+L EA  LLDLGL+P+S+SASR 
Sbjct  128  EWDYDYDFQCYFLYQHRAELYHWIDLRCEQMLADPRGLLQEASWLLDLGLMPDSSSASRG  187

Query  644  IGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNE-----PLYHW  480
            IGY++AME+L+ CR+ GG ++ +    FLS FQ  SR+  K+QLTWFR++       +HW
Sbjct  188  IGYQEAMEFLMECRKAGGMATEKRVLEFLSAFQHVSRSLVKKQLTWFRSDQHSDVKQFHW  247

Query  479  IDASRPMGSVLD  444
            IDAS+    +L+
Sbjct  248  IDASQSTEKILE  259



>ref|XP_001767747.1| predicted protein [Physcomitrella patens]
 gb|EDQ67498.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 120/220 (55%), Gaps = 44/220 (20%)
 Frame = -1

Query  812  DYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            DYDF C FL   R +LY+ +D RCE M  E  G+L EA  LLD GL PNSNSASR+IGY+
Sbjct  362  DYDFHCYFLYQPRSELYQKVDLRCEQMAQE--GLLDEASSLLDSGLQPNSNSASRSIGYQ  419

Query  632  QAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRN----EPLYHWIDASR  465
             AME+L+ CR+  G+++   FF FL EFQ+ SRN+ KRQLTWFRN    E +++WIDA++
Sbjct  420  LAMEFLMECRQVEGAATEERFFLFLEEFQRHSRNYVKRQLTWFRNKGQSEQMFNWIDATQ  479

Query  464  PMGSVLDF---------------IYDSYHSQSGHLKVP-------------------KSL  387
            P+   +DF               I+     QSG  +V                    K+ 
Sbjct  480  PL---IDFSHVKAVVSKEHRMVAIFSVTSLQSGWAEVMVDALAKEYERPNEVVSDVLKAA  536

Query  386  SVKKEISSRREVAEMKTYRPRNQHFIGR-EDCTPVLNWIQ  270
            SV  + SS +E   +K YR +N+ F    E     L WI+
Sbjct  537  SVVTKESSYKEENLLKRYRTQNRIFTSNSEALKRTLQWIR  576



>ref|XP_001754594.1| predicted protein [Physcomitrella patens]
 gb|EDQ80564.1| predicted protein [Physcomitrella patens]
Length=521

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/210 (39%), Positives = 114/210 (54%), Gaps = 28/210 (13%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E D DYDF C FL   R +LY  ID RCE ML +  G+L EA  LLDLGL+P+S+SASR 
Sbjct  300  EWDYDYDFQCYFLYQHRAELYHWIDLRCEQMLADPRGLLQEASWLLDLGLMPDSSSASRG  359

Query  644  IGYRQ------------------AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKR  519
            IGY++                  AME+L+ CR+ GG ++ +    FLS FQ  SR+  K+
Sbjct  360  IGYQEKFSNMFLEDACCDSSILIAMEFLMECRKAGGMATEKRVLEFLSAFQHVSRSLVKK  419

Query  518  QLTWFRNE-----PLYHWIDASRPMGSVLDFIYDSYHSQSGHLKVPKSL--SVKKEISSR  360
            QLTWFR++       +HWIDAS+    +L+ +   Y    G+   P  L  S  ++ +S 
Sbjct  420  QLTWFRSDQHSDVKQFHWIDASQSTEKILEAMRKEYWRPPGY---PSELRGSDDRKHASY  476

Query  359  REVAEMKTYRPRNQHFIGREDCTPVLNWIQ  270
            +E   +K Y+  N+ F        VL W++
Sbjct  477  KEGKVLKYYKVENRIFTNSAAIANVLKWVK  506



>ref|XP_005643818.1| isopentenyl transferase, partial [Coccomyxa subellipsoidea C-169]
 gb|EIE19274.1| isopentenyl transferase, partial [Coccomyxa subellipsoidea C-169]
Length=316

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = -1

Query  815  LDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGY  636
            LDYDF C FL   RL+LYR ID RCE+M++   G+L EA  LLD GL P+   A+RAIGY
Sbjct  192  LDYDFRCFFLNRPRLELYRRIDARCEEMVVG--GLLQEAAWLLDQGLTPDEKCAARAIGY  249

Query  635  RQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRPMG  456
            RQAME+L+ CR      +  +    + + Q+ASRN   RQL+WFR+EPL+ W++A R   
Sbjct  250  RQAMEFLIRCRADAAHITGDNLVQMVRDIQRASRNLCHRQLSWFRDEPLFRWVEAGREPA  309

Query  455  SVLDFI  438
             ++D I
Sbjct  310  DIVDDI  315



>ref|XP_001763870.1| predicted protein [Physcomitrella patens]
 gb|EDQ71274.1| predicted protein [Physcomitrella patens]
Length=717

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 95/167 (57%), Gaps = 18/167 (11%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E D DYDF C F    R +LY  ID RCE M+    G+L EA  LLDLGL P+S+ +SR 
Sbjct  510  EWDSDYDFQCYFFYQHRKELYHCIDLRCEQMIANPRGLLQEASWLLDLGLTPDSSFSSRG  569

Query  644  IGYR----------QAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNE  495
            IGY+          QAME+L+ CR+ GG S+   F AFLS FQ  SR+  K+QL WFR+ 
Sbjct  570  IGYQETCVMILMANQAMEFLMECRKAGGRSTEERFLAFLSAFQHVSRSLVKKQLAWFRSN  629

Query  494  -----PLYHWIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEI  369
                   +HWIDAS+P   +L+ +   Y  + G+   P  LS   ++
Sbjct  630  KHSDVKQFHWIDASQPTDKILEALRKEYWRRPGY---PSELSGSDDV  673



>dbj|BAG68563.1| isopentenyl transferase, partial [Physcomitrella patens]
Length=303

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E D DYDF C F    R +LY  ID RCE M+    G+L EA  LLDLGL P+S+ +SR 
Sbjct  195  EWDSDYDFQCYFFYQHRKELYHCIDLRCEQMIANPRGLLQEASWLLDLGLTPDSSFSSRG  254

Query  644  IGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRN  498
            IGY++AME+L+ CR+ GG S+   F AFLS FQ  SR+  K+QL WFR+
Sbjct  255  IGYQEAMEFLMECRKAGGRSTEERFLAFLSAFQHVSRSLVKKQLAWFRS  303



>ref|XP_003080095.1| tRNA isopentenyltransferase 9 / IPP transferase 9 (ISS) [Ostreococcus 
tauri]
Length=383

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 87/164 (53%), Gaps = 7/164 (4%)
 Frame = -1

Query  818  DLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIG  639
            D  +DF C FL+  R++LYR ID R E+M+L   G++ EA  LLD G+ P  N A+RAIG
Sbjct  205  DERFDFRCFFLSAPRVELYRKIDERVENMILN--GIMDEAAWLLDAGIAPGGNVAARAIG  262

Query  638  YRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRPM  459
            YRQAMEYL   R +    S       L E Q  +R +AKRQ TWFR E  Y WIDAS   
Sbjct  263  YRQAMEYLAKARAKDIDVSADTLLELLKEIQGLNRAYAKRQFTWFRGESKYLWIDASSSC  322

Query  458  GSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRP  327
              +   +   +     H    +   V KE     E+  +K YRP
Sbjct  323  EDIARRVLTEFECDEHHAGGEQMADVSKE-----ELEVLKRYRP  361



>emb|CEF98535.1| tRNA isopentenyltransferase [Ostreococcus tauri]
Length=409

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 87/164 (53%), Gaps = 7/164 (4%)
 Frame = -1

Query  818  DLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIG  639
            D  +DF C FL+  R++LYR ID R E+M+L   G++ EA  LLD G+ P  N A+RAIG
Sbjct  231  DERFDFRCFFLSAPRVELYRKIDERVENMILN--GIMDEAAWLLDAGIAPGGNVAARAIG  288

Query  638  YRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRPM  459
            YRQAMEYL   R +    S       L E Q  +R +AKRQ TWFR E  Y WIDAS   
Sbjct  289  YRQAMEYLAKARAKDIDVSADTLLELLKEIQGLNRAYAKRQFTWFRGESKYLWIDASSSC  348

Query  458  GSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRP  327
              +   +   +     H    +   V KE     E+  +K YRP
Sbjct  349  EDIARRVLTEFECDEHHAGGEQMADVSKE-----ELEVLKRYRP  387



>ref|XP_001771407.1| predicted protein [Physcomitrella patens]
 gb|EDQ63797.1| predicted protein [Physcomitrella patens]
Length=892

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 102/193 (53%), Gaps = 13/193 (7%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E D DYDF C FL   R DLY  +D RCE M+     +L EA  LL+LG+ P +NSAS+A
Sbjct  278  EDDWDYDFQCYFLYQHRADLYPRVDIRCEQMI---PALLEEAAWLLNLGVRPQTNSASKA  334

Query  644  IGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEP-----LYHW  480
            IGY +AME LL  R+  G  S   F  F++ FQ  S+   ++Q+ WFR         + W
Sbjct  335  IGYEEAMELLLEARQADGVISQERFLKFVALFQHNSKGLVRKQIAWFRTHSRSEVRKFRW  394

Query  479  IDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSR--REVAEMKTYRPRNQHFIG  306
            + A  P+  +++ + + Y    G    P  ++  +E+ +R  +E   MK+Y+P  + +  
Sbjct  395  LQAGGPVEEMMEALVEEYARAPGQ---PTLIASGEELKTRSMKEQKRMKSYKPTLKIYSD  451

Query  305  REDCTPVLNWIQS  267
                   L WI+S
Sbjct  452  AAAVAGCLAWIKS  464



>ref|XP_002500269.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61527.1| predicted protein, partial [Micromonas sp. RCC299]
Length=306

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 76/119 (64%), Gaps = 6/119 (5%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YDF CV LT+ R++LYR +D R E M+ +  G+L EA  +L  G+ P S  A+R+IGYRQ
Sbjct  190  YDFRCVVLTSPRIELYRRVDARVEAMVRD--GMLEEAAMMLGRGIAPGSTPAARSIGYRQ  247

Query  629  AMEYL--LYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRN--EPLYHWIDASR  465
            AM+++     R   G   P +   F+ E Q+A+R FAKRQ TWFR   E LY W+DAS+
Sbjct  248  AMDFVERRAARAGDGPCRPEELLEFVEEAQRATRAFAKRQFTWFRGEREGLYTWLDASK  306



>ref|WP_042103588.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Parachlamydiaceae 
bacterium HS-T3]
Length=330

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 78/120 (65%), Gaps = 9/120 (8%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            +++ K L+YDF C F+   +  LY+ I+ RC+ ML    G+L E   L+  GLL NS SA
Sbjct  199  KNRRKPLNYDFRCWFVNRPKEQLYKRIEKRCDKML--EAGLLGEVEELIREGLLCNS-SA  255

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            S+AIGYRQA+EYL          +P  +  F+  F++ASR++AKRQLTWFR EPL+ W+D
Sbjct  256  SQAIGYRQALEYL------ASEKTPEAYVKFVENFKQASRHYAKRQLTWFRKEPLFRWVD  309



>ref|XP_005539056.1| tRNA isopentenyltransferase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM83020.1| tRNA isopentenyltransferase [Cyanidioschyzon merolae strain 10D]
Length=500

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 96/181 (53%), Gaps = 21/181 (12%)
 Frame = -1

Query  830  SKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDM-----LLENYGVLSEARGLLDLGLLPN  666
            +K  DLD DF C FL+  R++L R ID RCEDM     LLE  G+L      ++ G  P 
Sbjct  289  TKAPDLDVDFRCYFLSLPRVELNRRIDARCEDMVWRGLLLETAGLLRGPWAAIETGTGPE  348

Query  665  SN---------SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQL  513
            +          SA RAIGYRQA+EYL     Q G  +P    AFL++F +ASR +A+RQ+
Sbjct  349  AGLDAETSKALSAFRAIGYRQAIEYL-----QHGERTPAGLRAFLAKFMQASRQYARRQI  403

Query  512  TWFRNEPLYHWIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTY  333
             WFR+E L+ W  A +P   ++D I +     S       +   +  + S RE  +MK Y
Sbjct  404  QWFRSETLFRWRAADQP--DLVDRIENELQRVSPVDAHDDAEDARLRMESHREAKQMKRY  461

Query  332  R  330
            +
Sbjct  462  Q  462



>ref|XP_007513069.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bathycoccus 
prasinos]
 emb|CCO16627.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bathycoccus 
prasinos]
Length=490

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 82/141 (58%), Gaps = 9/141 (6%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            KD    F C  L+  R+DLYR +D R E+M+    G+L EA  LL  G+ PN+NSASRAI
Sbjct  290  KDESKQFHCYALSMNRVDLYRRMDQRVEEMVAN--GILDEAAYLLREGVKPNTNSASRAI  347

Query  641  GYRQAMEYLLYCREQGGSSSPRD-------FFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            GY QA++YLL C+ +  ++S             F+ E Q+ +R +AKRQ TW R+E  + 
Sbjct  348  GYAQAIDYLLKCKREKENNSESSINNDATLLLEFIDELQRETRMYAKRQFTWLRSEKQFQ  407

Query  482  WIDASRPMGSVLDFIYDSYHS  420
            WIDAS         I++ +++
Sbjct  408  WIDASEGAEIASSRIFEKFNN  428



>gb|KIY99342.1| tRNA dimethylallyltransferase [Monoraphidium neglectum]
Length=573

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 2/129 (2%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            EK+LDYDF C FL   R  LY  I +R E+M+    G+L EAR L+ LG+   S +A+RA
Sbjct  340  EKELDYDFRCFFLHRPRRQLYDKIAYRVEEMVA--GGLLREARWLMSLGVTAGSCNAARA  397

Query  644  IGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASR  465
            IGYRQA+E++   ++QGG+++       + +   A+R   K Q TWFR++  + W+D S 
Sbjct  398  IGYRQALEFMQEAQQQGGAATQEQLSQMIMKIGAATRKLVKNQHTWFRDDGAFLWVDNSA  457

Query  464  PMGSVLDFI  438
            P   VL  I
Sbjct  458  PEEDVLRLI  466



>ref|WP_042239754.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neochlamydia 
sp. S13]
Length=330

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 77/120 (64%), Gaps = 9/120 (8%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K  +YDF C FL   R  LY  I+ RC+ M+ +  G+L E +GLL  GLL NS SA
Sbjct  200  KGRHKLQNYDFRCWFLFRPRPHLYHRIENRCDQMIED--GLLEEVQGLLKKGLLANS-SA  256

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            ++AIGY+QA+ YL        +  P D+  F+  F++ASRN+AKRQ TWF  EPL++WID
Sbjct  257  AQAIGYKQAIAYL------ATAKRPDDYLQFVETFKRASRNYAKRQHTWFGKEPLFNWID  310



>ref|WP_039384140.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Neochlamydia 
sp. TUME1]
Length=344

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 9/120 (8%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K  +YDF C FL   R  LY  I+ RC+ M+    G+L E +GLL  GLL NS SA
Sbjct  214  KGRHKLQNYDFRCWFLFRPRPHLYHRIENRCDQMI--EGGLLEEVQGLLKKGLLANS-SA  270

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            ++AIGY+QA+ YL        +  P D+  F+  F++ASRN+AKRQ TWF  EPL++WID
Sbjct  271  AQAIGYKQAIAYL------ASAKRPDDYLQFVETFKRASRNYAKRQHTWFGKEPLFNWID  324



>gb|KIC76632.1| tRNA dimethylallyltransferase [Neochlamydia sp. TUME1]
Length=343

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 9/120 (8%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K  +YDF C FL   R  LY  I+ RC+ M+    G+L E +GLL  GLL NS SA
Sbjct  213  KGRHKLQNYDFRCWFLFRPRPHLYHRIENRCDQMI--EGGLLEEVQGLLKKGLLANS-SA  269

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            ++AIGY+QA+ YL        +  P D+  F+  F++ASRN+AKRQ TWF  EPL++WID
Sbjct  270  AQAIGYKQAIAYL------ASAKRPDDYLQFVETFKRASRNYAKRQHTWFGKEPLFNWID  323



>ref|XP_005702562.1| tRNA dimethylallyltransferase isoform 1 [Galdieria sulphuraria]
 gb|EME26042.1| tRNA dimethylallyltransferase isoform 1 [Galdieria sulphuraria]
Length=400

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 95/178 (53%), Gaps = 12/178 (7%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ     DLDYDF C FL   R +L R ID RCE M+ ++ G+L E   LL    L   +
Sbjct  200  LQGIPVTDLDYDFRCFFLVAPRKELNRFIDRRCERMIAQD-GLLKEVFELLYKRELSKDS  258

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA +AIGYRQ +EYL        +++   F  +L +FQ ASR +A+RQL WFR E L+HW
Sbjct  259  SAGKAIGYRQTIEYLT----NHETNALDQFMKYLRDFQNASRQYARRQLQWFRGEELFHW  314

Query  479  IDA---SRPMGSV--LDFIYDSYHSQSGHLKVPKSLSVKKEIS--SRREVAEMKTYRP  327
            +     S  +  V  +++I   + + S   K      +  E+   S ++  EMKTY P
Sbjct  315  VPVEMFSNDISHVAPIEYIMHWFAATSEEYKESTRQRIDAEVREISLKQGKEMKTYTP  372



>gb|KIC73229.1| tRNA dimethylallyltransferase [Neochlamydia sp. EPS4]
Length=364

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 75/120 (63%), Gaps = 9/120 (8%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K  +YDF C FL   R  LY  I+ RCE M+    G+L E + LL  GLL NS SA
Sbjct  234  KGRHKLQNYDFRCWFLFRPRPHLYHRIENRCEQMI--EGGLLEEVQDLLKKGLLANS-SA  290

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            ++AIGY+QA+ YL        +  P D+  F+  F++ASRN+AKRQ TWF  EPL++WID
Sbjct  291  AQAIGYKQAIAYL------ATAKRPEDYLQFVETFKRASRNYAKRQHTWFGKEPLFNWID  344



>ref|XP_001418572.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96865.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=348

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            +DF C FL++ R++LYR ID R E M ++  G++ EA  LL+ G+ P  N  +R+IGYRQ
Sbjct  205  FDFRCFFLSSPRVELYRKIDARVEGMFVD--GIMDEAAWLLNAGIAPGENVPARSIGYRQ  262

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            AMEYL   R +            ++E Q  +R +AKRQ TWFR E  Y WI+
Sbjct  263  AMEYLAKARAKEIKVDDASLLELVNEIQMLNRAYAKRQFTWFRGESRYAWIN  314



>ref|XP_005708068.1| tRNA dimethylallyltransferase isoform 2 [Galdieria sulphuraria]
 gb|EME31548.1| tRNA dimethylallyltransferase isoform 2 [Galdieria sulphuraria]
Length=453

 Score =   103 bits (258),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 95/178 (53%), Gaps = 12/178 (7%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ     DLDYDF C FL   R +L R ID RCE M+ ++ G+L E   LL    L   +
Sbjct  253  LQGIPVTDLDYDFRCFFLVAPRKELNRFIDRRCERMIAQD-GLLKEVFELLYKRELSKDS  311

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA +AIGYRQ +EYL        +++   F  +L +FQ ASR +A+RQL WFR E L+HW
Sbjct  312  SAGKAIGYRQTIEYLT----NHETNALDQFMKYLRDFQNASRQYARRQLQWFRGEELFHW  367

Query  479  IDA---SRPMGSV--LDFIYDSYHSQSGHLKVPKSLSVKKEIS--SRREVAEMKTYRP  327
            +     S  +  V  +++I   + + S   K      +  E+   S ++  EMKTY P
Sbjct  368  VPVEMFSNDISHVAPIEYIMHWFAATSEEYKESTRQRIDAEVREISLKQGKEMKTYTP  425



>ref|XP_007021670.1| Isopentenyltransferase 9 isoform 2 [Theobroma cacao]
 gb|EOY13195.1| Isopentenyltransferase 9 isoform 2 [Theobroma cacao]
Length=336

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            +Q   KDLDY+F+C FL++ RLDLYR ID RCE ML E  G+LSEAR LLD+GL PNSNS
Sbjct  257  EQDTVKDLDYEFICFFLSSPRLDLYRLIDLRCEHMLSETDGILSEARWLLDMGLQPNSNS  316

Query  656  ASRAIGYRQA  627
            A+RAIGYRQ 
Sbjct  317  ATRAIGYRQV  326



>ref|XP_003061927.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH53639.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=324

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 72/122 (59%), Gaps = 10/122 (8%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            +DF CV L   R+ LYR ID R E M+ +  G+L EA  ++  G+ P S SA+ AIGYRQ
Sbjct  188  FDFRCVLLDAPRVQLYRRIDDRVECMVCD--GMLDEAAMMMRRGIAPGSTSAASAIGYRQ  245

Query  629  AMEYLLYCREQGGS------SSPRDFFAFLSEFQKASRNFAKRQLTWFRNEP--LYHWID  474
            AME+L               ++  D  AF+ + Q+A+R FAKRQLTWFR EP   Y WI 
Sbjct  246  AMEFLAARAAAAAGGGGGGATTEEDLLAFVEKTQRATRAFAKRQLTWFRGEPEGRYRWIS  305

Query  473  AS  468
            AS
Sbjct  306  AS  307



>ref|XP_002949722.1| hypothetical protein VOLCADRAFT_90025 [Volvox carteri f. nagariensis]
 gb|EFJ49274.1| hypothetical protein VOLCADRAFT_90025 [Volvox carteri f. nagariensis]
Length=610

 Score =   102 bits (255),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 71/117 (61%), Gaps = 1/117 (1%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            +++LD DF C FL   RL LY  I  R E M++E  G+L EA  LL +GL P +N A++A
Sbjct  381  DRELDLDFRCFFLHRPRLQLYDRIASRVEAMVVEG-GLLEEAAMLLRMGLAPGANMAAKA  439

Query  644  IGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            IGYRQAME+L+  +         D  A  +   +A+    + Q+TWFR++P+Y WID
Sbjct  440  IGYRQAMEWLMAAKAADRPVGLPDLCALHAAICQATHKLVRAQMTWFRDDPMYKWID  496



>ref|XP_005702563.1| tRNA dimethylallyltransferase isoform 2 [Galdieria sulphuraria]
 gb|EME26043.1| tRNA dimethylallyltransferase isoform 2 [Galdieria sulphuraria]
Length=369

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ     DLDYDF C FL   R +L R ID RCE M+ ++ G+L E   LL    L   +
Sbjct  200  LQGIPVTDLDYDFRCFFLVAPRKELNRFIDRRCERMIAQD-GLLKEVFELLYKRELSKDS  258

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA +AIGYRQ +EYL        +++   F  +L +FQ ASR +A+RQL WFR E L+HW
Sbjct  259  SAGKAIGYRQTIEYLT----NHETNALDQFMKYLRDFQNASRQYARRQLQWFRGEELFHW  314

Query  479  I  477
            +
Sbjct  315  V  315



>ref|XP_005708069.1| tRNA dimethylallyltransferase isoform 1 [Galdieria sulphuraria]
 gb|EME31549.1| tRNA dimethylallyltransferase isoform 1 [Galdieria sulphuraria]
Length=422

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 72/121 (60%), Gaps = 5/121 (4%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ     DLDYDF C FL   R +L R ID RCE M+ ++ G+L E   LL    L   +
Sbjct  253  LQGIPVTDLDYDFRCFFLVAPRKELNRFIDRRCERMIAQD-GLLKEVFELLYKRELSKDS  311

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            SA +AIGYRQ +EYL        +++   F  +L +FQ ASR +A+RQL WFR E L+HW
Sbjct  312  SAGKAIGYRQTIEYL----TNHETNALDQFMKYLRDFQNASRQYARRQLQWFRGEELFHW  367

Query  479  I  477
            +
Sbjct  368  V  368



>gb|EKE08074.1| tRNA delta(2)-isopentenylpyrophosphate transferase, partial [uncultured 
bacterium]
Length=219

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 74/116 (64%), Gaps = 9/116 (8%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            K+ DYDF C FL   +  LY  I+ RC++ML    G+LSE R L   GL  N  +AS++I
Sbjct  92   KEQDYDFRCWFLYYPKEKLYARIEKRCDEML--EKGLLSEVRELEKKGLRDNP-TASQSI  148

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            GYRQA++YL        + +  DF  F+  F+KASR+++KRQ TWFR EPL+ W++
Sbjct  149  GYRQALDYL------ASAQTEEDFERFVFTFKKASRHYSKRQFTWFRKEPLFRWLN  198



>gb|KDD75968.1| IPP transferase [Helicosporidium sp. ATCC 50920]
Length=423

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 2/113 (2%)
 Frame = -1

Query  815  LDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGY  636
            LD D  C FL   R+DLYR ID R E ML    G+L E   +L +G+ P++NSA+RAIGY
Sbjct  216  LDADSRCFFLARPRIDLYRRIDSRVEGML--AGGLLEETVSMLCMGVAPDANSAARAIGY  273

Query  635  RQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            RQ ME LL    +   ++ +D        Q ASR F+ RQ+TWFR++  + W+
Sbjct  274  RQTMEALLTLAGRETLATLQDLMNLAQAIQSASRRFSHRQMTWFRSQQGFAWL  326



>ref|WP_032125950.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Chlamydia 
sp. 'Diamant']
Length=344

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 78/137 (57%), Gaps = 10/137 (7%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K  +YDF C FL   +  LY  ID RC+ ML E  G L E R L DL  +  ++SA
Sbjct  214  KGRRKPQNYDFRCWFLHRPKEKLYERIDRRCDKMLDE--GFLEEVRRL-DLEGIRQNSSA  270

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            S+AIGYRQA++YLL         S   +  F+  F++A+R++AKRQ TWFR EPL+ W+D
Sbjct  271  SQAIGYRQALDYLL------TEQSAAHYDQFVKSFKQATRHYAKRQFTWFRKEPLFRWLD  324

Query  473  AS-RPMGSVLDFIYDSY  426
                    V D I   Y
Sbjct  325  VDMHDPEVVFDMIMKDY  341



>emb|CCB92254.1| trNA dimethylallyltransferase [Waddlia chondrophila 2032/99]
Length=254

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 74/113 (65%), Gaps = 9/113 (8%)
 Frame = -1

Query  812  DYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            ++DF C FL   +  LY+ I+ RCE M+    G+L E + L + GLL N+ SAS+AIGYR
Sbjct  131  NFDFRCWFLYRPKSLLYKRIEERCEQMVAS--GLLEEVKRLKEEGLLENT-SASQAIGYR  187

Query  632  QAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            QA++YL    E   SS+  D   F+  F++ASR +AKRQ TWFR EPL+ W+D
Sbjct  188  QALDYL----ETEQSSA--DHCKFMESFKQASRKYAKRQFTWFRREPLFRWLD  234



>ref|WP_041018636.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Criblamydia 
sequanensis]
Length=332

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 72/113 (64%), Gaps = 9/113 (8%)
 Frame = -1

Query  812  DYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            +YDF C FL   R  LYR ID RCE M+ +  G + E + LLD GL  NS SA ++IGYR
Sbjct  209  NYDFRCWFLFKPREHLYRVIDKRCERMIED--GFIDEVKALLDEGLKENS-SALQSIGYR  265

Query  632  QAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            Q +++         S +  D+  F+ +F++A+R++AKRQLTWFR EP + W+D
Sbjct  266  QVLDFF------ETSQTKEDYQKFIEKFKQATRSYAKRQLTWFRKEPDFRWLD  312



>gb|ADI38731.1| tRNA delta-2-isopentenylpyrophosphate transferase [Waddlia chondrophila 
WSU 86-1044]
Length=345

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 74/113 (65%), Gaps = 9/113 (8%)
 Frame = -1

Query  812  DYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            ++DF C FL   +  LY+ I+ RCE M+    G+L E + L + GLL N+ SAS+AIGYR
Sbjct  222  NFDFRCWFLYRPKSLLYKRIEERCEQMVAS--GLLEEVKRLKEEGLLENT-SASQAIGYR  278

Query  632  QAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            QA++YL    E   SS+  D   F+  F++ASR +AKRQ TWFR EPL+ W+D
Sbjct  279  QALDYL----ETEQSSA--DHCKFMESFKQASRKYAKRQFTWFRREPLFRWLD  325



>ref|WP_041941869.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Waddlia chondrophila]
Length=333

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 74/113 (65%), Gaps = 9/113 (8%)
 Frame = -1

Query  812  DYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            ++DF C FL   +  LY+ I+ RCE M+    G+L E + L + GLL N+ SAS+AIGYR
Sbjct  210  NFDFRCWFLYRPKSLLYKRIEERCEQMVAS--GLLEEVKRLKEEGLLENT-SASQAIGYR  266

Query  632  QAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            QA++YL    E   SS+  D   F+  F++ASR +AKRQ TWFR EPL+ W+D
Sbjct  267  QALDYL----ETEQSSA--DHCKFMESFKQASRKYAKRQFTWFRREPLFRWLD  313



>emb|CDR35057.1| tRNA dimethylallyltransferase [Criblamydia sequanensis CRIB-18]
Length=348

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 72/113 (64%), Gaps = 9/113 (8%)
 Frame = -1

Query  812  DYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            +YDF C FL   R  LYR ID RCE M+ +  G + E + LLD GL  NS SA ++IGYR
Sbjct  225  NYDFRCWFLFKPREHLYRVIDKRCERMIED--GFIDEVKALLDEGLKENS-SALQSIGYR  281

Query  632  QAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            Q +++         S +  D+  F+ +F++A+R++AKRQLTWFR EP + W+D
Sbjct  282  QVLDFF------ETSQTKEDYQKFIEKFKQATRSYAKRQLTWFRKEPDFRWLD  328



>ref|WP_006340845.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Parachlamydia 
acanthamoebae]
 gb|EFB41821.1| hypothetical protein pah_c022o115 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86292.1| tRNA dimethylaLLyltransferase [Parachlamydia acanthamoebae UV-7]
Length=365

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 72/120 (60%), Gaps = 9/120 (8%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K  +YDF C FL   +  LYR ID RCE M+    G+L E   L   GLL N  SA
Sbjct  234  KGRRKPRNYDFRCWFLYRPKEHLYRRIDHRCEKMV--EAGLLEEVEKLEKEGLLQNP-SA  290

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            ++AIGYRQA+EY           +  DF  F+ +F+K+SR +AKRQ TWFR EPL+ W+D
Sbjct  291  AQAIGYRQALEYF------KTPKTKEDFQKFMDDFKKSSRRYAKRQFTWFRQEPLFQWLD  344



>gb|KIC71336.1| tRNA dimethylallyltransferase [Candidatus Protochlamydia amoebophila]
Length=359

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 78/138 (57%), Gaps = 10/138 (7%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K  +YDF C FL   +  LY  ID RC+ ML E  G + E R L  LG+  NS SA
Sbjct  229  KGRRKPQNYDFRCWFLHRPKEKLYERIDKRCDKMLEE--GFMDEVRRLDSLGIRGNS-SA  285

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            S+AIGYRQA+ +L    EQ  S     +  F+  F++A+R++AKRQ TWFR EPL+ W+D
Sbjct  286  SQAIGYRQALNFLK--TEQTASQ----YQEFIRSFKQATRHYAKRQFTWFRKEPLFRWLD  339

Query  473  AS-RPMGSVLDFIYDSYH  423
                    V D I   Y 
Sbjct  340  VDMHDPEVVFDMIMKDYE  357



>ref|WP_011175793.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus 
Protochlamydia amoebophila]
 sp|Q6MBT2.1|MIAA_PARUW RecName: Full=tRNA dimethylallyltransferase; AltName: Full=Dimethylallyl 
diphosphate:tRNA dimethylallyltransferase; Short=DMAPP:tRNA 
dimethylallyltransferase; Short=DMATase; AltName: 
Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase; 
Short=IPP transferase; Short=IPPT; Short=IPTase [Candidatus 
Protochlamydia amoebophila UWE25]
 emb|CAF23967.1| putative tRNA delta-2-isopentenylpyrophosphate transferase [Candidatus 
Protochlamydia amoebophila UWE25]
Length=344

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 78/137 (57%), Gaps = 10/137 (7%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K  +YDF C FL   +  LY  ID RC+ ML E  G + E R L  LG+  NS SA
Sbjct  214  KGRRKPQNYDFRCWFLHRPKEKLYERIDKRCDKMLEE--GFMDEVRHLDSLGIRGNS-SA  270

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            S+AIGYRQA+ +L    EQ  S     +  F+  F++A+R++AKRQ TWFR EPL+ W+D
Sbjct  271  SQAIGYRQALNFLK--TEQTASQ----YQEFIRSFKQATRHYAKRQFTWFRKEPLFRWLD  324

Query  473  AS-RPMGSVLDFIYDSY  426
                    V D I   Y
Sbjct  325  VDMHDPEVVFDMILKDY  341



>ref|WP_039359474.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus 
Protochlamydia amoebophila]
Length=344

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 78/138 (57%), Gaps = 10/138 (7%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K  +YDF C FL   +  LY  ID RC+ ML E  G + E R L  LG+  NS SA
Sbjct  214  KGRRKPQNYDFRCWFLHRPKEKLYERIDKRCDKMLEE--GFMDEVRRLDSLGIRGNS-SA  270

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            S+AIGYRQA+ +L    EQ  S     +  F+  F++A+R++AKRQ TWFR EPL+ W+D
Sbjct  271  SQAIGYRQALNFLK--TEQTASQ----YQEFIRSFKQATRHYAKRQFTWFRKEPLFRWLD  324

Query  473  AS-RPMGSVLDFIYDSYH  423
                    V D I   Y 
Sbjct  325  VDMHDPEVVFDMIMKDYE  342



>ref|WP_042282692.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Candidatus 
Protochlamydia sp. R18]
Length=330

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 78/137 (57%), Gaps = 10/137 (7%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K  +YDF C FL   +  LY  ID RC+ ML E  G + E R L  LG+  NS SA
Sbjct  200  KGRRKPQNYDFRCWFLHRPKEKLYERIDKRCDKMLEE--GFMDEVRRLDSLGIRGNS-SA  256

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            S+AIGYRQA+ +L    EQ  S     +  F+  F++A+R++AKRQ TWFR EPL+ W+D
Sbjct  257  SQAIGYRQALNFLK--TEQTASQ----YQEFIRSFKQATRHYAKRQFTWFRKEPLFRWLD  310

Query  473  AS-RPMGSVLDFIYDSY  426
                    V D I   Y
Sbjct  311  VDMHDPEVVFDMIMKDY  327



>gb|KIA77950.1| tRNA dimethylallyltransferase [Parachlamydia acanthamoebae]
Length=371

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 72/120 (60%), Gaps = 9/120 (8%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K  +YDF C FL   +  LYR ID RCE M+    G+L E   L   GLL N  SA
Sbjct  240  KGRRKPRNYDFRCWFLYRPKEHLYRRIDHRCEKMV--EAGLLEEVEKLEKEGLLQNP-SA  296

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            ++AIGYRQA+EY           +  DF  F+ +F+K+SR +AKRQ TWFR EPL+ W+D
Sbjct  297  AQAIGYRQALEYF------KTPKTKEDFQKFMDDFKKSSRRYAKRQFTWFRQEPLFQWLD  350



>ref|XP_005843467.1| hypothetical protein CHLNCDRAFT_55198 [Chlorella variabilis]
 gb|EFN51365.1| hypothetical protein CHLNCDRAFT_55198 [Chlorella variabilis]
Length=490

 Score = 95.9 bits (237),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 93/174 (53%), Gaps = 14/174 (8%)
 Frame = -1

Query  824  EKDLD------YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            ++DLD      YD  C FL   RL+LYR ID R E+M+    G+L E + LL+ G+ P+S
Sbjct  250  DQDLDAGTPTHYDCRCFFLHRPRLELYRRIDGRVEEMV--AAGLLQECQLLLEAGVAPSS  307

Query  662  NSASRAIGYRQAMEYLLYCREQG-GSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLY  486
            N ASRAIGYRQA+++L  C +     ++       +   Q ASR    RQ++WFR+E ++
Sbjct  308  NCASRAIGYRQALDFLRRCHDDPQAHATEAGVIQLVKAIQTASRQLCHRQMSWFRDEGMF  367

Query  485  HWIDASRPMGSVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPR  324
             W+DA+    +VL  + + +H             + KE     +  EMK Y P+
Sbjct  368  RWVDATAGEEAVLAEVLERWHQPQHEGGCGDGGRLTKE-----QAEEMKRYVPK  416



>ref|XP_011398588.1| tRNA dimethylallyltransferase [Auxenochlorella protothecoides]
 gb|KFM25692.1| tRNA dimethylallyltransferase [Auxenochlorella protothecoides]
Length=361

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 83/156 (53%), Gaps = 8/156 (5%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q  +E+   + F   FL   RLDLYR ID R + M+  + G++ EA  LL  G  PN+  
Sbjct  188  QAGQERRRAFAFHPFFLVRPRLDLYRRIDSRVDHMV--SSGLIGEAAHLLACGAAPNTTC  245

Query  656  ASRAIGYRQAMEYLLYCREQ--GGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
            A+RAIGYRQA+  L   R++    +  P    + + + Q A+R    RQ+TWFRN P + 
Sbjct  246  ATRAIGYRQALLALERLRKEEIKDAELPGILLSLVVDIQSATRKLCHRQMTWFRNRPEFR  305

Query  482  WIDASRP----MGSVLDFIYDSYHSQSGHLKVPKSL  387
            W+DA++     +  + D +     + +G+   PK L
Sbjct  306  WLDATQDTDLLLRQICDHVQGDPSAATGYGSDPKRL  341



>emb|CDZ80405.1| tRNA dimethylallyltransferase [Chlamydia sp. 'Rubis']
Length=349

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 12/123 (10%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            +SK+K  +YDF C +L   R +LY+ I+ RC+ M+ E  G+L E   L   GL  N+ SA
Sbjct  215  KSKKKMQNYDFRCWYLYRPRENLYKRIEERCDLMISE--GLLEEVINLEKNGLKENT-SA  271

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRN---EPLYH  483
            S+AIGY+QA+EYL   R      +  DF  F+ +F++ASR +AKRQ +WF     +P+++
Sbjct  272  SQAIGYKQALEYLRTER------TSEDFNQFVQKFKQASRQYAKRQESWFSKYSQKPVFN  325

Query  482  WID  474
            W+D
Sbjct  326  WVD  328



>ref|WP_041419427.1| tRNA delta(2)-isopentenylpyrophosphate transferase, partial [Simkania 
negevensis]
Length=310

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 77/133 (58%), Gaps = 11/133 (8%)
 Frame = -1

Query  812  DYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            ++DF C FL      LY  I+ RC++M+ +  G + E  GL +L  L ++ +A++AIGYR
Sbjct  187  EFDFRCWFLYFPTEILYPRIEMRCDEMIAQ--GFIEEVEGLQEL--LRHNITAAQAIGYR  242

Query  632  QAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS-RPMG  456
            Q + +L   R      +  D+  F+ EF+KASR +AKRQ TWFR EPL+ W+D       
Sbjct  243  QCLNFLETER------TDSDWERFVWEFKKASRRYAKRQFTWFRKEPLFRWVDIDIHGYQ  296

Query  455  SVLDFIYDSYHSQ  417
             VL+ I   Y S+
Sbjct  297  KVLELILQDYESR  309



>emb|CCB89591.1| tRNA dimethylallyltransferase [Simkania negevensis Z]
Length=336

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 77/133 (58%), Gaps = 11/133 (8%)
 Frame = -1

Query  812  DYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            ++DF C FL      LY  I+ RC++M+ +  G + E  GL +L  L ++ +A++AIGYR
Sbjct  213  EFDFRCWFLYFPTEILYPRIEMRCDEMIAQ--GFIEEVEGLQEL--LRHNITAAQAIGYR  268

Query  632  QAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS-RPMG  456
            Q + +L   R      +  D+  F+ EF+KASR +AKRQ TWFR EPL+ W+D       
Sbjct  269  QCLNFLETER------TDSDWERFVWEFKKASRRYAKRQFTWFRKEPLFRWVDIDIHGYQ  322

Query  455  SVLDFIYDSYHSQ  417
             VL+ I   Y S+
Sbjct  323  KVLELILQDYESR  335



>gb|EWM22660.1| trna dimethylallyltransferase 9 [Nannochloropsis gaditana]
Length=491

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 81/158 (51%), Gaps = 9/158 (6%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YDF C FL   R +L R ID RC  M+    G+L E   LL  G L  S+   RAIGYRQ
Sbjct  287  YDFRCFFLIAAREELCRLIDRRCLQMV--EGGLLEETAHLLAAGTLNPSSPPGRAIGYRQ  344

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS-RPMGS  453
             +EYL     +G  +       FL +F  A+R +AK+Q+ WFR +  + W+  + + +G 
Sbjct  345  TIEYLSKEGIEGEMAEATALQEFLEDFATATRRYAKQQMVWFRAQAEFMWLRWNLQDLGP  404

Query  452  VLDFIYDSY-HSQSGHL-----KVPKSLSVKKEISSRR  357
            VLD +  S    +  HL     K  K+L V+  +  +R
Sbjct  405  VLDAVRASVAEDEVSHLARQEGKGQKALRVENIMEGKR  442



>ref|XP_001771357.1| predicted protein [Physcomitrella patens]
 gb|EDQ63747.1| predicted protein [Physcomitrella patens]
Length=923

 Score = 84.7 bits (208),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 59/97 (61%), Gaps = 5/97 (5%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E D DYDF C FL   R DLY  +D RCE M+     +L EA  LL+LG+ P +NSAS+A
Sbjct  449  EDDWDYDFQCYFLYQHRADLYPRVDIRCEQMI---PALLEEAAWLLNLGVRPQTNSASKA  505

Query  644  IGYRQAMEYLLYCREQGGSSSPRD--FFAFLSEFQKA  540
            IGY +AME LL  R+  G+  P +    A + E+ +A
Sbjct  506  IGYEEAMELLLEARQADGAGGPVEEMMEALVEEYARA  542



>emb|CDP18385.1| unnamed protein product [Coffea canephora]
Length=86

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  452  VLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGREDCTPVLNWI  273
            VL  I+DSYH ++G+L+VP SL++ K++S+R+E +++K YR +N+ FI REDC+ +L+WI
Sbjct  15   VLKLIHDSYHDETGNLEVPDSLAMHKDVSNRKEASQLKAYRTKNRQFIQREDCSHILDWI  74

Query  272  Q  270
            +
Sbjct  75   R  75



>ref|XP_009033241.1| hypothetical protein AURANDRAFT_61466 [Aureococcus anophagefferens]
 gb|EGB12160.1| hypothetical protein AURANDRAFT_61466 [Aureococcus anophagefferens]
Length=1597

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 45/112 (40%), Positives = 65/112 (58%), Gaps = 9/112 (8%)
 Frame = -1

Query  809  YDFLCVFLTT-QRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            YD  C FL    R  L+  ID RC+ ML    G+L E   L   G LP +++A+RAIGYR
Sbjct  214  YDVRCAFLAPGDRAALFHGIDARCDAMLAR--GLLGEVAALRAAGRLPETSTAARAIGYR  271

Query  632  QAMEYLLYCREQGG-----SSSPRDFFA-FLSEFQKASRNFAKRQLTWFRNE  495
            QA++YL+  R+  G     + + RD +  F  +F+ ASRN+A  Q+ W+R +
Sbjct  272  QALDYLVGRRDDAGDGALDAGARRDAYVDFCRKFRTASRNYAAEQMKWYRRD  323



>ref|XP_002289575.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED93112.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=548

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLT-TQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPN  666
            G++     D+ YD  C FL  T R+  + ++D RCE+MLL   G+L E   L     LP+
Sbjct  325  GIRSGSLPDMGYDVRCFFLCPTDRMGHFHTVDQRCEEMLLR--GLLRETAELYVNNSLPD  382

Query  665  SNSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLY  486
             +  +RAIGYRQ++ YL   R+         F  F+ +F  A+R +AK+Q+ WFR +  +
Sbjct  383  ESQVARAIGYRQSLAYLK--RDDAKMDDHNTFADFVDDFATATRQYAKKQMQWFRKDGDF  440

Query  485  HWI  477
             ++
Sbjct  441  FFV  443



>ref|WP_039232526.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
thermotolerans]
 gb|KIA69812.1| tRNA dimethylallyltransferase [Bacillus thermotolerans]
 gb|KIG07152.1| tRNA dimethylallyltransferase [Bacillaceae bacterium MTCC 8252]
 gb|KIG09216.1| tRNA dimethylallyltransferase [Bacillaceae bacterium MTCC 10057]
Length=316

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 74/123 (60%), Gaps = 13/123 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            QQ++E +L YD + + LT +R  LY+ I+ R  D++++N G+L E  GL + G+   S  
Sbjct  181  QQTEEPELLYDAVLIGLTMEREQLYQRINKRV-DIMMQN-GLLEEVTGLWEKGI--RSGQ  236

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A +AIGY++   YL       G +S  +    + + ++ SRN+AKRQLTWFRN+   +W 
Sbjct  237  AVQAIGYKEIFSYL------KGEASLEEA---VEQLKQNSRNYAKRQLTWFRNKMPVNWF  287

Query  476  DAS  468
            D S
Sbjct  288  DLS  290



>ref|XP_005831647.1| hypothetical protein GUITHDRAFT_139595 [Guillardia theta CCMP2712]
 gb|EKX44667.1| hypothetical protein GUITHDRAFT_139595 [Guillardia theta CCMP2712]
Length=398

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 63/119 (53%), Gaps = 17/119 (14%)
 Frame = -1

Query  812  DYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYR  633
            D DF C FL   RL+++R ID RCE ML    G L E   L+  G L         +G  
Sbjct  212  DLDFRCFFLYRSRLEIFRDIDLRCELML--QSGFLEEVSSLVASGKL--------RMGTG  261

Query  632  QAMEYLLYCREQGGSSSPRDF----FAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
             A+E      E GG +  +D      AF+ +FQ  SR F +RQLTWFR++P++ W+ A+
Sbjct  262  PAVENE---DEDGGGADRKDLDRELEAFIKDFQSVSRQFVRRQLTWFRSDPVFRWVQAA  317



>ref|WP_026867636.1| hypothetical protein [Jeotgalicoccus marinus]
Length=302

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 69/126 (55%), Gaps = 17/126 (13%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YD   + LTTQR  +Y  I+ R E M L   G+ +E RGL D G+   S +AS+AIGY+ 
Sbjct  182  YDTFIIGLTTQRSVIYDRINLRVEKMFLA--GLENEVRGLYDKGM---SKTASQAIGYK-  235

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRPMGSV  450
              E+L Y + +   S        +   Q  SR +AKRQLT+FRN+   HW D ++   + 
Sbjct  236  --EFLPYFKGEASISE------VMERVQAHSRQYAKRQLTYFRNQLEIHWYDIAQ---TN  284

Query  449  LDFIYD  432
             D IY+
Sbjct  285  TDIIYN  290



>ref|WP_019138303.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Peptoniphilus 
timonensis]
Length=303

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 66/118 (56%), Gaps = 12/118 (10%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            +E++ DY+ + + L   R  LY  I+ R E M+  N G++ E +GLL  G+  NS S  +
Sbjct  178  REENKDYNLVYIGLNMDRKRLYDKINNRVEKMI--NLGLVEEVQGLLKEGIDKNSQSL-K  234

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            AIGY++ + YL          +  D++  +   +K SR++AKRQLTWFR +    W D
Sbjct  235  AIGYKEVISYL---------DNEIDYYEMVDLIKKNSRHYAKRQLTWFRRDDRIKWFD  283



>ref|WP_021170642.1| tRNA dimethylallyltransferase [Sporomusa ovata]
 gb|EQB26079.1| tRNA dimethylallyltransferase [Sporomusa ovata DSM 2662]
Length=311

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 78/144 (54%), Gaps = 14/144 (10%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            +++   +L +D + + LT +R  LY  I+ R + M+ +  G++ E  GLL  G+ P S  
Sbjct  178  EKTATNELLFDAVVIGLTMERAALYERINRRVDQMIEQ--GLVDEVAGLLQQGV-PPSCK  234

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW-  480
            A + IGY++ +EYLL         + +D      + ++A+RNFAKRQLT++R  P   W 
Sbjct  235  AMQGIGYKEIVEYLL---------ADQDLITATDQLKQATRNFAKRQLTFYRRMPYITWY  285

Query  479  -IDASRPMGSVLDFIYDSYHSQSG  411
             +D      ++L+ IY+    + G
Sbjct  286  NVDNFEEYNNLLETIYNGIAGKFG  309



>ref|WP_029071130.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Kandleria 
vitulina]
Length=306

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 68/124 (55%), Gaps = 12/124 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            ++ ++  ++ YD  C+ LT  R  LY  ID R  D+++EN G+  E + L++ G  P   
Sbjct  175  MEDAQRHEMIYDATCIGLTLDREKLYERIDKRV-DIMMEN-GLEQEVKSLIEEGCKPTYQ  232

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            S  R IGY++  EY        G SS  +  A +   +K SRN+AKRQ TWF N+ + +W
Sbjct  233  SM-RGIGYKEWFEYF------EGRSSKEEVIALI---KKHSRNYAKRQFTWFNNQMMVNW  282

Query  479  IDAS  468
             + +
Sbjct  283  YEVN  286



>ref|WP_031588514.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Kandleria 
vitulina]
Length=306

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 68/124 (55%), Gaps = 12/124 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            ++ ++  ++ YD  C+ LT  R  LY  ID R  D+++EN G+  E + L++ G  P   
Sbjct  175  MEDAQRHEMIYDATCIGLTLDREKLYERIDKRV-DIMMEN-GLEQEVKSLIEEGCKPTYQ  232

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            S  R IGY++  EY        G SS  +  A +   +K SRN+AKRQ TWF N+ + +W
Sbjct  233  SM-RGIGYKEWFEYF------EGRSSKEEVIALI---KKHSRNYAKRQFTWFNNQMMVNW  282

Query  479  IDAS  468
             + +
Sbjct  283  YEVN  286



>ref|WP_009646516.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Selenomonas 
sp. CM52]
 gb|EJU27163.1| tRNA dimethylallyltransferase [Selenomonas sp. CM52]
Length=319

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 65/124 (52%), Gaps = 12/124 (10%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            +++   +L YD   + L  +R +LY  I+ R + ML    G+  E R LL  G+ P    
Sbjct  181  REAAGGELAYDAYVIGLRRERQELYARIEERVDAML--EAGLADEVRSLLAEGV-PRDCP  237

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A + IGYR+ + YL         +   D     +E +KA+R+FAKRQLTWFR  P  HW 
Sbjct  238  AMKGIGYREMLAYL---------AGSMDLPLAAAEIKKATRHFAKRQLTWFRKMPYVHWY  288

Query  476  DASR  465
             AS+
Sbjct  289  AASQ  292



>ref|WP_019124440.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Peptoniphilus 
grossensis]
Length=302

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 65/118 (55%), Gaps = 12/118 (10%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            +E++ DY+ + + L   R  LY+ I+ R + M+  + G++ E + LLD GL  NS S  +
Sbjct  178  REENNDYNLIYIGLNMDRAKLYQKINQRVDKMI--DLGLIDEVKNLLDEGLDKNSQSL-K  234

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            AIGY++ + YL             DF   +   +K SR++AKRQLTWFR +    W D
Sbjct  235  AIGYKEVISYL---------DGNIDFDEMVDLIKKNSRHYAKRQLTWFRRDKRIKWFD  283



>ref|WP_026651178.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Butyrivibrio 
proteoclasticus]
Length=315

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 69/124 (56%), Gaps = 12/124 (10%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++  E+   YDF    LT  R  LY  ID R + M+ E  G+L E + L+ L + P S++
Sbjct  183  KEQHERTSPYDFRYFVLTDDRKKLYSRIDQRVDQMIDE--GLLDEVKSLVKLDV-PLSST  239

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A++AIGYR+  +YL      G +   R  +      ++ +R+FAKRQLTWFR E    W+
Sbjct  240  AAKAIGYREMFDYL-----DGITDLDRAIYLI----KQNTRHFAKRQLTWFRREKEVIWL  290

Query  476  DASR  465
            D S+
Sbjct  291  DKSK  294



>ref|XP_002673426.1| predicted protein [Naegleria gruberi]
 gb|EFC40682.1| predicted protein [Naegleria gruberi]
Length=434

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 81/146 (55%), Gaps = 13/146 (9%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            + +  E +LD   + ++L   R  LY S++ RCE+++    G+L E   L+D G+L +  
Sbjct  209  MDKVSENNLDVRGIVLYL--DRYKLYASLERRCENLV--EAGLLEEVYSLMDRGILLDHT  264

Query  659  SASRAIGYRQAMEYLLYCREQG------GSSSPRDFFAFLSEFQKASRNFAKRQLTWFR-  501
               R+IGY++A +++ Y +          S+  + F  FL EF+ ++R ++K Q TWFR 
Sbjct  265  VPFRSIGYKEAYDFINYMKTVDRRDHFFKSALKKSFLRFLREFKVSTRRYSKHQNTWFRK  324

Query  500  NEPLYHWIDASR--PMGSVLDFIYDS  429
            +E  Y WI++     M  ++DFI ++
Sbjct  325  DETNYEWINSENFLKMDVMVDFIVNN  350



>ref|WP_009145914.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Phascolarctobacterium 
succinatutens]
 gb|EFY04520.1| tRNA dimethylallyltransferase [Phascolarctobacterium succinatutens 
YIT 12067]
Length=311

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 64/111 (58%), Gaps = 12/111 (11%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YD + + L  +R  LY  I+ R  D++LE  G+  E R LL+ G+ P   S  ++IGYRQ
Sbjct  187  YDAVVIGLEMERQALYERINRRV-DLMLEA-GLEQEVRSLLEQGVAPECQSM-QSIGYRQ  243

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
             + YL         +   D+ A + + ++A+RNFAKRQ+TW++  P  HW+
Sbjct  244  MVWYL---------NGSMDYAAAVDKLKQATRNFAKRQITWYKKMPYIHWL  285



>ref|WP_027436413.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae 
bacterium AB2028]
Length=311

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 75/136 (55%), Gaps = 15/136 (11%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + KEK+  YD  C FLT  R  LY  ID R  D+++E  G+L E +GL D  + P++ ++
Sbjct  182  KMKEKEAVYDADCFFLTDDRALLYERIDKRV-DIMMEK-GLLDEVKGLKDRNI-PSNATS  238

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
             + IGYR+ ++YL      G  +     +      +  SR+FAKRQ+TWFRN+  +  ++
Sbjct  239  MQGIGYREILDYL-----DGNCTLDEAVY----NIKLNSRHFAKRQMTWFRNKDEFIKVN  289

Query  473  AS---RPMGSVLDFIY  435
             S    P   + DFIY
Sbjct  290  RSDFDHPSEEIPDFIY  305



>ref|WP_021720023.1| tRNA dimethylallyltransferase [Phascolarctobacterium succinatutens]
 emb|CDD12320.1| tRNA dimethylallyltransferase [Phascolarctobacterium succinatutens 
CAG:287]
Length=311

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 64/111 (58%), Gaps = 12/111 (11%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YD + + L  +R  LY  I+ R  D++LE  G+  E R LL+ G+ P   S  ++IGYRQ
Sbjct  187  YDAVVIGLEMERQALYERINRRV-DLMLEA-GLEQEVRSLLERGVAPECQSM-QSIGYRQ  243

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
             + YL         +   D+ A + + ++A+RNFAKRQ+TW++  P  HW+
Sbjct  244  MVWYL---------NGSMDYAAAVDKLKQATRNFAKRQITWYKKMPYIHWL  285



>ref|WP_006192177.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Selenomonas 
sputigena]
 gb|EEX77678.1| tRNA dimethylallyltransferase [Selenomonas sputigena ATCC 35185]
 gb|AEC00232.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Selenomonas 
sputigena ATCC 35185]
Length=319

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 64/124 (52%), Gaps = 12/124 (10%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            +++   +L YD   + L  +R  LY  I+ R + ML    G+  E R LL  G+ P    
Sbjct  181  REAAGGELAYDAYVIGLRRERQALYARIEERVDAML--EAGLADEVRSLLAEGV-PRDCP  237

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A + IGYR+ + YL         +   D     +E +KA+R+FAKRQLTWFR  P  HW 
Sbjct  238  AMKGIGYREMLAYL---------AGSMDLPLAAAEIKKATRHFAKRQLTWFRKMPYVHWY  288

Query  476  DASR  465
             AS+
Sbjct  289  AASQ  292



>ref|WP_027396120.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anaerovibrio 
lipolyticus]
Length=309

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 63/120 (53%), Gaps = 12/120 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            +   KEK L YD     L   R +LY  I+ R  DM+L+  G++ E R LL+ G+ P S 
Sbjct  177  ISTQKEKGLVYDVYVAGLIWHRSELYDRINRRV-DMMLQQ-GLVDEVRNLLNSGVSPESQ  234

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            S  R IGY++ + Y    R  G      D      + +K +R+FAKRQLTW+R  P  HW
Sbjct  235  SM-RGIGYKEMVNY---VRGTGTLEQAVD------DIKKGTRHFAKRQLTWYRKMPYVHW  284



>ref|WP_027406444.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anaerovibrio 
sp. RM50]
Length=309

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 63/120 (53%), Gaps = 12/120 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            +   KE +L YD   V L   R +LY  I+ R + ML +  G+  E R LLD G+ P S 
Sbjct  177  ISTQKENELVYDVYVVGLIWHRGELYDRINRRVDIMLQQ--GLADEVRHLLDSGVSPESQ  234

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            S  R IGY++ + Y+     QG  +          + +K +R+FAKRQLTW+R  P  HW
Sbjct  235  SM-RGIGYKEMVNYV-----QGTGT----LEQAADDIKKGTRHFAKRQLTWYRKMPYVHW  284



>ref|WP_015262297.1| tRNA dimethylallyltransferase [Desulfitobacterium dichloroeliminans]
 gb|AGA69310.1| tRNA isopentenyltransferase MiaA [Desulfitobacterium dichloroeliminans 
LMG P-21439]
Length=314

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 73/139 (53%), Gaps = 13/139 (9%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G Q ++  +LD   L V LT  R  +Y  I+ RCE ML    G++ E   +L  G  P+ 
Sbjct  179  GNQDTQYSNLDPSTLYVGLTAPREIIYERINLRCEQMLAS--GLIEETHNILKEGYSPHL  236

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
                ++IGYR A+ YL       G  + ++       FQ+ +R+FAKRQLTWFR +P   
Sbjct  237  KPL-QSIGYRHALHYLY------GKVTRQEMLRI---FQRDTRHFAKRQLTWFRRDPRII  286

Query  482  WIDA-SRPMGSVLDFIYDS  429
            W D  +  M ++++ + D+
Sbjct  287  WHDTYNEKMSNIIESLIDT  305



>ref|WP_043904210.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
stearothermophilus]
 gb|EZP78141.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
stearothermophilus NUB3621]
Length=315

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 66/123 (54%), Gaps = 13/123 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q+ + K L YD   V LT +R  LYR I+ R E ML E  G+L EAR L D G+      
Sbjct  180  QRGQTKQLVYDAAIVGLTMEREQLYRRINERVEQMLAE--GLLEEARALYDRGI--RDCQ  235

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + +AIGY++  +Y        G  S  +    + + ++ SR +AKRQLTWFRN+    W 
Sbjct  236  SVQAIGYKELYDYF------DGRVSLEEA---IEQMKQNSRRYAKRQLTWFRNQMPVQWF  286

Query  476  DAS  468
            D +
Sbjct  287  DMT  289



>ref|WP_036085506.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeriaceae 
bacterium FSL A5-0281]
 gb|KGL41667.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeriaceae 
bacterium FSL A5-0281]
Length=308

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 64/126 (51%), Gaps = 13/126 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ  +E+  ++  L + LT +R  LY  ID R  D+++E  G+L EA+ L D GL     
Sbjct  176  LQSQEEQASEFAPLLIGLTRERELLYARIDLRV-DIMMEQ-GLLEEAKALYDTGL--RDV  231

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             A R IGY++   Y        G  +  D    L   ++ SR FAKRQLTWFRN    HW
Sbjct  232  PAVRGIGYKELFTYF------DGKMTLDDAITLL---KRNSRRFAKRQLTWFRNRMDVHW  282

Query  479  IDASRP  462
             D   P
Sbjct  283  FDVDEP  288



>ref|WP_017435038.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
caldoxylosilyticus]
 dbj|GAJ40843.1| tRNA dimethylallyltransferase [Geobacillus caldoxylosilyticus 
NBRC 107762]
Length=315

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 67/123 (54%), Gaps = 13/123 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q+ + K L YD   V LT +R  LYR I+ R E ML E  G+L EA+ L D G+      
Sbjct  180  QRGQTKQLVYDAAIVGLTMEREQLYRRINERVEQMLAE--GLLEEAKALYDRGI--RDCQ  235

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + +AIGY++  +Y        G  S ++    + + ++ SR +AKRQLTWFRN+    W 
Sbjct  236  SVQAIGYKELYDYF------DGRVSLKEA---IEQLKQNSRRYAKRQLTWFRNQMPVQWF  286

Query  476  DAS  468
            D +
Sbjct  287  DMT  289



>ref|WP_029281153.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
indicus]
 gb|KEZ50178.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
indicus LMG 22858]
Length=313

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 69/122 (57%), Gaps = 13/122 (11%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            +EK L YD + V LT +R +LY  ID R  D+++E  G+L+EA+ L + G+      + +
Sbjct  184  QEKVLLYDLVIVGLTMERSELYERIDHRV-DLMMEQ-GLLAEAKQLHENGI--RDCQSVQ  239

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
            AIGY++   Y        G SS  D    + + ++ SR +AKRQLTWFRN+    W D S
Sbjct  240  AIGYKELFAYF------DGKSSLEDA---VDQLKQNSRRYAKRQLTWFRNKMDVEWFDVS  290

Query  467  RP  462
             P
Sbjct  291  SP  292



>ref|WP_029565656.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
cibi]
 gb|KEZ54337.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
cibi]
Length=313

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 69/122 (57%), Gaps = 13/122 (11%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            +EK L YD + V LT +R +LY  ID R  D+++E  G+L+EA+ L + G+      + +
Sbjct  184  QEKVLLYDLVIVGLTMERSELYERIDHRV-DLMMEQ-GLLAEAKQLHENGI--RDCQSVQ  239

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
            AIGY++   Y        G SS  D    + + ++ SR +AKRQLTWFRN+    W D S
Sbjct  240  AIGYKELFAYF------DGKSSLEDA---VDQLKQNSRRYAKRQLTWFRNKMDVEWFDVS  290

Query  467  RP  462
             P
Sbjct  291  SP  292



>ref|XP_011403813.1| PREDICTED: tRNA dimethylallyltransferase 9-like [Amphimedon queenslandica]
Length=388

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 16/128 (13%)
 Frame = -1

Query  815  LDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGY  636
            L Y + C+FLT  R+ LYR ID RCE  ++   G+L E   L+    L   +   ++IGY
Sbjct  193  LPYSYHCLFLTMPRVQLYRRIDERCE--IMTKNGLLKEVIDLVRNHGLVAESPPGKSIGY  250

Query  635  RQAMEYLLYCREQGGSSSP------------RDFFAFLSEFQKASRNFAKRQLTWFRNEP  492
             + ++YL      G   SP            ++F  F+S++Q ++R  A +Q+ WF+ E 
Sbjct  251  CETLKYL--SESWGFPHSPCDDHATDRNTIRKEFLEFISDYQASTRQLACKQMVWFKRED  308

Query  491  LYHWIDAS  468
             +HW++ S
Sbjct  309  SFHWLNMS  316



>ref|WP_033169130.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Selenomonas 
sp. ND2010]
Length=313

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 66/128 (52%), Gaps = 15/128 (12%)
 Frame = -1

Query  839  LQQSK---EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLP  669
            + QSK   E +L YD L + L  +R  LY  I+ R E M     G+++E +GLL  G+  
Sbjct  177  ISQSKVADEGELCYDALVIGLNRERQGLYERINQRVELMF--EAGLIAEVQGLLATGI-T  233

Query  668  NSNSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPL  489
                A + IGY++   YL       G  S  +    +   QK++R+FAKRQLTW+R  P 
Sbjct  234  REEQAMKGIGYKETAAYL------AGEMSQEEAVELI---QKSTRHFAKRQLTWYRKMPY  284

Query  488  YHWIDASR  465
             HW  A +
Sbjct  285  IHWYAADK  292



>ref|WP_019542098.1| hypothetical protein [Selenomonas bovis]
Length=313

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 62/124 (50%), Gaps = 12/124 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            + + K  +L YD   + L   R +LY  ID R   M  +  G+ +E RGLL +G+ P+  
Sbjct  182  ISRRKRGNLAYDVYVIGLARSRAELYARIDARVRAMAAQ--GLAAEVRGLLAVGVTPDMQ  239

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
               + IGY++   YL         +    +   L+   +A+R+FAKRQLTWFR     HW
Sbjct  240  P-MQGIGYKEMAAYL---------ADHGTWEEALAAIARATRHFAKRQLTWFRRMGYIHW  289

Query  479  IDAS  468
             D S
Sbjct  290  FDVS  293



>ref|WP_009441886.1| tRNA dimethylallyltransferase [Selenomonas sp. oral taxon 138]
 gb|EKX94864.1| tRNA dimethylallyltransferase [Selenomonas sp. oral taxon 138 
str. F0429]
Length=322

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 55/116 (47%), Gaps = 12/116 (10%)
 Frame = -1

Query  818  DLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIG  639
            D  YD   + LT  R  LY  I+ R E M     G+  E  GLL  G+   +  A + IG
Sbjct  190  DAPYDAFVIGLTRARAHLYERINMRVEAMFAA--GLADEVAGLLACGI-SRAAPAMKGIG  246

Query  638  YRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDA  471
            Y++   YL         +    F   L+  Q A+R FAKRQ+TW+R  P  HW DA
Sbjct  247  YKETAAYL---------AGEMSFAETLAAIQTATRRFAKRQMTWYRRMPYIHWYDA  293



>ref|WP_003677310.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
coryniformis]
 gb|EJN56581.1| tRNA dimethylallyltransferase [Lactobacillus coryniformis subsp. 
coryniformis CECT 5711]
Length=309

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 66/120 (55%), Gaps = 13/120 (11%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ +++  Y+   + LTTQR  LYR ID R   M+ E  G+L+EA+  L       +  A
Sbjct  182  QTDQQNERYEPFIIGLTTQRQQLYRRIDQRVTQMMAE--GLLTEAK--LVYSQRQQAPQA  237

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            S+AIGY++   Y          +   D    +++ Q+ SR+FAKRQLT+FRN+   HW D
Sbjct  238  SKAIGYKEFFPYF---------AGEIDLATAIAKVQQNSRHFAKRQLTFFRNQMATHWYD  288



>ref|WP_009214871.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oribacterium 
sp. oral taxon 078]
 gb|EFE92210.1| tRNA dimethylallyltransferase [Oribacterium sp. oral taxon 078 
str. F0262]
Length=321

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 65/124 (52%), Gaps = 12/124 (10%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++ + +   YD L   LT +R  LY  ID R ++M+  N G+L E +GLL L     S+ 
Sbjct  189  EEERGRRAQYDALYFVLTREREKLYERIDERVDEMM--NRGLLEEVKGLL-LSGCRRSDP  245

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A + IGYR+   +L         S        +SE ++ SR +AKRQLTWFR E    WI
Sbjct  246  AMQGIGYRELTSFL---------SGEGSLEEAVSEIKRNSRKYAKRQLTWFRREKAAEWI  296

Query  476  DASR  465
            + S+
Sbjct  297  EISK  300



>ref|WP_029540539.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Selenomonas 
ruminantium]
Length=322

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 67/125 (54%), Gaps = 12/125 (10%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            ++L Y+ + + L   R +LY  I+ R E M     G+  E R LL+ GL  ++  A + I
Sbjct  197  EELCYETIVIGLERDRQELYERINRRVELMF--EAGLEDEVRRLLEGGLARDTQ-AMKGI  253

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GY++   YL       G  S  D    +   QK++R+FAKRQLTW+R  P   W+ A +P
Sbjct  254  GYKETASYL------SGEMSREDAIELI---QKSTRHFAKRQLTWYRKMPYIEWLAADQP  304

Query  461  MGSVL  447
            +G +L
Sbjct  305  VGELL  309



>gb|EJW02995.1| hypothetical protein EDEG_02639 [Edhazardia aedis USNM 41457]
Length=280

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 87/172 (51%), Gaps = 10/172 (6%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YD L +FL   RL LYR  D RCE M +EN G LSE   L + GL  N     RAIGYR 
Sbjct  107  YDTLKIFLVCDRLVLYRKTDERCEKM-IEN-GFLSEVLDLKNNGLSLNV-IPGRAIGYRD  163

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASR--PMG  456
            A+ +L          +   F  FL  F++ +RN  + Q T+FR +  Y WID ++  P  
Sbjct  164  AIIFLNKLTASKDIENHVHFNEFLHNFKRRTRNLIRSQETFFRKKE-YIWIDINKFDPY-  221

Query  455  SVLDFIYDSYHSQSGHLKVPKSLSVKKEISSRREVAEMKTYRPRNQHFIGRE  300
            SV+    +     + H +   ++S  +++ ++    + KTY+P +  F  ++
Sbjct  222  SVIQLFLNKAVKFTEHFEFVNNIS--RDV-NKNAFKKCKTYKPLDSKFTEKD  270



>gb|KGP68458.1| tRNA delta(2)-isopentenylpyrophosphate transferase, partial [Lactobacillus 
casei]
Length=286

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 62/111 (56%), Gaps = 13/111 (12%)
 Frame = -1

Query  806  DFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQA  627
            DFL + LTTQR  LY+ I+ R + M+    G+L EA+ L D G    +  A + IGYR+ 
Sbjct  168  DFLIIGLTTQRPVLYQRINQRVDQMVAN--GLLEEAKWLYDQG--GENEQAGKGIGYREL  223

Query  626  MEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
              Y        G+ S ++    L + +  SR++AKRQLTWFRN+   HW D
Sbjct  224  FPYF------AGTVSRQEA---LEKIKLDSRHYAKRQLTWFRNQMTVHWFD  265



>ref|WP_010011053.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
coryniformis]
Length=309

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 66/120 (55%), Gaps = 13/120 (11%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q+ +++  Y+   + LTTQR  LYR ID R   M+ E  G+L+EA+  L       +  A
Sbjct  182  QTDQQNERYEPFIIGLTTQRQQLYRRIDQRVTQMMAE--GLLTEAK--LVYSQRQQAPQA  237

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            S+AIGY++   Y          +   D    +++ Q+ SR+FAKRQLT+FRN+   HW D
Sbjct  238  SKAIGYKEFFPYF---------AGEIDLATAVAKVQQNSRHFAKRQLTFFRNQMATHWYD  288



>ref|WP_026487830.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Butyrivibrio 
sp. XBB1001]
Length=312

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 69/121 (57%), Gaps = 12/121 (10%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++ KE+   YDF    LT  R  LY  ID R  DM++E  G+L E + L+ + + P S++
Sbjct  180  KEQKERTSPYDFKYFVLTDDRKTLYSRIDKRV-DMMMEE-GLLEETQKLIQMNI-PFSST  236

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            AS+++GYR+  +YL     +G     R  +      ++ +R+FAKRQLTWF+ E    WI
Sbjct  237  ASKSLGYREMFDYL-----EGEYDLDRAVYLI----KQNTRHFAKRQLTWFKGEKDVIWI  287

Query  476  D  474
            D
Sbjct  288  D  288



>ref|WP_007288351.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermosinus 
carboxydivorans]
 gb|EAX48580.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermosinus 
carboxydivorans Nor1]
Length=311

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 72/134 (54%), Gaps = 14/134 (10%)
 Frame = -1

Query  830  SKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSAS  651
            ++EK+L YD L + L   R  LY  I+ R + M+    G+++E R LL+ G+ P    A 
Sbjct  181  AREKNLIYDALVIGLNMNRSSLYERINQRVDQMV--ERGLINEVRYLLESGISPKCQ-AM  237

Query  650  RAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW--I  477
            + IGY++ + YL     +G  + P      +   +K +RNFAKRQLTW+R  P   W  +
Sbjct  238  QGIGYKEIVLYL-----KGEITLPEA----IERIKKGTRNFAKRQLTWYRKMPYICWVQV  288

Query  476  DASRPMGSVLDFIY  435
            D       ++++IY
Sbjct  289  DHFPDHNKLMEYIY  302



>emb|CDI69493.1| tRNA dimethylallyltransferase (Dime thylallyl diphosphate:tRNA 
dimethylallyltransferase) (Isope ntenyl-diphosphate:tRNA isopentenyltransferase) 
[Lactobacillus fermentum L930BB]
Length=307

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 62/111 (56%), Gaps = 13/111 (12%)
 Frame = -1

Query  806  DFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQA  627
            DFL + LTTQR  LY+ I+ R + M+    G+L EA+ L D G    +  A + IGYR+ 
Sbjct  189  DFLIIGLTTQRPVLYQRINQRVDQMVAN--GLLEEAKWLYDQG--GENEQAGKGIGYREL  244

Query  626  MEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
              Y        G+ S ++    L + +  SR++AKRQLTWFRN+   HW D
Sbjct  245  FPYF------AGTVSRQEA---LEKIKLDSRHYAKRQLTWFRNQMTVHWFD  286



>ref|WP_003683781.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum]
 gb|EEI21398.1| tRNA dimethylallyltransferase [Lactobacillus fermentum ATCC 14931]
 gb|EEX25126.1| tRNA dimethylallyltransferase [Lactobacillus fermentum 28-3-CHN]
 gb|EQC59383.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum MTCC 8711]
 gb|ESS00712.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum NB-22]
Length=307

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 62/111 (56%), Gaps = 13/111 (12%)
 Frame = -1

Query  806  DFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQA  627
            DFL + LTTQR  LY+ I+ R + M+    G+L EA+ L D G    +  A + IGYR+ 
Sbjct  189  DFLIIGLTTQRPVLYQRINQRVDQMVAN--GLLEEAKWLYDQG--GENEQAGKGIGYREL  244

Query  626  MEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
              Y        G+ S ++    L + +  SR++AKRQLTWFRN+   HW D
Sbjct  245  FPYF------AGTVSRQEA---LEKIKLDSRHYAKRQLTWFRNQMTVHWFD  286



>dbj|GAK08955.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geomicrobium 
sp. JCM 19038]
Length=273

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 63/115 (55%), Gaps = 13/115 (11%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YD + + LT  R  LY  I+ R  D++LE  G++ E R L + GL      A +AIGY++
Sbjct  150  YDLIMIGLTMDRSALYERIERRV-DVMLEQ-GLVEEVRQLYEEGL--RDEQAMKAIGYKE  205

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASR  465
             ++Y      +G +S    F   +   +  SR FAKRQLTWFRN+   HW D+ +
Sbjct  206  WIDYF-----EGKAS----FEHVIETIKTHSRQFAKRQLTWFRNKETVHWFDSEQ  251



>ref|WP_015639231.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum]
 gb|AGL89282.1| tRNA Delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum F-6]
Length=307

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 62/111 (56%), Gaps = 13/111 (12%)
 Frame = -1

Query  806  DFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQA  627
            DFL + LTTQR  LY+ I+ R + M+    G+L EA+ L D G    +  A + IGYR+ 
Sbjct  189  DFLIIGLTTQRPVLYQRINQRVDQMVAN--GLLEEAKWLYDQG--GENEQAGKGIGYREL  244

Query  626  MEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
              Y        G+ S ++    L + +  SR++AKRQLTWFRN+   HW D
Sbjct  245  FPYF------AGTVSRQEA---LEKIKLDSRHYAKRQLTWFRNQMTVHWFD  286



>ref|WP_014562542.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum]
 gb|ADJ41418.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum CECT 5716]
Length=307

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 62/111 (56%), Gaps = 13/111 (12%)
 Frame = -1

Query  806  DFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQA  627
            DFL + LTTQR  LY+ I+ R + M+    G+L EA+ L D G    +  A + IGYR+ 
Sbjct  189  DFLIIGLTTQRPVLYQRINQRVDQMVAN--GLLEEAKWLYDQG--GENEQAGKGIGYREL  244

Query  626  MEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
              Y        G+ S ++    L + +  SR++AKRQLTWFRN+   HW D
Sbjct  245  FPYF------AGTVSRQEA---LEKIKLDSRHYAKRQLTWFRNQMTVHWFD  286



>ref|WP_031556857.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae 
bacterium FD2005]
Length=311

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 72/135 (53%), Gaps = 19/135 (14%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++ KEK+  YDF    LT  R  LY  ID R ++M+  + G++ E + L D+G   +S  
Sbjct  181  KEQKEKESPYDFTYFVLTDDRKKLYDRIDERVDEMM--SQGLVEEVQKLKDMGC-DSSMV  237

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + + IGY++ ++YL      G ++  R  +      ++ SR++AKRQLTWFR E    WI
Sbjct  238  SMQGIGYKEILDYL-----DGKTTLERAVYLI----KQGSRHYAKRQLTWFRREKTVTWI  288

Query  476  DASRPMGSVLDFIYD  432
            +         +F YD
Sbjct  289  NKE-------EFAYD  296



>ref|WP_021349189.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum]
 gb|ERJ55194.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum 3872]
 gb|KIL01876.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum 3872]
Length=307

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 62/111 (56%), Gaps = 13/111 (12%)
 Frame = -1

Query  806  DFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQA  627
            DFL + LTTQR  LY+ I+ R + M+    G+L EA+ L D G    +  A + IGYR+ 
Sbjct  189  DFLIIGLTTQRPVLYQRINQRVDQMVAN--GLLEEAKWLYDQG--GENEQAGKGIGYREL  244

Query  626  MEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
              Y        G+ S ++    L + +  SR++AKRQLTWFRN+   HW D
Sbjct  245  FPYF------AGTVSRQEA---LEKIKLDSRHYAKRQLTWFRNQMTVHWFD  286



>ref|WP_029505954.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae 
bacterium AC2012]
Length=311

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 72/135 (53%), Gaps = 19/135 (14%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++ KEK+  YDF    LT  R  LY  ID R ++M+  + G++ E + L D+G   +S  
Sbjct  181  KEQKEKESPYDFTYFVLTDDRKKLYDRIDERVDEMM--SQGLVEEVQKLKDMGC-DSSMV  237

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + + IGY++ ++YL      G ++  R  +      ++ SR++AKRQLTWFR E    WI
Sbjct  238  SMQGIGYKEILDYL-----DGKTTLERAVYLI----KQGSRHYAKRQLTWFRREKTVTWI  288

Query  476  DASRPMGSVLDFIYD  432
            +         +F YD
Sbjct  289  NKE-------EFAYD  296



>ref|WP_013877177.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
thermoglucosidasius]
 gb|AEH48476.1| tRNA dimethylallyltransferase [Geobacillus thermoglucosidasius 
C56-YS93]
Length=315

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 67/123 (54%), Gaps = 13/123 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            QQ + K L YD   + LT +R  LYR I+ R ++ML E  G+L EA+ L D G+   +  
Sbjct  180  QQGQTKKLLYDAAIIGLTMKREQLYRRINERVDEMLAE--GLLEEAKALYDRGI--RNCQ  235

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + +AIGY++   Y      +G  S        + + ++ SR +AKRQLTWFRN+    W 
Sbjct  236  SVQAIGYKELFAYF-----EGRVS----LEEAIEQLKQNSRRYAKRQLTWFRNQMPVQWF  286

Query  476  DAS  468
            D +
Sbjct  287  DMT  289



>ref|WP_027432968.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lachnospiraceae 
bacterium MD2004]
Length=311

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 72/135 (53%), Gaps = 19/135 (14%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++ KEK+  YDF    LT  R  LY  ID R ++M+  + G++ E + L D+G   +S  
Sbjct  181  KEQKEKESPYDFTYFVLTDDRKKLYDRIDERVDEMM--SQGLVEEVQKLKDMGC-DSSMV  237

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + + IGY++ ++YL      G ++  R  +      ++ SR++AKRQLTWFR E    WI
Sbjct  238  SMQGIGYKEILDYL-----DGKTTLERAVYLI----KQGSRHYAKRQLTWFRREKTVTWI  288

Query  476  DASRPMGSVLDFIYD  432
            +         +F YD
Sbjct  289  NKE-------EFAYD  296



>ref|WP_040353778.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Clostridium 
ultunense]
Length=320

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 12/110 (11%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            +D L + LT +R  LYR I+ R + M+  N G+L E + LL +G+ P  ++A + +GY++
Sbjct  195  FDLLLIGLTLERKHLYRRIEERVDRMM--NEGLLEEVKRLLAVGV-PKESTAMQGLGYKE  251

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             + YL     +G  +        + E +K +R FAKRQLTWFR+    HW
Sbjct  252  LIPYL-----EGKIT----LMEAVQEMKKRTRQFAKRQLTWFRHMNGIHW  292



>ref|WP_021774291.1| tRNA dimethylallyltransferase [Oribacterium sp. oral taxon 078]
 gb|ERL05863.1| tRNA dimethylallyltransferase [Oribacterium sp. oral taxon 078 
str. F0263]
Length=321

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 70/136 (51%), Gaps = 15/136 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++ + +   YD L   LT +R  LY  ID R ++M+    G+L E +GLL L     S+ 
Sbjct  189  EEEQGRRAQYDALYFVLTREREKLYERIDERVDEMM--KRGLLEEVKGLL-LSGCRRSDP  245

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A + IGYR+   +L         S  R     +SE ++ SR +AKRQ+TWFR E    WI
Sbjct  246  AMQGIGYRELSSFL---------SGERSLEEAVSEIKRNSRKYAKRQITWFRREKAAEWI  296

Query  476  DASR---PMGSVLDFI  438
            + S+     G + ++I
Sbjct  297  EISKFGEEKGKITEWI  312



>ref|WP_039205603.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anaerovibrio 
lipolyticus]
 gb|KHM53219.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Anaerovibrio 
lipolyticus]
Length=309

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 60/120 (50%), Gaps = 12/120 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            +   KEK L YD     L   R +LY  I+ R   ML +  G+  E R LL+ G+ P S 
Sbjct  177  ISTQKEKGLVYDVYVAGLIWHRSELYDRINRRVHMMLQQ--GLAEEVRNLLNSGVSPESQ  234

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            S  R IGY+   E + Y R  G      D      + +K +R+FAKRQLTW+R  P  HW
Sbjct  235  SM-RGIGYK---EMVNYVRGTGTLEQAVD------DIKKGTRHFAKRQLTWYRKMPYVHW  284



>emb|CCQ98517.1| tRNA dimethylallyltransferase [Clostridium ultunense Esp]
Length=312

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 12/110 (11%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            +D L + LT +R  LYR I+ R + M+  N G+L E + LL +G+ P  ++A + +GY++
Sbjct  187  FDLLLIGLTLERKHLYRRIEERVDRMM--NEGLLEEVKRLLAVGV-PKESTAMQGLGYKE  243

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             + YL     +G  +        + E +K +R FAKRQLTWFR+    HW
Sbjct  244  LIPYL-----EGKIT----LMEAVQEMKKRTRQFAKRQLTWFRHMNGIHW  284



>ref|WP_023510047.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sporolactobacillus 
laevolacticus]
 gb|EST12176.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Sporolactobacillus 
laevolacticus DSM 442]
Length=313

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 69/126 (55%), Gaps = 14/126 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q+  E+ L + FLC+ LT +R  LY  ID R + M+ +  G+L EA+ +  LGL   +  
Sbjct  181  QEETEQPL-FPFLCIGLTMERAMLYSRIDARVDQMMAD--GLLKEAQLMYQLGL--RNAQ  235

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A +AIGY++ + Y        G  S  D    +   +K SR++AKRQLTWFR +   HW 
Sbjct  236  AMQAIGYKEFIPYF------DGEISLEDA---VERLKKNSRHYAKRQLTWFRRQMPIHWF  286

Query  476  DASRPM  459
            D +  +
Sbjct  287  DMAEAL  292



>ref|WP_034658493.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
massiliosenegalensis]
Length=322

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 65/124 (52%), Gaps = 13/124 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
             Q+ +  DL YD   + LT +R  LY+ ID R   M+  + G+L E +GL D GL     
Sbjct  182  FQEKQTHDLCYDTALIGLTMEREQLYQRIDKRVNMMI--DQGLLEEVKGLYDSGL--RDC  237

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             + +AIGY++  EY           SP D    + + ++ SR +AKRQLTWFRN+    W
Sbjct  238  GSIQAIGYKELYEYF-------DGDSPLD--TAVEQLKQNSRRYAKRQLTWFRNKMDVQW  288

Query  479  IDAS  468
             D +
Sbjct  289  FDMT  292



>ref|WP_021718557.1| tRNA dimethylallyltransferase [Phascolarctobacterium sp. CAG:207]
 emb|CDB46601.1| tRNA dimethylallyltransferase [Phascolarctobacterium sp. CAG:207]
Length=309

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 66/122 (54%), Gaps = 12/122 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            +   K ++  Y+ +   L  +R  LY  I+ R + M+ E  G++ E + LLD GL  ++ 
Sbjct  175  IAHRKSEEWPYETVVFGLRMERESLYARINARVDKMMAE--GLVEETKSLLDSGLSLDAQ  232

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
            S  R+IGYRQ + YL     QG      D  A + + ++A+RNFAKRQ TW+R  P   W
Sbjct  233  SM-RSIGYRQIVWYL-----QG----QMDKLAAVEKLKQATRNFAKRQFTWYRQMPYIKW  282

Query  479  ID  474
             D
Sbjct  283  FD  284



>ref|WP_027215856.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Butyrivibrio 
fibrisolvens]
Length=307

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 70/136 (51%), Gaps = 15/136 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++  EK   YDF    LT  R  LY  ID R + M+ +  G+L E + L+ LG+ P S +
Sbjct  180  KEQHEKTSPYDFRYFVLTDHREVLYERIDKRVDKMIED--GLLGECQKLMTLGIEP-SMT  236

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + + +GYR+ M Y+         +   D    +   ++ +R+FAKRQLTWFR E    W+
Sbjct  237  SMQGLGYREMMGYI---------NGEYDLERAIYLIKRNTRHFAKRQLTWFRREKDVIWV  287

Query  476  DAS---RPMGSVLDFI  438
            D S   R    VLD I
Sbjct  288  DKSEYNREDAQVLDAI  303



>ref|WP_005398122.1| tRNA dimethylallyltransferase [Helcococcus kunzii]
 gb|EHR34461.1| tRNA dimethylallyltransferase [Helcococcus kunzii ATCC 51366]
Length=303

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 68/119 (57%), Gaps = 14/119 (12%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            KD++Y      LT  R  +Y  I+ R  D+++E+ G++ E + LL+ G+ PNS S  +AI
Sbjct  183  KDINYHLFV--LTNDRKIIYDRINKRV-DIMIES-GLIDEVKSLLEDGVDPNSQSM-KAI  237

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASR  465
            GYR+ + YL         ++   +   + + ++ SR++AKRQLTWFR      W+D S+
Sbjct  238  GYREVISYL---------NNEYTYEEMIDKLKQNSRHYAKRQLTWFRRNEYSQWLDVSK  287



>ref|WP_027218383.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Butyrivibrio 
fibrisolvens]
Length=307

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 70/136 (51%), Gaps = 15/136 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++  EK   YDF    LT  R  LY  ID R + M+ +  G+L E + L+ +G+ P S +
Sbjct  180  KEQHEKTSPYDFRYFVLTDHREVLYERIDKRVDKMIKD--GLLGECQKLMTMGIEP-SMT  236

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + + +GYR+ M Y+         +   D    +   ++ +R+FAKRQLTWFR E    W+
Sbjct  237  SMQGLGYREMMGYI---------NGEYDLERAIYLIKRNTRHFAKRQLTWFRREKDVIWV  287

Query  476  DAS---RPMGSVLDFI  438
            D S   R    VLD I
Sbjct  288  DKSEYNREDAQVLDAI  303



>ref|WP_019850479.1| tRNA dimethylallyltransferase [Desulfitobacterium sp. PCE1]
Length=314

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 71/139 (51%), Gaps = 13/139 (9%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G Q +    L    L V LT  R  +Y  I+ RCE M+    G++ E + L+  G  P  
Sbjct  179  GHQDTVYPPLASSILYVGLTAPRDIIYERINHRCEQMVAS--GLIEETQNLIQEGYSPKL  236

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
                ++IGYR A+ YL      G  + P      +  FQ+ +R+FAKRQLTWFR +P   
Sbjct  237  KPL-QSIGYRHALLYLY-----GKVTLPE----MMRIFQRDTRHFAKRQLTWFRRDPRVV  286

Query  482  WIDA-SRPMGSVLDFIYDS  429
            W D  +  M ++L+F+ D+
Sbjct  287  WHDTYNENMTNILEFLIDT  305



>ref|WP_009330586.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. 2_A_57_CT2]
 gb|EFV79719.1| TRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. 2_A_57_CT2]
Length=320

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 64/123 (52%), Gaps = 13/123 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q++++  L YD   + LT  R  LY  I+ R E M+ E  G+L E R L DLGL      
Sbjct  182  QENQDPALLYDTALIGLTMDRDTLYERINLRVEIMMKE--GLLEEVRALYDLGL--KDCQ  237

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + +AIGY++  EY        G  S  D    L   ++ SR +AKRQLTWFRN+    W 
Sbjct  238  SIQAIGYKELYEYF------NGRVSLEDAVGNL---KQNSRRYAKRQLTWFRNKMNVEWF  288

Query  476  DAS  468
            D S
Sbjct  289  DMS  291



>ref|WP_016459580.1| tRNA dimethylallyltransferase [Acidaminococcus sp. HPA0509]
 gb|EPD73931.1| tRNA dimethylallyltransferase [Acidaminococcus sp. HPA0509]
Length=312

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 72/134 (54%), Gaps = 14/134 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            + Q KE +  +D +   LT +R  LY  I+ R + M+ E  G+  EAR   D G+ P  +
Sbjct  177  VSQEKESESPFDAVVFGLTMERALLYDRINRRVDLMVEE--GLFDEARFFYDQGI-PLDS  233

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             + ++IGYRQ ++Y              D    +++ ++A+RNFAKRQ+TW++  P  HW
Sbjct  234  QSMKSIGYRQCVQYF---------RGEWDKKTAVAKIKQATRNFAKRQITWYKKMPYIHW  284

Query  479  --IDASRPMGSVLD  444
              +DAS    S+ D
Sbjct  285  LMLDASPHYPSIAD  298



>ref|WP_039944259.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Thermicanus 
aegyptius]
Length=320

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 12/110 (11%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            +D L + LT +R  LYR I+ R + M+  N G+L E + LL +G+ P  ++A + +GY++
Sbjct  195  FDLLLIGLTLERKHLYRRIEERVDRMM--NEGLLEEVKRLLAVGV-PKESTAMQGLGYKE  251

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             + YL     +G  +        + E +K +R FAKRQLTWFR+    HW
Sbjct  252  LIPYL-----EGKIT----LTEAVQEMKKRTRQFAKRQLTWFRHMNGIHW  292



>ref|WP_019381817.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
oceanisediminis]
Length=320

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 64/123 (52%), Gaps = 13/123 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q++++  L YD   + LT  R  LY  I+ R E M+ E  G+L E R L DLGL      
Sbjct  182  QENQDPALLYDTALIGLTMDRDTLYERINLRVEIMMKE--GLLEEVRALYDLGL--KDCQ  237

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + +AIGY++  EY        G  S  D    L   ++ SR +AKRQLTWFRN+    W 
Sbjct  238  SIQAIGYKELYEYF------NGRVSLEDAVGNL---KQNSRRYAKRQLTWFRNKMNVEWF  288

Query  476  DAS  468
            D S
Sbjct  289  DMS  291



>ref|WP_014794023.1| tRNA dimethylallyltransferase [Desulfitobacterium dehalogenans]
 gb|AFM00537.1| tRNA isopentenyltransferase MiaA [Desulfitobacterium dehalogenans 
ATCC 51507]
Length=314

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 71/139 (51%), Gaps = 13/139 (9%)
 Frame = -1

Query  842  GLQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNS  663
            G Q +    L    L V LT  R  +Y  I+ RCE M+    G++ E + L+  G  P  
Sbjct  179  GHQDTVYPPLASSILYVGLTAPRDIIYERINHRCEQMVAS--GLIEETQNLIQEGYSPKL  236

Query  662  NSASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYH  483
                ++IGYR A+ YL      G  + P      +  FQ+ +R+FAKRQLTWFR +P   
Sbjct  237  KPL-QSIGYRHALLYLY-----GKVTLPE----MMRIFQRDTRHFAKRQLTWFRRDPRVV  286

Query  482  WIDA-SRPMGSVLDFIYDS  429
            W D  +  M ++L+F+ D+
Sbjct  287  WHDTYNENMTNILEFLIDT  305



>ref|WP_022223151.1| tRNA dimethylallyltransferase [Firmicutes bacterium CAG:170]
 emb|CDB87883.1| tRNA dimethylallyltransferase [Firmicutes bacterium CAG:170]
Length=314

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 62/106 (58%), Gaps = 12/106 (11%)
 Frame = -1

Query  776  RLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQAMEYLLYCREQ  597
            R DLY  ID R E ML    G+++E   LL  G+ P++ +A +AIGY++ ++ L      
Sbjct  203  RADLYARIDLRVEQML--EQGLVAEVERLLARGV-PDTATAMQAIGYKEIVQALR-----  254

Query  596  GGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRPM  459
             G ++  +    +   Q+ SRN+AKRQLTWFR  P  HW++ + P+
Sbjct  255  -GQTTMDEAVRLI---QQRSRNYAKRQLTWFRRNPELHWLEQTLPL  296



>ref|WP_027204115.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Butyrivibrio 
fibrisolvens]
Length=307

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 70/136 (51%), Gaps = 15/136 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++  EK   YDF    LT  R  LY  ID R + M+ +  G+L E + L+ +G+ P S +
Sbjct  180  KEQHEKTSPYDFRYFVLTDHREVLYERIDKRVDKMIED--GLLGECQKLMTMGIEP-SMT  236

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + + +GYR+ M Y+         +   D    +   ++ +R+FAKRQLTWFR E    W+
Sbjct  237  SMQGLGYREMMGYI---------NGEYDLERAIYLIKRNTRHFAKRQLTWFRREKDVIWV  287

Query  476  DAS---RPMGSVLDFI  438
            D S   R    VLD I
Sbjct  288  DKSEYNREDAQVLDAI  303



>ref|WP_003251543.1| MULTISPECIES: tRNA delta(2)-isopentenylpyrophosphate transferase 
[Geobacillus]
 gb|ADP75260.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
sp. Y4.1MC1]
 gb|EID43830.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
thermoglucosidans TNO-09.020]
 dbj|GAJ41955.1| tRNA dimethylallyltransferase [Geobacillus thermoglucosidasius 
NBRC 107763]
Length=315

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 13/123 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            QQ + K L YD   + LT +R  LYR I+ R + ML E  G+L EA+ L D G+   +  
Sbjct  180  QQGQTKKLLYDAAIIGLTMKREQLYRRINERVDKMLAE--GLLEEAKALYDRGI--RNCQ  235

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + +AIGY++   Y      +G  S        + + ++ SR +AKRQLTWFRN+    W 
Sbjct  236  SVQAIGYKELFAYF-----EGRVS----LEEAIEQLKQNSRRYAKRQLTWFRNQMPVQWF  286

Query  476  DAS  468
            D +
Sbjct  287  DMT  289



>ref|WP_027205748.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Butyrivibrio 
fibrisolvens]
Length=307

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 70/136 (51%), Gaps = 15/136 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++  EK   YDF    LT  R  LY  ID R + M+ +  G+L E + L+ +G+ P S +
Sbjct  180  KEQHEKTSPYDFRYFVLTDHREVLYERIDKRVDKMIED--GLLGECQKLMTMGIEP-SMT  236

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + + +GYR+ M Y+         +   D    +   ++ +R+FAKRQLTWFR E    W+
Sbjct  237  SMQGLGYREMMGYI---------NGEYDLERAIYLIKRNTRHFAKRQLTWFRREKDVIWV  287

Query  476  DAS---RPMGSVLDFI  438
            D S   R    VLD I
Sbjct  288  DKSEYNREDAQVLDAI  303



>ref|WP_026515890.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Butyrivibrio 
sp. MC2021]
Length=309

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 63/115 (55%), Gaps = 12/115 (10%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YDF C  LT  R  LY  ID R + M+ E  G+  E + LL++ + P + ++ + +GYR+
Sbjct  189  YDFKCFVLTDDRNTLYSRIDKRVDQMIEE--GLEEEVKKLLEMDI-PKTATSMQGLGYRE  245

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASR  465
             + YL     QG     R  +      ++ +R+FAKRQLTW+RN     WID S+
Sbjct  246  MIGYL-----QGEYDLERAVYLI----KRNTRHFAKRQLTWYRNRDDSIWIDKSQ  291



>ref|WP_022753896.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Butyrivibrio 
fibrisolvens]
Length=307

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 70/136 (51%), Gaps = 15/136 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++  EK   YDF    LT  R  LY  ID R + M+ +  G+L E + L+ +G+ P S +
Sbjct  180  KEQHEKTSPYDFRYFVLTDHREVLYERIDKRVDKMIED--GLLGECQKLMTMGIEP-SMT  236

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + + +GYR+ M Y+         +   D    +   ++ +R+FAKRQLTWFR E    W+
Sbjct  237  SMQGLGYREMMGYI---------NGEYDLERAIYLIKRNTRHFAKRQLTWFRREKDVIWV  287

Query  476  DAS---RPMGSVLDFI  438
            D S   R    VLD I
Sbjct  288  DKSEYNREDAQVLDAI  303



>ref|WP_026668537.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Butyrivibrio 
sp. AE3009]
Length=310

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 62/114 (54%), Gaps = 12/114 (11%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YDF C  LT  R  LY  ID R + M+ E  G+  E R LL++ + P + ++ + +GYR+
Sbjct  190  YDFKCFVLTDDRNTLYSRIDKRVDQMIEE--GLEEEVRKLLEMNI-PKTATSMQGLGYRE  246

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
             + YL     +G     R  +      ++ +R+FAKRQLTW+RN     WID S
Sbjct  247  MIGYL-----EGEYDLDRAIYLI----KRNTRHFAKRQLTWYRNRDDSIWIDKS  291



>ref|WP_031584720.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Selenomonas 
bovis]
Length=313

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 12/124 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            + + +  +L YD   + L   R +LY  ID R   M  +  G+ +E RGLL  G+ P+  
Sbjct  182  ISRHRRGNLAYDVYVIGLARPRAELYARIDARVRAMAAQ--GLAAEVRGLLAAGVTPDMQ  239

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
               + IGY++   YL       G  +  +  A ++   +A+R+FAKRQLTWFR     HW
Sbjct  240  P-MQGIGYKEMAAYL------AGRGTWEEALAAIA---RATRHFAKRQLTWFRRMGYIHW  289

Query  479  IDAS  468
             D S
Sbjct  290  FDVS  293



>ref|WP_006695649.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Selenomonas 
noxia]
 gb|EHG26193.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Selenomonas 
noxia F0398]
Length=322

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 58/116 (50%), Gaps = 12/116 (10%)
 Frame = -1

Query  818  DLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIG  639
            D  YD   + LT +R  LY  I+ R E+M     G+  E  GLL  G+  ++  A + IG
Sbjct  190  DTPYDAFVIGLTRERARLYERINARAEEMF--AAGLADEVAGLLARGVQRDA-PAMKGIG  246

Query  638  YRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDA  471
            Y++   YL     Q  +         +   QKA+RNFAKRQLTW+R  P   W DA
Sbjct  247  YKETAAYLAGEMSQAEA---------VDAIQKATRNFAKRQLTWYRRMPYIRWYDA  293



>ref|WP_040284514.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Tessaracoccus 
sp. SIT6]
Length=304

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 62/109 (57%), Gaps = 12/109 (11%)
 Frame = -1

Query  788  LTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQAMEYLLY  609
            L  +R +L R ID R E M     G++ E RGLLD GL  +  +A RAIGYRQ + +L  
Sbjct  197  LALERAELDRRIDQRVEQMW--EQGLVGEVRGLLDRGLR-DGVTAIRAIGYRQVVAHL--  251

Query  608  CREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
                 G  + ++  A   E Q+A+R F +RQL+W+  +P   W+DAS P
Sbjct  252  ----DGELTEQEARA---EVQRATRRFFRRQLSWYNRDPRITWLDASSP  293



>ref|WP_012739228.1| tRNA delta(2)-isopentenylpyrophosphate transferase [[Eubacterium] 
eligens]
 gb|ACR71993.1| tRNA delta(2)-isopentenylpyrophosphate transferase [ [[Eubacterium] 
eligens ATCC 27750]
Length=313

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 69/124 (56%), Gaps = 14/124 (11%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            + + K+  Y+F    L  +R  LY  I+ R  D++ +N G+L E + L D+GL+ + + A
Sbjct  183  EQRAKESPYNFCYFVLNDKREILYDRINRRV-DIMFDN-GLLDEVKHLSDMGLVKD-DVA  239

Query  653  SRAIGYRQAMEYLL-YCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
             + IGY++  +YL   C E G               ++ +R+FAKRQLTWFR EPL  W+
Sbjct  240  MQGIGYKEVFDYLEGRCDEAG----------LREMIKQDTRHFAKRQLTWFRREPLVTWV  289

Query  476  DASR  465
            D S+
Sbjct  290  DFSQ  293



>ref|WP_036101723.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeria 
riparia]
 gb|EUJ43038.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeria 
riparia FSL S10-1204]
Length=308

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 69/132 (52%), Gaps = 14/132 (11%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ  +E+  ++  L + LT +R  LY  ID R  D+++E  G+L EA+ L D GL     
Sbjct  176  LQSQEEQASEFAPLLIGLTRERELLYARIDLRV-DIMMEQ-GLLEEAKALYDSGL--RDV  231

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             A R IGY++   Y        G+ +  D    L   ++ SR FAKRQLTWFRN     W
Sbjct  232  PAVRGIGYKELFTYF------DGNITLEDAITLL---KRNSRRFAKRQLTWFRNRMDVRW  282

Query  479  IDASRP-MGSVL  447
             D  +P M SV+
Sbjct  283  FDVDQPEMESVI  294



>ref|WP_012391462.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum]
 sp|B2GD80.1|MIAA_LACF3 RecName: Full=tRNA dimethylallyltransferase; AltName: Full=Dimethylallyl 
diphosphate:tRNA dimethylallyltransferase; Short=DMAPP:tRNA 
dimethylallyltransferase; Short=DMATase; AltName: 
Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase; 
Short=IPP transferase; Short=IPPT; Short=IPTase [Lactobacillus 
fermentum IFO 3956]
 dbj|BAG27612.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
fermentum IFO 3956]
Length=307

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 62/111 (56%), Gaps = 13/111 (12%)
 Frame = -1

Query  806  DFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQA  627
            DFL + LTTQR  LY+ I+ R + M+    G+L EA+ L D G    +  A + IGYR+ 
Sbjct  189  DFLIIGLTTQRPVLYQRINQRVDQMVAN--GLLEEAKWLYDQG--GENEQAGKGIGYREL  244

Query  626  MEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
              +        G+ S ++    L + +  SR++AKRQLTWFRN+   HW D
Sbjct  245  FPHF------AGTVSRQEA---LEKIKLDSRHYAKRQLTWFRNQMTVHWFD  286



>ref|WP_035330692.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
firmus]
 gb|EWG10420.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
firmus DS1]
Length=320

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 63/123 (51%), Gaps = 13/123 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q+ +  +L YD   + LT  R  LY  I+ R E M+ E  G+L E R L D GL      
Sbjct  182  QEKQNPELLYDMALIGLTLDRESLYERINHRVEIMMKE--GLLEEVRSLYDQGL--KDCQ  237

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + +AIGY++  EY        GS S  D    +   ++ SR +AKRQLTWFRN+    W 
Sbjct  238  SIQAIGYKELYEYF------KGSVSLEDA---VENLKQNSRRYAKRQLTWFRNKMNVEWF  288

Query  476  DAS  468
            D S
Sbjct  289  DMS  291



>ref|WP_028584511.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfobulbus 
mediterraneus]
Length=323

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 65/128 (51%), Gaps = 17/128 (13%)
 Frame = -1

Query  836  QQSKEKDLDYD-FLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            Q+   KD  +D  L V LTT+R  LY+ I  R E M+    G++ E RGLL +G      
Sbjct  189  QRQGAKDYSFDQLLLVGLTTEREKLYQRIGLRTEIMM--ESGLIEEVRGLLAMGY-HGGL  245

Query  659  SASRAIGYRQAMEYL--LYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLY  486
            S+ +AIGYR A+ Y+  LY REQ   +  RD           +R +AKRQ+TWF+     
Sbjct  246  SSMQAIGYRHAVGYIQGLYNREQAVETLIRD-----------TRRYAKRQMTWFKQYEQM  294

Query  485  HWIDASRP  462
             W     P
Sbjct  295  RWYRVDSP  302



>ref|WP_036065259.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeria 
grandensis]
Length=305

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 63/123 (51%), Gaps = 13/123 (11%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ  + +  ++D L + L  +R +LY  I+ R E ML +  G+L EAR   D G+     
Sbjct  176  LQNQEAQSSEFDPLLIGLNRERSELYARINLRVELMLAQ--GLLEEARRFYDTGV--RDV  231

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             A+R IGY++   Y        G+ +  D    L   Q+ SR FAKRQLTWFRN    HW
Sbjct  232  PAARGIGYKELFTYF------DGNMALADATELL---QRNSRRFAKRQLTWFRNRLDVHW  282

Query  479  IDA  471
             D 
Sbjct  283  FDT  285



>ref|WP_025951152.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
thermocatenulatus]
Length=314

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 65/122 (53%), Gaps = 13/122 (11%)
 Frame = -1

Query  833  QSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSA  654
            Q  EK L Y+   V LT +R  LYR I+ R ++M+    G++ EAR L D GL      A
Sbjct  180  QQTEKRLLYEAAIVGLTAERKVLYRRINERVDEMI--AAGLIEEARALYDRGL--RDCQA  235

Query  653  SRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
             +AIGY++  +Y        G  S   F   + + ++ SR +AKRQLTWFRN+    W D
Sbjct  236  VQAIGYKELYDYF------DGRVS---FDEAIEQLKQHSRRYAKRQLTWFRNQMPVKWFD  286

Query  473  AS  468
             +
Sbjct  287  MT  288



>ref|WP_021716304.1| tRNA dimethylallyltransferase [Phascolarctobacterium sp. CAG:266]
 emb|CDB35078.1| tRNA dimethylallyltransferase [Phascolarctobacterium sp. CAG:266]
Length=236

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 65/122 (53%), Gaps = 12/122 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            L  SK ++L YD     L  +R  LY  I+ R  D++LE  G++ E R LL+ G+ P S 
Sbjct  102  LSHSKSEELVYDAAVFGLRMERSALYDRINRRV-DIMLEQ-GLIEETRRLLEEGV-PESA  158

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             + +AIGYRQ + YL             D    + + ++A+RNFAKRQ TW++  P   W
Sbjct  159  QSMQAIGYRQTVLYL---------KGEWDKAIAVDKIKQATRNFAKRQFTWYKKMPYVKW  209

Query  479  ID  474
             +
Sbjct  210  FN  211



>gb|EUJ24809.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Listeria 
grandensis FSL F6-971]
Length=311

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 63/124 (51%), Gaps = 13/124 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            LQ  + +  ++D L + L  +R +LY  I+ R E ML +  G+L EAR   D G+     
Sbjct  182  LQNQEAQSSEFDPLLIGLNRERSELYARINLRVELMLAQ--GLLEEARRFYDTGV--RDV  237

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             A+R IGY++   Y        G+ +  D    L   Q+ SR FAKRQLTWFRN    HW
Sbjct  238  PAARGIGYKELFTYF------DGNMALADATELL---QRNSRRFAKRQLTWFRNRLDVHW  288

Query  479  IDAS  468
             D  
Sbjct  289  FDTG  292



>ref|XP_006358949.1| PREDICTED: tRNA dimethylallyltransferase 9-like isoform X2 [Solanum 
tuberosum]
Length=368

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLL  726
            LQQ++ KDLDYDFLC FL+T R+DLYRSIDFRCEDMLL
Sbjct  250  LQQNEIKDLDYDFLCYFLSTNRIDLYRSIDFRCEDMLL  287


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  718  MEFCLRLGGFLIWVFCQTQILQVELLVIGKLWNT  617
            MEF LR GGFL+WVFC+T+IL +E LV  K WNT
Sbjct  334  MEFYLRQGGFLMWVFCRTRILLLEQLVTDKQWNT  367



>ref|WP_019107145.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Peptoniphilus 
senegalensis]
Length=302

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 61/117 (52%), Gaps = 12/117 (10%)
 Frame = -1

Query  824  EKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRA  645
            E++ DY+ + + L   R  LY  I+ R + M+    G+L E + LL  GL  NS S  +A
Sbjct  179  EENNDYNLIYIGLNMDRAKLYEKINQRVDKMI--ELGLLDEVKNLLAEGLDKNSQSL-KA  235

Query  644  IGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
            IGY++ + YL             DF   +   +K SR++AKRQLTWFR +    W D
Sbjct  236  IGYKEVIAYL---------DGEIDFDEMVDLIKKNSRHYAKRQLTWFRRDDRIKWFD  283



>gb|KIL73665.1| tRNA dimethylallyltransferase [Bacillus badius]
Length=306

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 70/144 (49%), Gaps = 19/144 (13%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q S+  +L YD   + LT  R  LY  I+ R + M+    G+L E + L D G+   S  
Sbjct  174  QSSQPNELLYDTALIGLTMDREMLYSRINERVDQMMAA--GLLEEVKTLWDKGI--RSGQ  229

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A +AIGY++   YL                A + + ++ SRN+AKRQLTWFRN+   +W 
Sbjct  230  AVQAIGYKELFSYL---------RGEETLEAAVEQLKQNSRNYAKRQLTWFRNKMDVNWF  280

Query  476  DAS----RP--MGSVLDFIYDSYH  423
            D S    RP  +  +  FI    H
Sbjct  281  DLSDEEKRPEKIKEISGFIAGKLH  304



>ref|WP_022791389.1| transposase [Weissella halotolerans]
Length=307

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 66/114 (58%), Gaps = 17/114 (15%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YD   + L T+R  LY+ I+ R + ML +  G+L+EAR + DL   P   +A +AIGY++
Sbjct  188  YDAFIIGLNTERAYLYKRINQRVDSMLAD--GLLNEARLVYDL---PAEATAKKAIGYKE  242

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQK-ASRNFAKRQLTWFRNE-PLYHWID  474
               YL       G ++     A  SE  K ASR++AKRQLTWF+N+    HW+D
Sbjct  243  LFPYL------AGEAT----LAQASEVLKTASRHYAKRQLTWFKNQFTDIHWLD  286



>ref|WP_005835646.1| MULTISPECIES: tRNA delta(2)-isopentenylpyrophosphate transferase 
[Bacillales]
 gb|ELK39562.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
agri BAB-2500]
Length=319

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 64/118 (54%), Gaps = 12/118 (10%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YD + + LT +R  LY  I+ R E M+ E  G++ E RGLLD G    S  + + +GY++
Sbjct  192  YDLVMIGLTMERAVLYERINRRVELMIEE--GLVEEVRGLLDKGY-DASMVSMQGLGYKE  248

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRPMG  456
             + YL       G  +       +++ Q+ +R+FAKRQL+WFR  P   W D + P G
Sbjct  249  LIPYLY------GEIT---LEKAINDIQQRTRHFAKRQLSWFRRIPEVQWFDMTDPAG  297



>ref|WP_041100150.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
badius]
Length=314

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 70/144 (49%), Gaps = 19/144 (13%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q S+  +L YD   + LT  R  LY  I+ R + M+    G+L E + L D G+   S  
Sbjct  182  QSSQPNELLYDTALIGLTMDREMLYSRINERVDQMMAA--GLLEEVKTLWDKGI--RSGQ  237

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A +AIGY++   YL                A + + ++ SRN+AKRQLTWFRN+   +W 
Sbjct  238  AVQAIGYKELFSYL---------RGEETLEAAVEQLKQNSRNYAKRQLTWFRNKMDVNWF  288

Query  476  DAS----RP--MGSVLDFIYDSYH  423
            D S    RP  +  +  FI    H
Sbjct  289  DLSDEEKRPEKIKEISGFIAGKLH  312



>ref|WP_009015655.1| MULTISPECIES: tRNA delta(2)-isopentenylpyrophosphate transferase 
[Acidaminococcus]
 ref|YP_004896306.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acidaminococcus 
intestini RyC-MR95]
 gb|EEH90836.1| tRNA dimethylallyltransferase [Acidaminococcus sp. D21]
 gb|AEQ22166.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Acidaminococcus 
intestini RyC-MR95]
 emb|CDB97594.1| tRNA dimethylallyltransferase [Acidaminococcus intestini CAG:325]
Length=312

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 72/134 (54%), Gaps = 14/134 (10%)
 Frame = -1

Query  839  LQQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            + Q K+ +  +D +   LT +R  LY  I+ R + M+ E  G+  EAR   D G+ P  +
Sbjct  177  VSQEKDSESPFDAVVFGLTMERALLYDRINRRVDLMVEE--GLFDEARFFYDQGI-PLDS  233

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             + ++IGYRQ ++Y              D    +++ ++A+RNFAKRQ+TW++  P  HW
Sbjct  234  QSMKSIGYRQCVQYF---------RGEWDKKTAVAKIKQATRNFAKRQITWYKKMPYIHW  284

Query  479  --IDASRPMGSVLD  444
              +DAS    S+ D
Sbjct  285  LMLDASPHYPSIAD  298



>ref|WP_027322432.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
sp. URHB0009]
Length=321

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 74/147 (50%), Gaps = 19/147 (13%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q ++E +L YD   + LT +R  LY  I+ R   M+ E  G+L E   L   G+  +   
Sbjct  185  QSNQEPELLYDTALIGLTMEREKLYERINLRVGLMMEE--GLLEEVESLYHQGI--SGCQ  240

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + +AIGY++  EYL     +G SS        +   ++ SRN+AKRQLTWFRN+    W 
Sbjct  241  SIQAIGYKEIYEYL-----EGKSS----LETAVENLKQNSRNYAKRQLTWFRNKMNVEWF  291

Query  476  D------ASRPMGSVLDFIYDSYHSQS  414
            D      AS+ +  +  ++    H +S
Sbjct  292  DMTDTDMASKKINEISQYVEGKLHLKS  318



>gb|KIL80673.1| tRNA dimethylallyltransferase [Bacillus badius]
Length=306

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 70/144 (49%), Gaps = 19/144 (13%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q S+  +L YD   + LT  R  LY  I+ R + M+    G+L E + L D G+   S  
Sbjct  174  QSSQPNELLYDTALIGLTMDREMLYSRINERVDQMVAA--GLLEEVKTLWDKGI--RSGQ  229

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A +AIGY++   YL                A + + ++ SRN+AKRQLTWFRN+   +W 
Sbjct  230  AVQAIGYKELFSYL---------RGEETLEAAVEQLKQNSRNYAKRQLTWFRNKMDVNWF  280

Query  476  DAS----RP--MGSVLDFIYDSYH  423
            D S    RP  +  +  FI    H
Sbjct  281  DLSDEEKRPEKIKEISGFIAGKLH  304



>ref|WP_021870602.1| tRNA dimethylallyltransferase [Clostridium sp. CAG:7]
 emb|CCY42090.1| tRNA dimethylallyltransferase [Clostridium sp. CAG:7]
Length=277

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 70/129 (54%), Gaps = 12/129 (9%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            ++  +KD  Y+FL   LT  R  LY  ID R  D+++EN G++ E + L D+G      +
Sbjct  142  EEMHQKDSPYNFLYYVLTRDRKVLYERIDRRV-DIMMEN-GLVDEVKKLKDMGC-HRGQT  198

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            + + +GY++ ++YL      GG +     +      ++ +R+FAKRQLTWFR E    W+
Sbjct  199  SMQGLGYKEILDYL-----DGGCTLEEAVYIL----KRDTRHFAKRQLTWFRREKDVRWL  249

Query  476  DASRPMGSV  450
            D  +  G+ 
Sbjct  250  DLDQYQGNT  258



>ref|WP_009616762.1| tRNA dimethylallyltransferase [Desulfosporosinus sp. OT]
 gb|EGW40262.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Desulfosporosinus 
sp. OT]
Length=313

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 67/131 (51%), Gaps = 12/131 (9%)
 Frame = -1

Query  821  KDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAI  642
            + LD   + + LT  R  +Y  I+ RC  ML  + G++ E   LL++G  P      ++I
Sbjct  186  QPLDSSIVYIGLTASRDLIYERINQRCVAML--SQGLIEETLKLLNMGYAPTLKPL-QSI  242

Query  641  GYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRP  462
            GYR A+ YL     +G ++ P      L   Q+ +R+FAKRQLTWFR +P   W D    
Sbjct  243  GYRHALWYL-----KGLATQPE----MLRLLQRDTRHFAKRQLTWFRRDPRITWYDIETK  293

Query  461  MGSVLDFIYDS  429
            +  +L  I  +
Sbjct  294  LNDILKSIVQT  304



>ref|WP_041113123.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Bacillus 
badius]
Length=314

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 70/144 (49%), Gaps = 19/144 (13%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q S+  +L YD   + LT  R  LY  I+ R + M+    G+L E + L D G+   S  
Sbjct  182  QSSQPNELLYDTALIGLTMDREMLYSRINERVDQMV--AAGLLEEVKTLWDKGI--RSGQ  237

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A +AIGY++   YL                A + + ++ SRN+AKRQLTWFRN+   +W 
Sbjct  238  AVQAIGYKELFSYL---------RGEETLEAAVEQLKQNSRNYAKRQLTWFRNKMDVNWF  288

Query  476  DAS----RP--MGSVLDFIYDSYH  423
            D S    RP  +  +  FI    H
Sbjct  289  DLSDEEKRPEKIKEISGFIAGKLH  312



>ref|WP_040220801.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Collinsella 
sp. MS5]
Length=308

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 64/105 (61%), Gaps = 12/105 (11%)
 Frame = -1

Query  788  LTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQAMEYLLY  609
            L+  R +LYR ID R + M+    G++ E + LL++GL  +S +AS+AIGY++ ++YL  
Sbjct  195  LSMNREELYRRIDTRVDVMI--ELGLVDEVKHLLEMGLQRDS-TASQAIGYKEILQYL--  249

Query  608  CREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
                 G  S  +    +   ++ SR +AKRQL+WFR +  YHWI+
Sbjct  250  ----NGELSLDEAIELI---KRGSRRYAKRQLSWFRRDTRYHWIE  287



>ref|WP_022387376.1| tRNA dimethylallyltransferase [Collinsella sp. CAG:289]
 emb|CDD86794.1| tRNA dimethylallyltransferase [Collinsella sp. CAG:289]
Length=313

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 64/105 (61%), Gaps = 12/105 (11%)
 Frame = -1

Query  788  LTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQAMEYLLY  609
            L+  R +LYR ID R + M+    G++ E + LL++GL  +S +AS+AIGY++ ++YL  
Sbjct  200  LSMNREELYRRIDTRVDVMI--ELGLVDEVKHLLEMGLQRDS-TASQAIGYKEILQYL--  254

Query  608  CREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWID  474
                 G  S  +    +   ++ SR +AKRQL+WFR +  YHWI+
Sbjct  255  ----NGELSLDEAIELI---KRGSRRYAKRQLSWFRRDTRYHWIE  292



>ref|WP_004165698.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Pediococcus 
acidilactici]
 gb|EFL96133.1| tRNA dimethylallyltransferase [Pediococcus acidilactici DSM 20284]
Length=305

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 69/122 (57%), Gaps = 15/122 (12%)
 Frame = -1

Query  836  QQSKEK-DLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            +Q+K + +L YD   + L T+R  LY  I+ R E ML +  G+ +EAR L      P + 
Sbjct  177  EQTKSRGELAYDAFLIGLNTERAKLYERINQRVEIMLEQ--GLEAEARWLFKQ---PEAP  231

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             A + IGYR+   Y  +  EQ  S++       +++ QK SR++AKRQLTWFRN+   +W
Sbjct  232  QAVKGIGYREWPAY--FAGEQPYSTT-------VAQIQKDSRHYAKRQLTWFRNQMDVNW  282

Query  479  ID  474
             D
Sbjct  283  FD  284



>ref|WP_025021832.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Lactobacillus 
hayakitensis]
Length=310

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 70/121 (58%), Gaps = 13/121 (11%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            +Q+ +K  ++D L + LTT R  LY  I+ R  D+++EN G+L EA+ L + G +    S
Sbjct  182  EQNDQKTSEFDPLIIGLTTDRALLYERINQRV-DIMIEN-GLLDEAKYLFEKGNM--ELS  237

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A++ IGY++  EY        G  S  D  A +   ++ SR +AKRQLTWFRN+   +W 
Sbjct  238  AAKGIGYKEFYEYF------EGKISLDDAIALV---KRNSRRYAKRQLTWFRNKMDVNWF  288

Query  476  D  474
            D
Sbjct  289  D  289



>ref|WP_015739879.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ammonifex 
degensii]
 gb|ACX53002.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Ammonifex 
degensii KC4]
Length=315

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 67/124 (54%), Gaps = 12/124 (10%)
 Frame = -1

Query  827  KEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASR  648
            K++   YD L   L   R +LYR I+ R + ML    G++ E R LL+ G+ P + S  +
Sbjct  182  KKEPPPYDVLMFGLNLAREELYRRIEQRVDAML--AAGLVEEVRRLLEQGVPPQATSM-Q  238

Query  647  AIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDAS  468
             +GY++   YL     +G  S  R  +      ++ +R FAKRQLTWFR++P   W+D +
Sbjct  239  GLGYKEIAAYL-----RGEISLERAVYLI----KRNTRRFAKRQLTWFRHDPRIRWLDVA  289

Query  467  RPMG  456
            +  G
Sbjct  290  QYKG  293



>ref|WP_008879547.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
sp. G11MC16]
 gb|EDY07081.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
sp. G11MC16]
Length=315

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 67/125 (54%), Gaps = 13/125 (10%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q+ +++ L Y+   + LT +R  LYR I+ R ++M+ E  G++ E R L D GL      
Sbjct  180  QRGQQRQLLYETALIGLTAERRVLYRRINERVDEMIAE--GLIEEVRSLYDRGL--RDCQ  235

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A +AIGY++  +Y        G  S       + + ++ SR +AKRQLTWFRN+    W 
Sbjct  236  AVQAIGYKELYDYF------DGRVS---LDEAIEQLKQNSRRYAKRQLTWFRNQMPVEWF  286

Query  476  DASRP  462
            D + P
Sbjct  287  DMTDP  291



>ref|WP_011887177.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
thermodenitrificans]
 sp|A4IMI5.1|MIAA_GEOTN RecName: Full=tRNA dimethylallyltransferase; AltName: Full=Dimethylallyl 
diphosphate:tRNA dimethylallyltransferase; Short=DMAPP:tRNA 
dimethylallyltransferase; Short=DMATase; AltName: 
Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase; 
Short=IPP transferase; Short=IPPT; Short=IPTase [Geobacillus 
thermodenitrificans NG80-2]
 gb|ABO66539.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
thermodenitrificans NG80-2]
Length=315

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 67/125 (54%), Gaps = 13/125 (10%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q+ +++ L Y+   + LT +R  LYR I+ R ++M+ E  G++ E R L D GL      
Sbjct  180  QRGQQRQLLYETALIGLTAERSVLYRRINERVDEMIAE--GLIEEVRSLYDRGL--RDCQ  235

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A +AIGY++  +Y        G  S       + + ++ SR +AKRQLTWFRN+    W 
Sbjct  236  AVQAIGYKELYDYF------DGRVS---LDEAIEQLKQNSRRYAKRQLTWFRNQMPVEWF  286

Query  476  DASRP  462
            D + P
Sbjct  287  DMTDP  291



>ref|WP_005916569.1| tRNA dimethylallyltransferase, miaA [Pediococcus acidilactici]
 gb|EOA09170.1| tRNA dimethylallyltransferase, miaA [Pediococcus acidilactici 
D3]
Length=305

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 69/122 (57%), Gaps = 15/122 (12%)
 Frame = -1

Query  836  QQSKEK-DLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSN  660
            +Q+K + +L YD   + L T+R  LY  I+ R E ML +  G+ +EAR L     +P   
Sbjct  177  EQTKSRGELAYDAFLIGLNTERAKLYERINQRVEIMLEQ--GLEAEARWLFKQPEVP---  231

Query  659  SASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHW  480
             A + IGYR+   Y  +  EQ  S++       +++ QK SR++AKRQLTWFRN+   +W
Sbjct  232  QAVKGIGYREWPAY--FAGEQTYSTT-------VAQIQKDSRHYAKRQLTWFRNQMDVNW  282

Query  479  ID  474
             D
Sbjct  283  FD  284



>ref|WP_029760505.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Geobacillus 
thermodenitrificans]
Length=315

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 67/125 (54%), Gaps = 13/125 (10%)
 Frame = -1

Query  836  QQSKEKDLDYDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNS  657
            Q+ +++ L Y+   + LT +R  LYR I+ R ++M+ E  G++ E R L D GL      
Sbjct  180  QRGQQRQLLYETALIGLTAERSVLYRRINERVDEMIAE--GLIEEVRSLYDRGL--RDCQ  235

Query  656  ASRAIGYRQAMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWI  477
            A +AIGY++  +Y        G  S       + + ++ SR +AKRQLTWFRN+    W 
Sbjct  236  AVQAIGYKELYDYF------DGRVS---LDEAIEQLKQNSRRYAKRQLTWFRNQMPVEWF  286

Query  476  DASRP  462
            D + P
Sbjct  287  DMTDP  291



>ref|WP_007786918.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
sp. CF112]
 gb|EJL39430.1| tRNA isopentenyltransferase MiaA [Brevibacillus sp. CF112]
Length=319

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 63/118 (53%), Gaps = 12/118 (10%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YD + + LT +R  LY  I+ R E M+    G++ E RGLLD G    S  + + +GY++
Sbjct  192  YDLVMIGLTMERAVLYERINRRVELMI--EAGLVEEVRGLLDKGY-DASMVSMQGLGYKE  248

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRPMG  456
             + YL       G  +       +++ Q+ +R+FAKRQL+WFR  P   W D + P G
Sbjct  249  LIPYLY------GEIT---LEKAINDIQQRTRHFAKRQLSWFRRIPEVQWFDMTDPAG  297



>ref|WP_025846031.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Brevibacillus 
agri]
Length=319

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 63/118 (53%), Gaps = 12/118 (10%)
 Frame = -1

Query  809  YDFLCVFLTTQRLDLYRSIDFRCEDMLLENYGVLSEARGLLDLGLLPNSNSASRAIGYRQ  630
            YD + + LT +R  LY  I+ R E M+    G++ E RGLLD G    S  + + +GY++
Sbjct  192  YDLVMIGLTMERAVLYERINRRVELMI--EAGLVEEVRGLLDKGY-DASMVSMQGLGYKE  248

Query  629  AMEYLLYCREQGGSSSPRDFFAFLSEFQKASRNFAKRQLTWFRNEPLYHWIDASRPMG  456
             + YL       G  +       +++ Q+ +R+FAKRQL+WFR  P   W D + P G
Sbjct  249  LIPYLY------GEIT---LEKAINDIQQRTRHFAKRQLSWFRRIPEVQWFDMTDPAG  297



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1916371272000