BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038G05

Length=944
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786426.1|  PREDICTED: uncharacterized protein LOC104234...    397   7e-129   Nicotiana sylvestris
ref|XP_009628236.1|  PREDICTED: uncharacterized protein LOC104118...    391   8e-127   Nicotiana tomentosiformis
ref|XP_006341679.1|  PREDICTED: uncharacterized protein LOC102589286    383   2e-123   Solanum tuberosum [potatoes]
ref|XP_004235711.1|  PREDICTED: uncharacterized protein LOC101250783    381   1e-122   Solanum lycopersicum
ref|XP_011072341.1|  PREDICTED: uncharacterized protein LOC105157620    341   2e-107   Sesamum indicum [beniseed]
ref|XP_002304191.2|  hypothetical protein POPTR_0003s05360g             318   1e-104   
ref|XP_002279674.1|  PREDICTED: uncharacterized protein LOC100241173    328   7e-103   Vitis vinifera
emb|CDO98057.1|  unnamed protein product                                328   1e-102   Coffea canephora [robusta coffee]
ref|XP_010545713.1|  PREDICTED: uncharacterized protein LOC104817994    325   3e-100   Tarenaya hassleriana [spider flower]
gb|KHN32609.1|  hypothetical protein glysoja_022291                     320   3e-100   Glycine soja [wild soybean]
ref|XP_003542101.1|  PREDICTED: uncharacterized protein LOC100791852    320   4e-99    Glycine max [soybeans]
ref|XP_002299694.2|  hypothetical protein POPTR_0001s18130g             318   4e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010098052.1|  hypothetical protein L484_026183                   319   7e-99    Morus notabilis
gb|KHG04451.1|  Monodehydroascorbate reductase, fruit isozyme           318   1e-98    Gossypium arboreum [tree cotton]
gb|AAK96499.1|  At1g52320/F19K6_7                                       305   1e-97    Arabidopsis thaliana [mouse-ear cress]
gb|EYU21542.1|  hypothetical protein MIMGU_mgv1a001881mg                315   3e-97    Erythranthe guttata [common monkey flower]
ref|XP_011001614.1|  PREDICTED: uncharacterized protein LOC105108845    313   3e-97    Populus euphratica
ref|XP_006465528.1|  PREDICTED: uncharacterized protein LOC102613887    313   7e-97    Citrus sinensis [apfelsine]
ref|NP_001117469.1|  uncharacterized protein                            306   8e-97    Arabidopsis thaliana [mouse-ear cress]
gb|KHM98761.1|  hypothetical protein glysoja_030814                     310   2e-96    Glycine soja [wild soybean]
ref|XP_006427010.1|  hypothetical protein CICLE_v10024988mg             311   3e-96    Citrus clementina [clementine]
ref|XP_011026550.1|  PREDICTED: uncharacterized protein LOC105127120    311   7e-96    Populus euphratica
gb|KHN10238.1|  hypothetical protein glysoja_017842                     305   1e-95    Glycine soja [wild soybean]
ref|XP_004305292.1|  PREDICTED: uncharacterized protein LOC101294200    310   1e-95    Fragaria vesca subsp. vesca
ref|XP_004486732.1|  PREDICTED: uncharacterized protein LOC101506...    310   2e-95    Cicer arietinum [garbanzo]
ref|XP_006392932.1|  hypothetical protein EUTSA_v10011250mg             310   6e-95    Eutrema salsugineum [saltwater cress]
gb|KDO51231.1|  hypothetical protein CISIN_1g044677mg                   293   7e-95    Citrus sinensis [apfelsine]
gb|KFK35788.1|  hypothetical protein AALP_AA4G036700                    310   8e-95    Arabis alpina [alpine rockcress]
emb|CDY52975.1|  BnaA06g01600D                                          307   2e-94    Brassica napus [oilseed rape]
ref|XP_003603595.1|  hypothetical protein MTR_3g109450                  306   3e-94    Medicago truncatula
ref|XP_009147692.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    308   4e-94    Brassica rapa
ref|XP_003523728.1|  PREDICTED: formin-like protein 8-like              305   5e-94    Glycine max [soybeans]
ref|XP_002308623.2|  hypothetical protein POPTR_0006s26050g             306   9e-94    Populus trichocarpa [western balsam poplar]
ref|XP_007150659.1|  hypothetical protein PHAVU_005G170800g             305   1e-93    Phaseolus vulgaris [French bean]
ref|XP_007012028.1|  Golgin subfamily A member 4                        305   1e-93    
ref|XP_002324252.2|  hypothetical protein POPTR_0018s00880g             305   2e-93    Populus trichocarpa [western balsam poplar]
ref|XP_010462070.1|  PREDICTED: uncharacterized protein LOC104742736    306   2e-93    Camelina sativa [gold-of-pleasure]
emb|CDY61085.1|  BnaC06g41130D                                          305   2e-93    Brassica napus [oilseed rape]
gb|KHN18210.1|  hypothetical protein glysoja_025100                     301   4e-93    Glycine soja [wild soybean]
dbj|BAF00450.1|  putative bZIP protein                                  305   5e-93    Arabidopsis thaliana [mouse-ear cress]
ref|NP_849796.2|  uncharacterized protein                               305   5e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891687.1|  hypothetical protein ARALYDRAFT_474348             304   8e-93    
ref|XP_011007598.1|  PREDICTED: uncharacterized protein LOC105113217    301   9e-93    Populus euphratica
ref|XP_002516584.1|  conserved hypothetical protein                     302   1e-92    Ricinus communis
ref|XP_002281782.1|  PREDICTED: uncharacterized protein LOC100259547    301   1e-92    Vitis vinifera
ref|XP_011019684.1|  PREDICTED: uncharacterized protein LOC105122326    303   1e-92    Populus euphratica
ref|XP_003527819.1|  PREDICTED: uncharacterized protein LOC100807597    301   2e-92    Glycine max [soybeans]
ref|XP_010500831.1|  PREDICTED: uncharacterized protein LOC104778154    303   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_010479738.1|  PREDICTED: kinesin-related protein 4-like          303   3e-92    Camelina sativa [gold-of-pleasure]
gb|KJB54879.1|  hypothetical protein B456_009G052500                    301   3e-92    Gossypium raimondii
ref|XP_008362707.1|  PREDICTED: uncharacterized protein LOC103426...    300   5e-92    
ref|XP_003597769.1|  hypothetical protein MTR_2g102050                  301   6e-92    Medicago truncatula
ref|XP_008362706.1|  PREDICTED: uncharacterized protein LOC103426...    300   9e-92    
ref|XP_007024146.1|  Uncharacterized protein isoform 1                  300   1e-91    
ref|XP_007137162.1|  hypothetical protein PHAVU_009G105100g             298   2e-91    Phaseolus vulgaris [French bean]
ref|XP_010251918.1|  PREDICTED: uncharacterized protein LOC104593650    299   2e-91    Nelumbo nucifera [Indian lotus]
ref|XP_010942485.1|  PREDICTED: uncharacterized protein LOC105060463    298   3e-91    
ref|XP_006306796.1|  hypothetical protein CARUB_v10008333mg             299   8e-91    Capsella rubella
ref|XP_004292865.1|  PREDICTED: uncharacterized protein LOC101308445    297   9e-91    Fragaria vesca subsp. vesca
ref|XP_008447501.1|  PREDICTED: uncharacterized protein LOC103489933    297   1e-90    Cucumis melo [Oriental melon]
gb|KJB13152.1|  hypothetical protein B456_002G059600                    295   7e-90    Gossypium raimondii
ref|XP_004150356.1|  PREDICTED: uncharacterized protein LOC101203914    295   7e-90    Cucumis sativus [cucumbers]
ref|XP_004172478.1|  PREDICTED: uncharacterized protein LOC101231290    294   9e-90    
gb|KJB65700.1|  hypothetical protein B456_010G109200                    293   2e-89    Gossypium raimondii
ref|XP_010938806.1|  PREDICTED: uncharacterized protein LOC105057803    291   3e-89    
gb|KDP34224.1|  hypothetical protein JCGZ_07795                         293   4e-89    Jatropha curcas
ref|XP_006356661.1|  PREDICTED: uncharacterized protein LOC102596799    292   6e-89    
ref|XP_007024149.1|  Uncharacterized protein isoform 4                  293   7e-89    
ref|XP_004150357.1|  PREDICTED: uncharacterized protein LOC101204163    291   7e-89    
ref|XP_004169923.1|  PREDICTED: uncharacterized LOC101204163            291   1e-88    
gb|KGN58062.1|  hypothetical protein Csa_3G481220                       292   1e-88    Cucumis sativus [cucumbers]
ref|XP_009383699.1|  PREDICTED: uncharacterized protein LOC103971407    292   1e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007225191.1|  hypothetical protein PRUPE_ppa002131mg             290   3e-88    Prunus persica
ref|XP_004245249.1|  PREDICTED: uncharacterized protein LOC101255018    290   4e-88    Solanum lycopersicum
ref|XP_009799127.1|  PREDICTED: uncharacterized protein LOC104245243    290   5e-88    Nicotiana sylvestris
emb|CBI36151.3|  unnamed protein product                                285   7e-88    Vitis vinifera
ref|XP_010049074.1|  PREDICTED: uncharacterized protein LOC104437750    288   7e-88    
ref|XP_008220000.1|  PREDICTED: uncharacterized protein LOC103320143    288   1e-87    Prunus mume [ume]
ref|XP_008462152.1|  PREDICTED: uncharacterized protein LOC103500575    288   2e-87    Cucumis melo [Oriental melon]
ref|XP_009338711.1|  PREDICTED: uncharacterized protein LOC103931028    287   4e-87    Pyrus x bretschneideri [bai li]
ref|XP_004141776.1|  PREDICTED: uncharacterized protein LOC101222402    287   4e-87    Cucumis sativus [cucumbers]
ref|XP_009368022.1|  PREDICTED: uncharacterized protein LOC103957563    287   5e-87    Pyrus x bretschneideri [bai li]
gb|KCW81524.1|  hypothetical protein EUGRSUZ_C02885                     288   5e-87    Eucalyptus grandis [rose gum]
ref|XP_008228519.1|  PREDICTED: uncharacterized protein LOC103327921    281   1e-86    Prunus mume [ume]
ref|XP_009616206.1|  PREDICTED: uncharacterized protein LOC104108786    286   1e-86    Nicotiana tomentosiformis
emb|CDX88193.1|  BnaA06g27840D                                          286   2e-86    
ref|XP_010691307.1|  PREDICTED: uncharacterized protein LOC104904665    287   2e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004501198.1|  PREDICTED: uncharacterized protein LOC101510604    285   2e-86    
ref|XP_009151092.1|  PREDICTED: uncharacterized protein LOC103874418    286   2e-86    Brassica rapa
ref|XP_008378117.1|  PREDICTED: uncharacterized protein LOC103441188    285   4e-86    
ref|XP_010667633.1|  PREDICTED: uncharacterized protein LOC104884...    284   7e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002516075.1|  conserved hypothetical protein                     284   9e-86    Ricinus communis
ref|XP_008393906.1|  PREDICTED: uncharacterized protein LOC103456054    283   2e-85    
ref|XP_010112163.1|  hypothetical protein L484_019902                   285   3e-85    
emb|CDP18480.1|  unnamed protein product                                281   7e-85    Coffea canephora [robusta coffee]
ref|XP_008776462.1|  PREDICTED: uncharacterized protein LOC103696569    272   8e-85    
ref|XP_009345256.1|  PREDICTED: uncharacterized protein LOC103937065    281   1e-84    
ref|XP_011089542.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    279   7e-84    
ref|XP_008775372.1|  PREDICTED: uncharacterized protein LOC103695745    274   1e-83    Phoenix dactylifera
ref|XP_008447502.1|  PREDICTED: uncharacterized protein LOC103489935    278   2e-83    Cucumis melo [Oriental melon]
gb|KDP37214.1|  hypothetical protein JCGZ_06270                         278   2e-83    Jatropha curcas
gb|KDO79698.1|  hypothetical protein CISIN_1g004600mg                   278   2e-83    Citrus sinensis [apfelsine]
ref|XP_006476157.1|  PREDICTED: myosin-9-like                           278   2e-83    Citrus sinensis [apfelsine]
ref|XP_006450611.1|  hypothetical protein CICLE_v10007564mg             278   2e-83    Citrus clementina [clementine]
ref|XP_008799874.1|  PREDICTED: uncharacterized protein LOC103714416    273   3e-83    Phoenix dactylifera
emb|CAN72109.1|  hypothetical protein VITISV_044047                     277   4e-83    Vitis vinifera
gb|EPS57690.1|  hypothetical protein M569_17127                         263   5e-83    Genlisea aurea
ref|XP_008342705.1|  PREDICTED: uncharacterized protein LOC103405477    277   6e-83    
emb|CDX80528.1|  BnaC07g29160D                                          276   1e-82    
ref|XP_010907260.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    275   2e-82    
ref|XP_010931963.1|  PREDICTED: uncharacterized protein LOC105052734    272   3e-81    Elaeis guineensis
emb|CDX87081.1|  BnaC09g03960D                                          267   4e-81    
ref|XP_008808244.1|  PREDICTED: uncharacterized protein LOC103720359    270   2e-80    Phoenix dactylifera
ref|XP_010519919.1|  PREDICTED: uncharacterized protein LOC104799211    268   2e-79    Tarenaya hassleriana [spider flower]
gb|EMT28812.1|  hypothetical protein F775_16807                         254   4e-77    
gb|KFK27812.1|  hypothetical protein AALP_AA8G433100                    257   2e-75    Arabis alpina [alpine rockcress]
gb|EMS56206.1|  hypothetical protein TRIUR3_11325                       251   2e-75    Triticum urartu
ref|XP_006658396.1|  PREDICTED: uncharacterized protein LOC102701368    249   2e-75    
gb|EYU29268.1|  hypothetical protein MIMGU_mgv1a002196mg                255   5e-75    Erythranthe guttata [common monkey flower]
ref|XP_006655291.1|  PREDICTED: uncharacterized protein LOC102706661    251   6e-75    
ref|XP_009393120.1|  PREDICTED: uncharacterized protein LOC103978894    248   7e-73    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE63626.1|  hypothetical protein OsJ_18443                          248   8e-73    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ96225.1|  predicted protein                                      249   8e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT20964.1|  hypothetical protein F775_31339                         236   2e-72    
ref|XP_002874269.1|  hypothetical protein ARALYDRAFT_910621             249   2e-72    
ref|XP_006394813.1|  hypothetical protein EUTSA_v10003682mg             249   2e-72    Eutrema salsugineum [saltwater cress]
gb|EEC79170.1|  hypothetical protein OsI_19854                          247   3e-72    Oryza sativa Indica Group [Indian rice]
ref|NP_197941.1|  uncharacterized protein                               249   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010228227.1|  PREDICTED: formin-like protein 5                   248   4e-72    
gb|EMS63249.1|  hypothetical protein TRIUR3_24469                       235   5e-72    Triticum urartu
gb|AAT93897.1|  unknown protein                                         248   1e-71    Oryza sativa Japonica Group [Japonica rice]
gb|EEE66795.1|  hypothetical protein OsJ_23540                          243   1e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006287097.1|  hypothetical protein CARUB_v10000261mg             247   2e-71    Capsella rubella
ref|XP_010421422.1|  PREDICTED: DNA ligase 1-like isoform X3            246   3e-71    Camelina sativa [gold-of-pleasure]
ref|XP_010421421.1|  PREDICTED: DNA ligase 1-like isoform X2            246   3e-71    Camelina sativa [gold-of-pleasure]
ref|XP_010421420.1|  PREDICTED: DNA ligase 1-like isoform X1            246   4e-71    Camelina sativa [gold-of-pleasure]
gb|EAZ03209.1|  hypothetical protein OsI_25359                          243   4e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_006826988.1|  hypothetical protein AMTR_s00010p00207960          244   5e-71    Amborella trichopoda
ref|XP_010454904.1|  PREDICTED: ABC transporter F family member 4...    245   1e-70    Camelina sativa [gold-of-pleasure]
ref|XP_010493822.1|  PREDICTED: DNA ligase 1-like                       245   1e-70    Camelina sativa [gold-of-pleasure]
emb|CDM83169.1|  unnamed protein product                                237   1e-70    Triticum aestivum [Canadian hard winter wheat]
dbj|BAC16409.1|  putative bZIP protein                                  243   4e-70    Oryza sativa Japonica Group [Japonica rice]
gb|EMT10854.1|  hypothetical protein F775_26145                         240   7e-70    
dbj|BAJ96409.1|  predicted protein                                      242   1e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002457866.1|  hypothetical protein SORBIDRAFT_03g017350          227   6e-69    
gb|EMS61963.1|  hypothetical protein TRIUR3_31953                       238   6e-69    Triticum urartu
ref|XP_010254134.1|  PREDICTED: uncharacterized protein LOC104595215    238   1e-68    Nelumbo nucifera [Indian lotus]
ref|XP_010033880.1|  PREDICTED: uncharacterized protein LOC104423116    238   2e-68    Eucalyptus grandis [rose gum]
ref|XP_003568507.1|  PREDICTED: ras and Rab interactor 3                238   4e-68    Brachypodium distachyon [annual false brome]
emb|CDM82883.1|  unnamed protein product                                238   6e-68    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002439756.1|  hypothetical protein SORBIDRAFT_09g019490          235   6e-67    
dbj|BAJ94711.1|  predicted protein                                      234   1e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010249763.1|  PREDICTED: uncharacterized protein LOC104592...    229   1e-65    
ref|NP_001168451.1|  uncharacterized protein LOC100382224               229   2e-65    Zea mays [maize]
ref|XP_010249762.1|  PREDICTED: uncharacterized protein LOC104592...    229   2e-65    Nelumbo nucifera [Indian lotus]
ref|NP_001169630.1|  hypothetical protein                               230   3e-65    Zea mays [maize]
ref|XP_010667640.1|  PREDICTED: uncharacterized protein LOC104884...    228   4e-65    
gb|AFW82165.1|  hypothetical protein ZEAMMB73_214762                    229   4e-65    
emb|CBI20923.3|  unnamed protein product                                222   5e-65    Vitis vinifera
ref|NP_001172370.1|  Os01g0500550                                       228   9e-65    
gb|EEC70709.1|  hypothetical protein OsI_02082                          228   1e-64    Oryza sativa Indica Group [Indian rice]
gb|EPS58005.1|  hypothetical protein M569_16812                         216   2e-64    Genlisea aurea
ref|XP_004506851.1|  PREDICTED: uncharacterized protein LOC101489547    221   2e-63    Cicer arietinum [garbanzo]
ref|XP_003567735.1|  PREDICTED: uncharacterized protein LOC100824905    223   7e-63    Brachypodium distachyon [annual false brome]
ref|XP_008652191.1|  PREDICTED: uncharacterized protein LOC103632124    221   2e-62    Zea mays [maize]
ref|XP_004968820.1|  PREDICTED: uncharacterized protein LOC101757982    221   5e-62    Setaria italica
ref|XP_004955806.1|  PREDICTED: uncharacterized protein LOC101763037    219   2e-61    
ref|XP_006644200.1|  PREDICTED: uncharacterized protein LOC102708565    219   3e-61    
ref|XP_002461680.1|  hypothetical protein SORBIDRAFT_02g006420          217   9e-61    Sorghum bicolor [broomcorn]
ref|XP_009398982.1|  PREDICTED: uncharacterized protein LOC103983491    217   9e-61    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003604444.1|  hypothetical protein MTR_4g012430                  192   6e-53    
ref|XP_010479739.1|  PREDICTED: uncharacterized protein LOC104758551    194   1e-52    Camelina sativa [gold-of-pleasure]
gb|ABR18011.1|  unknown                                                 189   7e-51    Picea sitchensis
gb|AES86641.2|  BZIP protein                                            182   3e-49    Medicago truncatula
ref|XP_008352156.1|  PREDICTED: uncharacterized protein LOC103415623    174   5e-47    
ref|XP_009786427.1|  PREDICTED: uncharacterized protein LOC104234...    174   1e-45    Nicotiana sylvestris
ref|XP_009628246.1|  PREDICTED: uncharacterized protein LOC104118...    166   6e-43    
gb|ABK95129.1|  unknown                                                 124   7e-31    Populus trichocarpa [western balsam poplar]
ref|XP_007134473.1|  hypothetical protein PHAVU_010G050100g             133   8e-31    Phaseolus vulgaris [French bean]
ref|XP_009391172.1|  PREDICTED: ras and EF-hand domain-containing...    133   8e-31    
gb|KHN00204.1|  hypothetical protein glysoja_034735                     130   1e-30    Glycine soja [wild soybean]
ref|XP_010941314.1|  PREDICTED: uncharacterized protein LOC105059637    130   2e-30    Elaeis guineensis
ref|XP_011093240.1|  PREDICTED: uncharacterized protein LOC105173250    131   3e-30    Sesamum indicum [beniseed]
ref|XP_004166130.1|  PREDICTED: uncharacterized LOC101224117            124   9e-30    
ref|XP_006576720.1|  PREDICTED: uncharacterized protein LOC100792843    130   1e-29    Glycine max [soybeans]
gb|EYU30808.1|  hypothetical protein MIMGU_mgv1a0195871mg               124   1e-29    Erythranthe guttata [common monkey flower]
ref|XP_011099873.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    127   5e-29    
ref|XP_010113322.1|  hypothetical protein L484_026653                   127   6e-29    Morus notabilis
ref|XP_004492935.1|  PREDICTED: uncharacterized protein LOC101510124    127   8e-29    Cicer arietinum [garbanzo]
ref|XP_010935104.1|  PREDICTED: uncharacterized protein LOC105055091    125   8e-29    
ref|XP_007139641.1|  hypothetical protein PHAVU_008G046800g             127   1e-28    Phaseolus vulgaris [French bean]
ref|XP_007204230.1|  hypothetical protein PRUPE_ppa002657mg             125   1e-28    
gb|KJB22870.1|  hypothetical protein B456_004G070400                    125   3e-28    Gossypium raimondii
ref|NP_171713.2|  uncharacterized protein                               125   3e-28    Arabidopsis thaliana [mouse-ear cress]
gb|KHN40553.1|  hypothetical protein glysoja_001051                     120   3e-28    Glycine soja [wild soybean]
ref|XP_008459782.1|  PREDICTED: uncharacterized protein LOC103498813    125   3e-28    Cucumis melo [Oriental melon]
ref|XP_010919721.1|  PREDICTED: uncharacterized protein LOC105043738    125   3e-28    Elaeis guineensis
ref|XP_010679893.1|  PREDICTED: uncharacterized protein LOC104895159    124   4e-28    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006464424.1|  PREDICTED: uncharacterized protein LOC102627291    125   4e-28    
ref|XP_010089322.1|  hypothetical protein L484_021854                   125   4e-28    
gb|KDO85511.1|  hypothetical protein CISIN_1g040600mg                   125   4e-28    Citrus sinensis [apfelsine]
ref|XP_006445430.1|  hypothetical protein CICLE_v10018930mg             125   5e-28    Citrus clementina [clementine]
ref|XP_006306896.1|  hypothetical protein CARUB_v10008455mg             124   5e-28    
gb|KEH23438.1|  BZIP transcription factor bZIP80                        124   7e-28    Medicago truncatula
ref|XP_006466986.1|  PREDICTED: uncharacterized protein LOC102630487    123   7e-28    Citrus sinensis [apfelsine]
ref|XP_006837374.1|  hypothetical protein AMTR_s00111p00120840          124   7e-28    
ref|XP_008365863.1|  PREDICTED: uncharacterized protein LOC103429493    124   8e-28    
ref|XP_006425413.1|  hypothetical protein CICLE_v10025182mg             123   8e-28    Citrus clementina [clementine]
ref|XP_010258777.1|  PREDICTED: uncharacterized protein LOC104598423    124   9e-28    Nelumbo nucifera [Indian lotus]
ref|XP_002511585.1|  conserved hypothetical protein                     124   9e-28    Ricinus communis
ref|XP_004515356.1|  PREDICTED: uncharacterized protein LOC101490151    124   1e-27    Cicer arietinum [garbanzo]
ref|XP_011089387.1|  PREDICTED: uncharacterized protein LOC105170351    124   1e-27    Sesamum indicum [beniseed]
gb|KDP28858.1|  hypothetical protein JCGZ_14629                         124   1e-27    Jatropha curcas
gb|KGN46505.1|  hypothetical protein Csa_6G104620                       124   1e-27    Cucumis sativus [cucumbers]
ref|NP_001190052.1|  protein ALTERED PHOSPHATE STARVATION RESPONSE 1    123   1e-27    Arabidopsis thaliana [mouse-ear cress]
emb|CDP09433.1|  unnamed protein product                                124   1e-27    Coffea canephora [robusta coffee]
ref|XP_011008835.1|  PREDICTED: uncharacterized protein LOC105114109    122   2e-27    Populus euphratica
ref|XP_010426683.1|  PREDICTED: uncharacterized protein LOC104711...    122   2e-27    Camelina sativa [gold-of-pleasure]
ref|XP_010426682.1|  PREDICTED: uncharacterized protein LOC104711...    122   2e-27    Camelina sativa [gold-of-pleasure]
ref|XP_010503820.1|  PREDICTED: uncharacterized protein LOC104780964    122   2e-27    Camelina sativa [gold-of-pleasure]
ref|XP_010515532.1|  PREDICTED: uncharacterized protein LOC104791366    122   2e-27    Camelina sativa [gold-of-pleasure]
ref|XP_002529641.1|  conserved hypothetical protein                     122   2e-27    Ricinus communis
gb|EPS68751.1|  hypothetical protein M569_06016                         123   2e-27    Genlisea aurea
emb|CDX73734.1|  BnaC08g22690D                                          122   3e-27    
ref|XP_009383946.1|  PREDICTED: uncharacterized protein LOC103971612    122   3e-27    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006856770.1|  hypothetical protein AMTR_s00055p00070380          122   3e-27    
ref|XP_009379364.1|  PREDICTED: uncharacterized protein LOC103967785    121   4e-27    Pyrus x bretschneideri [bai li]
ref|XP_009115808.1|  PREDICTED: uncharacterized protein LOC103841050    121   5e-27    Brassica rapa
ref|XP_008352431.1|  PREDICTED: uncharacterized protein LOC103415926    121   5e-27    
ref|XP_007052313.1|  BZIP domain class transcription factor             122   5e-27    
ref|XP_006380598.1|  proline-rich family protein                        121   5e-27    
gb|ABI34654.1|  bZIP transcription factor bZIP80                        119   5e-27    Glycine max [soybeans]
gb|KFK42583.1|  hypothetical protein AALP_AA1G014300                    121   5e-27    Arabis alpina [alpine rockcress]
ref|XP_006290733.1|  hypothetical protein CARUB_v10016827mg             121   6e-27    Capsella rubella
gb|KEH17841.1|  BZIP transcription factor bZIP80, putative              121   6e-27    Medicago truncatula
ref|XP_008813601.1|  PREDICTED: uncharacterized protein LOC103724193    121   6e-27    Phoenix dactylifera
gb|KFK34370.1|  hypothetical protein AALP_AA5G136500                    120   7e-27    Arabis alpina [alpine rockcress]
ref|XP_011032057.1|  PREDICTED: uncharacterized protein LOC105131006    121   7e-27    Populus euphratica
ref|XP_002467482.1|  hypothetical protein SORBIDRAFT_01g028920          121   9e-27    Sorghum bicolor [broomcorn]
ref|XP_008643472.1|  PREDICTED: uncharacterized protein LOC100381...    121   9e-27    Zea mays [maize]
ref|NP_001065395.1|  Os10g0562700                                       121   9e-27    
ref|XP_008370338.1|  PREDICTED: uncharacterized protein LOC103433829    120   1e-26    
ref|XP_009363473.1|  PREDICTED: uncharacterized protein LOC103953463    120   1e-26    Pyrus x bretschneideri [bai li]
gb|EAY79532.1|  hypothetical protein OsI_34661                          121   1e-26    Oryza sativa Indica Group [Indian rice]
ref|XP_006660902.1|  PREDICTED: uncharacterized protein LOC102703332    118   1e-26    
ref|XP_009373242.1|  PREDICTED: uncharacterized protein LOC103962279    118   1e-26    Pyrus x bretschneideri [bai li]
ref|XP_006403933.1|  hypothetical protein EUTSA_v10010132mg             120   1e-26    
ref|XP_008808616.1|  PREDICTED: uncharacterized protein LOC103720605    119   1e-26    Phoenix dactylifera
ref|XP_010275436.1|  PREDICTED: uncharacterized protein LOC104610494    120   1e-26    Nelumbo nucifera [Indian lotus]
ref|XP_002892025.1|  proline-rich family protein                        120   1e-26    
ref|XP_006402594.1|  hypothetical protein EUTSA_v10005793mg             120   2e-26    
ref|XP_009398490.1|  PREDICTED: uncharacterized protein LOC103983...    120   2e-26    
ref|XP_009398488.1|  PREDICTED: uncharacterized protein LOC103983...    120   2e-26    
gb|EMT24541.1|  hypothetical protein F775_19967                         119   2e-26    
gb|KDP24001.1|  hypothetical protein JCGZ_25389                         119   3e-26    Jatropha curcas
ref|XP_008377795.1|  PREDICTED: uncharacterized protein LOC103440873    115   3e-26    
gb|KFK35242.1|  hypothetical protein AALP_AA5G258900                    119   3e-26    Arabis alpina [alpine rockcress]
emb|CAN79228.1|  hypothetical protein VITISV_011041                     120   3e-26    Vitis vinifera
gb|EYU42344.1|  hypothetical protein MIMGU_mgv1a020945mg                119   3e-26    Erythranthe guttata [common monkey flower]
ref|XP_010469198.1|  PREDICTED: uncharacterized protein LOC104749302    119   3e-26    Camelina sativa [gold-of-pleasure]
ref|XP_002273471.2|  PREDICTED: uncharacterized protein LOC100266818    119   3e-26    Vitis vinifera
ref|XP_006418489.1|  hypothetical protein EUTSA_v10006946mg             119   3e-26    Eutrema salsugineum [saltwater cress]
gb|EYU31892.1|  hypothetical protein MIMGU_mgv1a0019612mg               119   4e-26    Erythranthe guttata [common monkey flower]
ref|XP_010512348.1|  PREDICTED: uncharacterized protein LOC104788305    119   4e-26    Camelina sativa [gold-of-pleasure]
ref|XP_009133690.1|  PREDICTED: uncharacterized protein LOC103858146    119   4e-26    Brassica rapa
gb|EMS48593.1|  hypothetical protein TRIUR3_22003                       119   4e-26    Triticum urartu
gb|KHG20396.1|  Ferric uptake regulation                                119   4e-26    Gossypium arboreum [tree cotton]
ref|XP_002526611.1|  conserved hypothetical protein                     118   5e-26    Ricinus communis
ref|XP_006397664.1|  hypothetical protein EUTSA_v10001315mg             119   5e-26    Eutrema salsugineum [saltwater cress]
dbj|BAK03784.1|  predicted protein                                      119   5e-26    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010544575.1|  PREDICTED: uncharacterized protein LOC104817191    118   7e-26    Tarenaya hassleriana [spider flower]
ref|XP_010550476.1|  PREDICTED: uncharacterized protein LOC104821337    117   7e-26    Tarenaya hassleriana [spider flower]
ref|XP_006587779.1|  PREDICTED: uncharacterized protein LOC778134       118   7e-26    Glycine max [soybeans]
ref|XP_011017344.1|  PREDICTED: protein virilizer homolog               118   8e-26    Populus euphratica
emb|CBI37845.3|  unnamed protein product                                117   8e-26    Vitis vinifera
ref|XP_011043178.1|  PREDICTED: uncharacterized protein LOC105138705    117   8e-26    Populus euphratica
ref|XP_008347510.1|  PREDICTED: uncharacterized protein LOC103410601    115   9e-26    
ref|NP_190697.2|  protein ALTERED PHOSPHATE STARVATION RESPONSE 1       117   1e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402593.1|  hypothetical protein EUTSA_v10005793mg             118   1e-25    Eutrema salsugineum [saltwater cress]
ref|XP_006375135.1|  hypothetical protein POPTR_0014s04670g             118   1e-25    
emb|CDY42691.1|  BnaC04g22150D                                          117   1e-25    
emb|CDY56992.1|  BnaA04g27330D                                          117   1e-25    
ref|XP_004229746.1|  PREDICTED: uncharacterized protein LOC101257405    118   1e-25    
ref|XP_002881983.1|  predicted protein                                  117   1e-25    
ref|NP_001175961.1|  Os09g0538750                                       114   1e-25    
gb|KFK37283.1|  hypothetical protein AALP_AA4G237000                    117   1e-25    
gb|EMT28305.1|  hypothetical protein F775_06020                         116   1e-25    
ref|XP_010692050.1|  PREDICTED: uncharacterized protein LOC104905271    117   1e-25    
ref|NP_001145796.1|  hypothetical protein                               117   2e-25    
ref|XP_009138843.1|  PREDICTED: uncharacterized protein LOC103862890    117   2e-25    
gb|AFW87853.1|  hypothetical protein ZEAMMB73_997437                    117   2e-25    
ref|XP_001762208.1|  predicted protein                                  117   2e-25    
ref|XP_010413572.1|  PREDICTED: uncharacterized protein LOC104699875    117   2e-25    
ref|XP_009373221.1|  PREDICTED: uncharacterized protein LOC103962259    117   2e-25    
ref|XP_008385303.1|  PREDICTED: uncharacterized protein LOC103447...    117   2e-25    
ref|XP_010479355.1|  PREDICTED: uncharacterized protein LOC104758214    117   2e-25    
ref|XP_010646704.1|  PREDICTED: uncharacterized protein LOC100243514    117   2e-25    
ref|XP_008658472.1|  PREDICTED: uncharacterized protein LOC100279...    117   2e-25    
ref|XP_010265980.1|  PREDICTED: uncharacterized protein LOC104603617    116   3e-25    
ref|NP_001280829.1|  uncharacterized LOC103447875                       117   3e-25    
ref|XP_002460581.1|  hypothetical protein SORBIDRAFT_02g031210          116   3e-25    
ref|XP_010506417.1|  PREDICTED: uncharacterized protein LOC104783037    116   3e-25    
ref|XP_010524436.1|  PREDICTED: uncharacterized protein LOC104802494    116   4e-25    
ref|XP_010518090.1|  PREDICTED: uncharacterized protein LOC104793437    116   4e-25    
ref|XP_006383089.1|  hypothetical protein POPTR_0005s11440g             115   4e-25    
ref|XP_009612588.1|  PREDICTED: uncharacterized protein LOC104105875    115   4e-25    
ref|XP_009796808.1|  PREDICTED: uncharacterized protein LOC104243329    115   4e-25    
gb|EEE70131.1|  hypothetical protein OsJ_30161                          115   4e-25    
ref|XP_010496466.1|  PREDICTED: uncharacterized protein LOC104773...    115   5e-25    
ref|XP_010508243.1|  PREDICTED: uncharacterized protein LOC104784850    116   5e-25    
ref|XP_010496700.1|  PREDICTED: uncharacterized protein LOC104773746    112   6e-25    
ref|XP_006290620.1|  hypothetical protein CARUB_v10016712mg             115   6e-25    
ref|XP_003578529.1|  PREDICTED: uncharacterized protein LOC100833837    115   6e-25    
ref|XP_010033513.1|  PREDICTED: uncharacterized protein LOC104422784    115   6e-25    
ref|XP_002986032.1|  hypothetical protein SELMODRAFT_425043             115   6e-25    
ref|XP_008232519.1|  PREDICTED: uncharacterized protein DDB_G0284...    115   7e-25    
ref|XP_009411587.1|  PREDICTED: uncharacterized protein LOC103993301    115   7e-25    
ref|XP_009796082.1|  PREDICTED: uncharacterized protein LOC104242706    115   8e-25    
gb|EEC84963.1|  hypothetical protein OsI_32200                          115   8e-25    
ref|XP_002968724.1|  hypothetical protein SELMODRAFT_145899             115   9e-25    
ref|XP_002990611.1|  hypothetical protein SELMODRAFT_10621              115   9e-25    
ref|XP_007157896.1|  hypothetical protein PHAVU_002G106900g             114   1e-24    
gb|KJB24877.1|  hypothetical protein B456_004G165900                    115   1e-24    
emb|CBI17341.3|  unnamed protein product                                113   1e-24    
ref|XP_011462170.1|  PREDICTED: uncharacterized protein LOC105350878    114   1e-24    
ref|XP_008440844.1|  PREDICTED: uncharacterized protein LOC103485...    114   1e-24    
ref|XP_009355694.1|  PREDICTED: uncharacterized protein LOC103946664    115   1e-24    
ref|XP_008236050.1|  PREDICTED: uncharacterized protein LOC103334853    112   1e-24    
ref|XP_010496465.1|  PREDICTED: uncharacterized protein LOC104773...    114   1e-24    
gb|KGN48936.1|  hypothetical protein Csa_6G507110                       114   1e-24    
gb|KHG10277.1|  hypothetical protein F383_08644                         115   1e-24    
ref|XP_010235002.1|  PREDICTED: uncharacterized protein LOC100823...    114   1e-24    
ref|XP_008440843.1|  PREDICTED: uncharacterized protein LOC103485...    114   1e-24    
gb|EPS68914.1|  hypothetical protein M569_05851                         114   1e-24    
ref|XP_010052798.1|  PREDICTED: uncharacterized protein LOC104441367    115   1e-24    
ref|XP_007046645.1|  Uncharacterized protein TCM_000170                 114   1e-24    
ref|XP_003574338.1|  PREDICTED: uncharacterized protein LOC100823...    114   2e-24    
ref|XP_007220261.1|  hypothetical protein PRUPE_ppa001262mg             114   2e-24    
ref|XP_009624469.1|  PREDICTED: uncharacterized protein LOC104115517    114   2e-24    
gb|ABP88223.1|  transcription factor bZIP54                             106   2e-24    
ref|XP_004957489.1|  PREDICTED: uncharacterized protein LOC101781416    114   2e-24    
ref|XP_006293710.1|  hypothetical protein CARUB_v10022668mg             114   2e-24    
ref|XP_002301229.1|  hypothetical protein POPTR_0002s13850g             114   2e-24    
gb|EPS64716.1|  hypothetical protein M569_10064                         114   2e-24    
ref|XP_008457723.1|  PREDICTED: uncharacterized protein LOC103497347    114   2e-24    
ref|XP_010649002.1|  PREDICTED: uncharacterized protein LOC100245...    113   3e-24    
ref|NP_001146678.1|  uncharacterized protein LOC100280278               112   3e-24    
gb|EMS65961.1|  hypothetical protein TRIUR3_15371                       111   3e-24    
ref|XP_006293711.1|  hypothetical protein CARUB_v10022668mg             114   3e-24    
emb|CAN62559.1|  hypothetical protein VITISV_009207                     113   3e-24    
ref|XP_010649000.1|  PREDICTED: uncharacterized protein LOC100245...    113   3e-24    
ref|XP_009783506.1|  PREDICTED: uncharacterized protein LOC104232105    113   3e-24    
dbj|BAJ93020.1|  predicted protein                                      112   3e-24    
ref|XP_008651371.1|  PREDICTED: uncharacterized protein LOC100280...    113   4e-24    
ref|XP_002521270.1|  conserved hypothetical protein                     113   5e-24    
emb|CDX95620.1|  BnaC03g25010D                                          112   5e-24    
ref|XP_006347962.1|  PREDICTED: uncharacterized protein LOC102598946    113   5e-24    
emb|CDX83412.1|  BnaA03g20940D                                          112   5e-24    
dbj|BAJ88203.1|  predicted protein                                      112   6e-24    
ref|XP_002878328.1|  DNA binding protein                                112   7e-24    
emb|CDX71821.1|  BnaC08g30530D                                          112   7e-24    
ref|XP_006573547.1|  PREDICTED: uncharacterized protein LOC102662030    112   8e-24    
ref|XP_009418803.1|  PREDICTED: uncharacterized protein LOC103998915    112   9e-24    
ref|XP_008344422.1|  PREDICTED: uncharacterized protein LOC103407257    112   9e-24    
ref|XP_002305530.1|  hypothetical protein POPTR_0004s18350g             112   9e-24    
ref|XP_007215312.1|  hypothetical protein PRUPE_ppa003521mg             111   1e-23    
emb|CDP01871.1|  unnamed protein product                                111   1e-23    
ref|XP_010316432.1|  PREDICTED: uncharacterized protein LOC101264882    111   1e-23    
ref|XP_009589344.1|  PREDICTED: uncharacterized protein LOC104086728    111   1e-23    
gb|KDP33297.1|  hypothetical protein JCGZ_13084                         111   1e-23    
ref|XP_002989601.1|  hypothetical protein SELMODRAFT_447743             111   2e-23    
ref|XP_010465893.1|  PREDICTED: uncharacterized protein LOC104746...    110   2e-23    
ref|XP_011046654.1|  PREDICTED: uncharacterized protein LOC105141197    111   2e-23    
ref|XP_010465886.1|  PREDICTED: uncharacterized protein LOC104746...    110   2e-23    
ref|XP_002530629.1|  conserved hypothetical protein                     110   3e-23    
dbj|BAD34385.1|  hypothetical protein                                   106   3e-23    
ref|XP_006367871.1|  PREDICTED: uncharacterized protein LOC102582747    110   3e-23    
ref|XP_009116713.1|  PREDICTED: uncharacterized protein LOC103841881    110   3e-23    
emb|CDY41178.1|  BnaA09g38370D                                          110   3e-23    
gb|KJB40973.1|  hypothetical protein B456_007G085700                    110   4e-23    
ref|XP_009358153.1|  PREDICTED: uncharacterized protein LOC103948808    110   4e-23    
ref|XP_007201549.1|  hypothetical protein PRUPE_ppa017556mg             110   5e-23    
gb|AAN05792.1|  unknown                                                 109   5e-23    
gb|KJB17616.1|  hypothetical protein B456_003G008100                    108   6e-23    
emb|CDX77992.1|  BnaA09g31870D                                          109   7e-23    
ref|XP_004512154.1|  PREDICTED: uncharacterized protein LOC101508512    109   7e-23    
gb|KJB40156.1|  hypothetical protein B456_007G049300                    108   8e-23    
ref|XP_010266884.1|  PREDICTED: uncharacterized protein LOC104604293    109   8e-23    
ref|XP_009358043.1|  PREDICTED: uncharacterized protein LOC103948707    109   9e-23    
ref|XP_010266047.1|  PREDICTED: uncharacterized protein LOC104603664    109   9e-23    
ref|XP_009358050.1|  PREDICTED: uncharacterized protein LOC103948716    109   1e-22    
ref|XP_004134851.1|  PREDICTED: uncharacterized protein LOC101220098    108   1e-22    
gb|KFK28273.1|  hypothetical protein AALP_AA8G495200                    107   2e-22    
ref|XP_003635164.1|  PREDICTED: uncharacterized protein LOC100855179    108   2e-22    
ref|XP_006340943.1|  PREDICTED: uncharacterized protein LOC102600978    107   2e-22    
gb|KHG27804.1|  hypothetical protein F383_01358                         107   2e-22    
gb|KHG14505.1|  Pyridoxal-phosphate-dependent serine hydroxymethy...    107   3e-22    
gb|KJB15855.1|  hypothetical protein B456_002G199800                    107   3e-22    
ref|XP_010547414.1|  PREDICTED: formin-like protein 2 isoform X2        107   4e-22    
gb|KHG27172.1|  Holliday junction ATP-dependent DNA helicase RuvB       106   5e-22    
ref|XP_011088630.1|  PREDICTED: uncharacterized protein LOC105169807    106   9e-22    
ref|XP_004290739.2|  PREDICTED: uncharacterized protein LOC101292471    106   1e-21    
gb|KGN61947.1|  hypothetical protein Csa_2G271390                       105   1e-21    
ref|XP_004147076.1|  PREDICTED: uncharacterized protein LOC101207270    105   1e-21    
gb|KJB17572.1|  hypothetical protein B456_003G006300                    104   2e-21    
ref|XP_004231454.1|  PREDICTED: uncharacterized protein LOC101255743    105   2e-21    
ref|XP_003612207.1|  hypothetical protein MTR_5g022530                  105   2e-21    
ref|XP_004969399.1|  PREDICTED: uncharacterized protein LOC101757...    105   2e-21    
ref|XP_006486545.1|  PREDICTED: uncharacterized protein LOC102622893    102   2e-21    
ref|XP_004140629.1|  PREDICTED: uncharacterized protein LOC101219960    105   2e-21    
ref|XP_007041768.1|  Uncharacterized protein isoform 1                  105   2e-21    
gb|KHG24815.1|  DNA ligase                                              104   3e-21    
gb|KJB17571.1|  hypothetical protein B456_003G006300                    103   5e-21    
gb|KJB17570.1|  hypothetical protein B456_003G006300                    103   6e-21    
ref|XP_006448941.1|  hypothetical protein CICLE_v10014533mg             103   8e-21    
ref|XP_011022260.1|  PREDICTED: uncharacterized protein LOC105124090    103   8e-21    
ref|XP_006603964.1|  PREDICTED: uncharacterized protein LOC102664706  99.4    9e-21    
ref|XP_010241199.1|  PREDICTED: uncharacterized protein LOC104585875    103   9e-21    
gb|EYU37975.1|  hypothetical protein MIMGU_mgv1a026155mg                102   1e-20    
ref|XP_006383045.1|  hypothetical protein POPTR_0005s11020g             102   1e-20    
ref|XP_006468274.1|  PREDICTED: uncharacterized protein LOC102624...    102   1e-20    
ref|XP_006468273.1|  PREDICTED: uncharacterized protein LOC102624...    102   1e-20    
ref|XP_008646006.1|  PREDICTED: uncharacterized protein LOC103627496    100   3e-20    
ref|XP_002313698.2|  hypothetical protein POPTR_0009s13960g             101   4e-20    
ref|XP_007046600.1|  Uncharacterized protein TCM_000136                 100   5e-20    
emb|CAB87869.1|  bZIP protein                                         99.8    6e-20    
ref|NP_001043426.1|  Os01g0585600                                       100   8e-20    
gb|EAY74707.1|  hypothetical protein OsI_02600                          100   9e-20    
gb|EEE54881.1|  hypothetical protein OsJ_02382                          100   9e-20    
ref|XP_010028766.1|  PREDICTED: uncharacterized protein LOC104418979  99.8    1e-19    
ref|XP_010056962.1|  PREDICTED: uncharacterized protein LOC104444883  99.8    1e-19    
ref|XP_011045822.1|  PREDICTED: uncharacterized protein LOC105140622  99.8    1e-19    
gb|EMT31600.1|  hypothetical protein F775_01622                         100   1e-19    
ref|NP_001047613.2|  Os02g0654600                                     99.4    1e-19    
dbj|BAD25321.1|  putative bZIP protein                                99.4    1e-19    
emb|CDP14548.1|  unnamed protein product                              99.4    1e-19    
ref|NP_191591.2|  uncharacterized protein                             99.4    2e-19    
ref|XP_002455853.1|  hypothetical protein SORBIDRAFT_03g026230        98.2    4e-19    
gb|KDP34961.1|  hypothetical protein JCGZ_09249                       97.8    4e-19    
ref|XP_010941533.1|  PREDICTED: uncharacterized protein LOC105059789  97.8    4e-19    
ref|XP_008812622.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  97.8    5e-19    
gb|EYU19135.1|  hypothetical protein MIMGU_mgv1a002741mg              97.4    6e-19    
emb|CAC39057.1|  putative protein                                     97.1    6e-19    
gb|EEC73715.1|  hypothetical protein OsI_08319                        97.1    7e-19    
gb|KCW55583.1|  hypothetical protein EUGRSUZ_I01453                   97.1    8e-19    
ref|XP_010935171.1|  PREDICTED: uncharacterized protein LOC105055134  97.1    9e-19    
ref|XP_010231954.1|  PREDICTED: uncharacterized protein LOC100827...  97.1    9e-19    
ref|XP_008675404.1|  PREDICTED: uncharacterized protein LOC103651534  97.1    1e-18    
ref|XP_003569275.1|  PREDICTED: uncharacterized protein LOC100827...  97.1    1e-18    
ref|XP_003576784.1|  PREDICTED: uncharacterized protein LOC100844006  96.7    1e-18    
ref|XP_006644314.1|  PREDICTED: uncharacterized protein LOC102718120  96.7    1e-18    
emb|CBI16665.3|  unnamed protein product                              94.4    2e-18    
ref|XP_010540216.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  95.1    2e-18    
gb|KDP23957.1|  hypothetical protein JCGZ_25345                       96.3    2e-18    
ref|XP_010086828.1|  hypothetical protein L484_006057                 95.9    2e-18    
ref|XP_004289069.1|  PREDICTED: uncharacterized protein LOC101292260  95.5    3e-18    
ref|XP_006828819.1|  hypothetical protein AMTR_s00001p00134970        95.1    3e-18    
ref|XP_006425369.1|  hypothetical protein CICLE_v10027576mg           95.1    4e-18    
ref|XP_011092957.1|  PREDICTED: uncharacterized protein LOC105173018  94.7    5e-18    
gb|KDO71340.1|  hypothetical protein CISIN_1g014022mg                 93.6    5e-18    
ref|XP_007041131.1|  Uncharacterized protein isoform 3                94.4    7e-18    
gb|EMS55915.1|  hypothetical protein TRIUR3_26441                     94.0    7e-18    
gb|AAC24369.1|  bZIP-like protein                                     94.0    7e-18    
ref|XP_007041129.1|  Uncharacterized protein isoform 1                94.0    8e-18    
ref|XP_006467173.1|  PREDICTED: uncharacterized protein LOC102606809  94.4    8e-18    
gb|ABI34689.1|  bZIP transcription factor bZIP79                      91.3    8e-18    
ref|XP_008806165.1|  PREDICTED: uncharacterized protein LOC103718930  93.2    2e-17    
ref|XP_002452818.1|  hypothetical protein SORBIDRAFT_04g033110        92.8    2e-17    
ref|XP_007204798.1|  hypothetical protein PRUPE_ppa018170mg           93.2    2e-17    
ref|NP_001063821.2|  Os09g0542500                                     89.0    4e-17    
ref|XP_010113292.1|  hypothetical protein L484_026622                 91.7    5e-17    
gb|KHN45577.1|  hypothetical protein glysoja_033556                   90.5    6e-17    
ref|XP_008444972.1|  PREDICTED: uncharacterized protein LOC103488153  90.9    8e-17    
ref|XP_011096879.1|  PREDICTED: uncharacterized protein LOC105175929  90.5    1e-16    
ref|XP_003547572.1|  PREDICTED: uncharacterized protein LOC100809...  89.7    2e-16    
ref|XP_010496482.1|  PREDICTED: uncharacterized protein LOC104773542  85.9    2e-16    
ref|XP_010275925.1|  PREDICTED: uncharacterized protein LOC104610...  89.4    2e-16    
ref|XP_010690330.1|  PREDICTED: uncharacterized protein LOC104903894  89.4    3e-16    
ref|XP_010540610.1|  PREDICTED: uncharacterized protein LOC104814319  89.4    3e-16    
ref|XP_007138530.1|  hypothetical protein PHAVU_009G217000g           89.0    3e-16    
emb|CDP19649.1|  unnamed protein product                              89.0    3e-16    
gb|AAN01518.1|  bZIP-like protein                                     84.7    4e-16    
ref|XP_002989600.1|  hypothetical protein SELMODRAFT_428168           89.0    4e-16    
ref|XP_002986031.1|  hypothetical protein SELMODRAFT_425042           89.4    4e-16    
emb|CBI24375.3|  unnamed protein product                              82.8    4e-16    
ref|XP_004135735.1|  PREDICTED: uncharacterized protein LOC101216940  88.6    5e-16    
gb|EAZ09934.1|  hypothetical protein OsI_32233                        87.8    8e-16    
gb|KDO68173.1|  hypothetical protein CISIN_1g007142mg                 87.8    9e-16    
ref|XP_010519079.1|  PREDICTED: uncharacterized protein LOC104798610  87.8    9e-16    
gb|KHN37389.1|  hypothetical protein glysoja_013604                   87.8    9e-16    
gb|ABN08062.1|  Protein of unknown function DUF632                    85.9    9e-16    
dbj|BAC79196.1|  bzip-like transcription factor-like protein          87.8    1e-15    
ref|XP_003535757.1|  PREDICTED: uncharacterized protein LOC100801471  87.8    1e-15    
ref|XP_006486851.1|  PREDICTED: uncharacterized protein LOC102611322  87.8    1e-15    
emb|CBI30984.3|  unnamed protein product                              87.4    1e-15    
ref|XP_006422535.1|  hypothetical protein CICLE_v10030360mg           87.8    1e-15    
ref|XP_002274665.1|  PREDICTED: uncharacterized protein LOC100249833  87.4    1e-15    
ref|XP_003595493.1|  hypothetical protein MTR_2g048360                85.5    1e-15    
ref|XP_006661491.1|  PREDICTED: uncharacterized protein LOC102717278  87.0    1e-15    
ref|XP_007142804.1|  hypothetical protein PHAVU_007G018200g           87.4    1e-15    



>ref|XP_009786426.1| PREDICTED: uncharacterized protein LOC104234548 isoform X1 [Nicotiana 
sylvestris]
Length=756

 Score =   397 bits (1020),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 184/260 (71%), Positives = 225/260 (87%), Gaps = 0/260 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWETM+G+H +Q +IV ALRSLD+SQSPKET+EHH+ERT QL VVVQEWHSQF+K+
Sbjct  493  GMAIMWETMRGYHVSQSKIVQALRSLDISQSPKETTEHHHERTLQLYVVVQEWHSQFDKL  552

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YI+ LN+WLKLNL+PIDTNLKEKVSSPQRPQ PPIL+L+HAW D + KLPDELA
Sbjct  553  VTHQKHYIKALNNWLKLNLIPIDTNLKEKVSSPQRPQTPPILSLIHAWHDYLDKLPDELA  612

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +TAIY+FSAV+NTI ++Q +EMKLKDRC+DTR+EL K+TRQ+EDWYHKYMQRRTP D+ +
Sbjct  613  RTAIYNFSAVINTIFEYQKEEMKLKDRCEDTRRELNKKTRQYEDWYHKYMQRRTPPDEMD  672

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             D  HED+ V++RQLQLEAL+++L++EEEAY RQC+QVR KSLTSLR+ LPELF AMS+F
Sbjct  673  PDQAHEDSLVVDRQLQLEALRKKLEDEEEAYQRQCLQVRDKSLTSLRSRLPELFEAMSDF  732

Query  223  SRACSIMYQTLESITHPLNR  164
            S AC+ MY+ L SI    NR
Sbjct  733  SLACADMYRDLRSIAKHRNR  752



>ref|XP_009628236.1| PREDICTED: uncharacterized protein LOC104118644 isoform X1 [Nicotiana 
tomentosiformis]
Length=739

 Score =   391 bits (1005),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 181/260 (70%), Positives = 226/260 (87%), Gaps = 0/260 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWETM+G+H +Q +IV A+RSLD+SQSPKET+EHH+ERT QL VVVQEWHSQF+K+
Sbjct  476  GMAIMWETMRGYHVSQSKIVQAVRSLDISQSPKETTEHHHERTLQLYVVVQEWHSQFDKL  535

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ LN+WLKLNL+PIDTNLKEKVSSPQRPQNPPIL+L+HAW D + KLPDELA
Sbjct  536  VTHQKQYIKALNNWLKLNLIPIDTNLKEKVSSPQRPQNPPILSLIHAWHDYLDKLPDELA  595

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +TAIY+FSAV+NTI ++Q +EMKLKDRC+DTR+EL K+TRQ+EDWY ++MQRRTP D+ +
Sbjct  596  RTAIYNFSAVINTIFEYQKEEMKLKDRCEDTRRELNKKTRQYEDWYQRHMQRRTPPDEMD  655

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             D  H D+ V++RQLQLEAL+++L++EEEAY RQC+QVR KSLTSLR+ LPELF AMSEF
Sbjct  656  PDQAHVDSLVVDRQLQLEALRKKLEDEEEAYQRQCLQVRDKSLTSLRSRLPELFGAMSEF  715

Query  223  SRACSIMYQTLESITHPLNR  164
            S AC+ MY+ L SI+   NR
Sbjct  716  SLACADMYRDLRSISKHRNR  735



>ref|XP_006341679.1| PREDICTED: uncharacterized protein LOC102589286 [Solanum tuberosum]
Length=755

 Score =   383 bits (983),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/260 (69%), Positives = 225/260 (87%), Gaps = 1/260 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWETMKG+H +Q +IV AL+SLD+SQSPKET+EHH+ERT QL VVVQEWHSQF+K+
Sbjct  493  GMAIMWETMKGYHVSQSKIVQALKSLDISQSPKETTEHHHERTLQLYVVVQEWHSQFDKL  552

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +I+QK+YI+ LN WLKLNL+PIDTNLKEKVSSPQRPQNPPILAL+HAW D + KLPDELA
Sbjct  553  VIYQKQYIKALNSWLKLNLIPIDTNLKEKVSSPQRPQNPPILALIHAWHDYLEKLPDELA  612

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +TAIY+FSAV+NTI ++Q +EMKL+DRC+DTR+EL K+TRQ+EDWYHK+MQR+TP D+ +
Sbjct  613  RTAIYNFSAVINTIFEYQKEEMKLRDRCEDTRRELNKKTRQYEDWYHKHMQRKTP-DEID  671

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +   ED  V++RQLQLEAL+++L++EE++Y RQC+QVR KSLTSLR+ LPELF AMSE+
Sbjct  672  PESAQEDTLVVDRQLQLEALRKKLEDEEDSYQRQCLQVRDKSLTSLRSRLPELFGAMSEY  731

Query  223  SRACSIMYQTLESITHPLNR  164
            S AC+ MY+ L SI    NR
Sbjct  732  SLACADMYRDLRSIAKHRNR  751



>ref|XP_004235711.1| PREDICTED: uncharacterized protein LOC101250783 [Solanum lycopersicum]
Length=754

 Score =   381 bits (978),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/260 (69%), Positives = 223/260 (86%), Gaps = 1/260 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWE MKG+H +Q +I  AL+SLD+SQSPKET+EHH+ERT QL VVVQEWHSQF+K+
Sbjct  492  GMAIMWENMKGYHVSQSKIAQALKSLDISQSPKETTEHHHERTLQLYVVVQEWHSQFDKL  551

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +I+QK+YI+ LN+WLKLNL+PIDTNLKEKVSSPQRPQNPPILAL+HAW D + KLPDELA
Sbjct  552  VIYQKQYIKALNNWLKLNLIPIDTNLKEKVSSPQRPQNPPILALIHAWHDDLEKLPDELA  611

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +TAIY+FSAV+NTI ++Q +EMKL+DRC+DTR+EL K+TRQ+EDWYHK+MQRR P D+ +
Sbjct  612  RTAIYNFSAVINTIFEYQKEEMKLRDRCEDTRRELNKKTRQYEDWYHKHMQRRIP-DEMD  670

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +   ED  V++RQLQLEAL++RL++EE++Y RQC+QVR KSLTSLR+ LPELF AMSEF
Sbjct  671  PESAQEDTLVVDRQLQLEALRKRLEDEEDSYQRQCLQVRDKSLTSLRSRLPELFGAMSEF  730

Query  223  SRACSIMYQTLESITHPLNR  164
            S AC+ MY+ L SI    NR
Sbjct  731  SLACADMYRDLRSIAKHRNR  750



>ref|XP_011072341.1| PREDICTED: uncharacterized protein LOC105157620 [Sesamum indicum]
Length=743

 Score =   341 bits (875),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/260 (61%), Positives = 206/260 (79%), Gaps = 0/260 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWET++ HHENQ +IV ALR LD+SQ+PKETS+HH+ERT QLG VVQEW++ F ++
Sbjct  481  GMATMWETIRIHHENQSKIVQALRLLDISQAPKETSDHHHERTRQLGGVVQEWYTNFSEL  540

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QKEYI+ LN WLKLNL+PIDTN KEKVSSP RPQNPPI  LLHAW D + KLPDE A
Sbjct  541  MSQQKEYIKALNSWLKLNLIPIDTNWKEKVSSPGRPQNPPIQILLHAWHDYLEKLPDEPA  600

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K +I +F+A++ TI Q+Q +E+  ++RC D+RK+L ++TR FE+WY+KYMQ+RTP DD +
Sbjct  601  KASINNFAAIIKTIWQYQKEELDFRNRCADSRKDLIRKTRDFENWYNKYMQKRTPPDDMD  660

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             D  H+ + + E+QL +EA KQ+L+E+EEAY RQC+QVR KSL SL++ LPELF A+S+F
Sbjct  661  PDRTHDKDLIAEKQLMVEAAKQKLEEDEEAYQRQCIQVREKSLMSLKSHLPELFRALSDF  720

Query  223  SRACSIMYQTLESITHPLNR  164
            S ACS MY TL SI+   NR
Sbjct  721  SLACSDMYSTLRSISRSRNR  740



>ref|XP_002304191.2| hypothetical protein POPTR_0003s05360g [Populus trichocarpa]
 gb|EEE79170.2| hypothetical protein POPTR_0003s05360g [Populus trichocarpa]
Length=261

 Score =   318 bits (816),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/254 (62%), Positives = 205/254 (81%), Gaps = 4/254 (2%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW+TM  HHE+Q +IV ALR LD+SQS KETSEHH++RT+QL VVVQEW SQF K+I +Q
Sbjct  1    MWKTMLVHHEDQSKIVNALRFLDISQSSKETSEHHHDRTFQLLVVVQEWQSQFCKLIDNQ  60

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            K YI+ LN WLKLNL+PI++NLKEKVSSP R +NPPI  LL AW D + KLPDE+A+TAI
Sbjct  61   KAYIKSLNSWLKLNLIPIESNLKEKVSSPPRVRNPPIQPLLIAWHDFLDKLPDEVARTAI  120

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DTE--Q  401
             +F+AV++TI+QHQ +EMKLK++C++TRKEL ++ R++EDW+ KYMQ+RTP++ D E  +
Sbjct  121  NNFAAVIHTILQHQEEEMKLKEKCEETRKELSQKMRKYEDWWRKYMQQRTPDELDPERTE  180

Query  400  DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  221
            D  H D  + ERQ  ++A+K RLKEEEEAY +QC+QVR KS+ SL+T LPELF AMSE +
Sbjct  181  DNSHND-AIAERQSVVDAVKNRLKEEEEAYRKQCLQVREKSMASLKTRLPELFRAMSEVA  239

Query  220  RACSIMYQTLESIT  179
             ACS MY+ L SI+
Sbjct  240  HACSEMYKNLRSIS  253



>ref|XP_002279674.1| PREDICTED: uncharacterized protein LOC100241173 [Vitis vinifera]
Length=722

 Score =   328 bits (842),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 202/258 (78%), Gaps = 4/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW TM  HH++Q +  +AL+SLD+SQSPKETSEHH++RT QL +VVQEWHSQF+K+
Sbjct  458  GMATMWGTMLEHHKSQSKTAMALKSLDISQSPKETSEHHHKRTIQLWIVVQEWHSQFDKL  517

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK YI  L  WL+LNL+PI++NLKEKVSSP RPQNPPI ALL AW D + KLPDELA
Sbjct  518  VTNQKNYITALKKWLRLNLIPIESNLKEKVSSPPRPQNPPIQALLQAWNDHLEKLPDELA  577

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            KT+I +F+A++ TI+QHQ DEM+LK +C++T KELE++TRQF DW+ KYMQ+R P+++  
Sbjct  578  KTSISNFAAIIETIMQHQQDEMRLKAKCEETAKELERKTRQFNDWHSKYMQKRIPDENDR  637

Query  403  Q---DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            +   D PH D  VIER+L +E L  RLK+EEE Y ++C+ VR KSL SL+  LPELF A+
Sbjct  638  EHSGDDPH-DEVVIERKLVVETLSNRLKDEEETYQKECVLVRDKSLASLKNHLPELFRAL  696

Query  232  SEFSRACSIMYQTLESIT  179
            SEFS ACS MY  L SI+
Sbjct  697  SEFSYACSDMYSRLRSIS  714



>emb|CDO98057.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   328 bits (842),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/263 (62%), Positives = 212/263 (81%), Gaps = 0/263 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWE+M+GHHE+Q +IV AL SL +SQ PKETSEHH+ERT+QL +VV+EWH QF+K+
Sbjct  487  GMAFMWESMRGHHESQSKIVQALSSLHISQFPKETSEHHHERTFQLLLVVKEWHMQFDKL  546

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I +Q +YIR LN+WLKLNL+PIDTNLKEKVSSPQRP NPPI  LLHAW D + K PDELA
Sbjct  547  IKNQLDYIRALNNWLKLNLIPIDTNLKEKVSSPQRPANPPICVLLHAWHDYLEKAPDELA  606

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            ++AI +F+ VV+ IV++Q+DEMKL+++C+DTR+EL K+T QF+DWY KYMQRRTP D+ +
Sbjct  607  RSAINNFAHVVDHIVEYQIDEMKLRNKCEDTRRELAKKTEQFKDWYRKYMQRRTPPDELD  666

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +   + + ++ERQ+Q+E L+++L+EEE  Y +QC+QVR KSL SLRTGLP LF AMS F
Sbjct  667  PERAQDKDLIVERQIQVETLEKKLEEEEAEYKKQCIQVREKSLASLRTGLPNLFLAMSGF  726

Query  223  SRACSIMYQTLESITHPLNREST  155
            S ACS MY+ L SI+   +R  +
Sbjct  727  SLACSDMYRNLRSISQKRSRSES  749



>ref|XP_010545713.1| PREDICTED: uncharacterized protein LOC104817994 [Tarenaya hassleriana]
Length=834

 Score =   325 bits (832),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 202/256 (79%), Gaps = 9/256 (4%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +MA+MWE M+ HH+ Q ++  ALRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  546  AMAKMWELMQIHHQRQAEVSKALRSLDISQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  605

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ LN WLKLNL+PI++ LKEKVSSP R  NPPI  LL AW D + KLPDE+A
Sbjct  606  IDHQKEYIKFLNSWLKLNLIPIESTLKEKVSSPPRVPNPPIQRLLIAWYDRLDKLPDEMA  665

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +TAI +F+AV++TI+Q Q +EMKL+D+C++TR+EL ++TR FEDWYHKYMQ+R P    E
Sbjct  666  RTAIINFAAVISTIMQQQEEEMKLRDKCEETRRELARKTRNFEDWYHKYMQKRIP----E  721

Query  403  QDGPHEDNN-----VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
            +  P EDN+     VIERQL +E +++RL+EEEE Y RQC+QVR KSL SLRT LPELF 
Sbjct  722  EINPEEDNDAHKDVVIERQLAVEQVRKRLEEEEEVYQRQCVQVREKSLASLRTRLPELFQ  781

Query  238  AMSEFSRACSIMYQTL  191
            AMSE + ACS MY+ L
Sbjct  782  AMSEVAYACSDMYRAL  797



>gb|KHN32609.1| hypothetical protein glysoja_022291 [Glycine soja]
Length=640

 Score =   320 bits (819),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 198/266 (74%), Gaps = 3/266 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW+TM  HH  Q   V +LR+LD+SQSPK TSEHHY+RTYQL +VVQ+WHS FEK+
Sbjct  375  GMATMWKTMLEHHVKQSDTVTSLRNLDISQSPKTTSEHHYDRTYQLVLVVQQWHSHFEKL  434

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YI+ LN WLKLN++PI++NLKEKVSSP R ++PPI  LL+AW D + KLPDELA
Sbjct  435  VNHQKGYIKALNTWLKLNIIPIESNLKEKVSSPPRVRSPPIQGLLNAWNDRLDKLPDELA  494

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP---ND  413
            +TAI +F  V+ TI   Q +E+ LK +C+DTRKEL ++TRQFEDWY+KYMQ++ P   N 
Sbjct  495  RTAIGNFVNVIETIYHQQEEEIALKRKCEDTRKELSRKTRQFEDWYNKYMQKKIPDEYNP  554

Query  412  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            D  +D    D  V ERQ  +E +K+RL++EEEAY RQC+QVR K+L SL+  +PELF AM
Sbjct  555  DRAEDANAPDEVVTERQFAVELVKKRLEDEEEAYARQCLQVRQKTLGSLKNRMPELFRAM  614

Query  232  SEFSRACSIMYQTLESITHPLNREST  155
            S+FS  CS MY  L SI+  L + S+
Sbjct  615  SDFSLECSRMYSELRSISQHLGQSSS  640



>ref|XP_003542101.1| PREDICTED: uncharacterized protein LOC100791852 [Glycine max]
Length=749

 Score =   320 bits (819),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 198/266 (74%), Gaps = 3/266 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW+TM  HH  Q   V +LR+LD+SQSPK TSEHHY+RTYQL +VVQ+WHS FEK+
Sbjct  484  GMATMWKTMLEHHVKQSDTVTSLRNLDISQSPKTTSEHHYDRTYQLVLVVQQWHSHFEKL  543

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YI+ LN WLKLN++PI++NLKEKVSSP R ++PPI  LL+AW D + KLPDELA
Sbjct  544  VNHQKGYIKALNTWLKLNIIPIESNLKEKVSSPPRVRSPPIQGLLNAWNDRLDKLPDELA  603

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP---ND  413
            +TAI +F  V+ TI   Q +E+ LK +C+DTRKEL ++TRQFEDWY+KYMQ++ P   N 
Sbjct  604  RTAIGNFVNVIETIYHQQEEEIALKRKCEDTRKELSRKTRQFEDWYNKYMQKKIPDEYNP  663

Query  412  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            D  +D    D  V ERQ  +E +K+RL++EEEAY RQC+QVR K+L SL+  +PELF AM
Sbjct  664  DRAEDANAPDEVVTERQFAVELVKKRLEDEEEAYARQCLQVRQKTLGSLKNRMPELFRAM  723

Query  232  SEFSRACSIMYQTLESITHPLNREST  155
            S+FS  CS MY  L SI+  L + S+
Sbjct  724  SDFSLECSRMYSELRSISQHLGQSSS  749



>ref|XP_002299694.2| hypothetical protein POPTR_0001s18130g [Populus trichocarpa]
 gb|EEE84499.2| hypothetical protein POPTR_0001s18130g [Populus trichocarpa]
Length=696

 Score =   318 bits (816),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/261 (60%), Positives = 208/261 (80%), Gaps = 2/261 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW+TM+ HHE Q ++V ALR+LD+SQSPKETSEHH++RT+QL VVVQ W SQF K+
Sbjct  434  GMATMWDTMRYHHEAQSKVVNALRALDISQSPKETSEHHHDRTFQLLVVVQGWQSQFCKL  493

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I +QK YIR LN WLKLNL+PI+++LKEKVSSP R QNPPI +LL AW D + KLPDE+A
Sbjct  494  IDNQKGYIRALNSWLKLNLIPIESSLKEKVSSPPRVQNPPIQSLLIAWHDFLDKLPDEVA  553

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DT  407
            +TAI +F++V++TI+QHQ +EMKLK++C++TRKEL ++TR+FEDWYHKYMQ++ P + D 
Sbjct  554  RTAINNFASVIHTILQHQEEEMKLKEKCEETRKELFQKTRKFEDWYHKYMQQKMPAEFDP  613

Query  406  EQDGPHEDNNVI-ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            E      DN+ I +RQ  ++A+K+RL+EEEEAY +Q +QVR KSL S++T LPELF AM 
Sbjct  614  ELTEDKSDNDAIADRQFVVDAVKKRLEEEEEAYKKQRLQVREKSLASIKTCLPELFRAMF  673

Query  229  EFSRACSIMYQTLESITHPLN  167
            + ++ACS MY+ L  I+   N
Sbjct  674  DIAQACSEMYRNLRFISQRRN  694



>ref|XP_010098052.1| hypothetical protein L484_026183 [Morus notabilis]
 gb|EXB74489.1| hypothetical protein L484_026183 [Morus notabilis]
Length=743

 Score =   319 bits (817),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 199/259 (77%), Gaps = 0/259 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWETM+ HHENQ +IV  LR LD+SQSPKETSEHH+ERT QL  VV EWH QFEK+
Sbjct  479  GMATMWETMQYHHENQSKIVQKLRYLDISQSPKETSEHHHERTVQLYAVVNEWHLQFEKL  538

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QK+Y++ L  WLKLNL+P +++LKEKVSSP R Q PPI  LL AWQ+ + KLPDELA
Sbjct  539  VFKQKDYMKALTTWLKLNLIPTESSLKEKVSSPPRQQTPPIQKLLMAWQEHLEKLPDELA  598

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            ++AI++F+AV++TIV  Q++EM+L+++CKDT KEL ++ RQFEDWY KYM+R+ PN+   
Sbjct  599  RSAIFNFAAVIDTIVHQQVEEMRLREKCKDTEKELSRKKRQFEDWYRKYMERQIPNEGEP  658

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +    +N + ERQ  +++L++RL+EE+E Y R C+ VR KSL S++T LPELF A+S+F
Sbjct  659  AEDTTSNNGLAERQFMVDSLEKRLEEEQEDYQRHCLHVREKSLASVKTRLPELFRALSDF  718

Query  223  SRACSIMYQTLESITHPLN  167
            + ACS MY+ L S + P N
Sbjct  719  AVACSEMYRDLRSRSPPQN  737



>gb|KHG04451.1| Monodehydroascorbate reductase, fruit isozyme [Gossypium arboreum]
Length=741

 Score =   318 bits (815),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/261 (60%), Positives = 201/261 (77%), Gaps = 3/261 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRS-LDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            M  MWETM+  H++QC+I   LR  LD+SQSPKETSEHH+ERT+QL  +VQ+WH QF K+
Sbjct  476  MVIMWETMREEHDSQCRIADILRDHLDLSQSPKETSEHHHERTFQLLAIVQDWHMQFCKL  535

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ LN+WL+LNL+PI+++LKEK SSP R ++PPI  L+ AWQD + KLPDE+A
Sbjct  536  IDHQKEYIKALNNWLRLNLIPIESSLKEKGSSPPRVESPPIQRLILAWQDKLDKLPDEIA  595

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN--DD  410
            +TAI +F+ V++ I+QHQ DEMKLK++C+++RKEL K+ RQFEDWY+KYMQRRTP   D 
Sbjct  596  RTAINNFAHVIDAIMQHQRDEMKLKEKCEESRKELAKKQRQFEDWYNKYMQRRTPEELDP  655

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            T  D    ++ V ERQ  +EA+K+RL EEEEAY   C+QVR KSL SL+T LPELF AMS
Sbjct  656  TRTDDNPNNDAVTERQFMVEAVKRRLGEEEEAYRILCIQVREKSLVSLKTRLPELFRAMS  715

Query  229  EFSRACSIMYQTLESITHPLN  167
              + ACS MY  L +I+H  N
Sbjct  716  TIAVACSKMYGELRAISHSRN  736



>gb|AAK96499.1| At1g52320/F19K6_7 [Arabidopsis thaliana]
 gb|AAN18183.1| At1g52320/F19K6_7 [Arabidopsis thaliana]
 dbj|BAD94485.1| bZIP protein [Arabidopsis thaliana]
Length=398

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/264 (58%), Positives = 198/264 (75%), Gaps = 6/264 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  125  AMGKMWEMMQIHHQRQAEISKVLRSLDVSQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  184

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + K+PDE+A
Sbjct  185  IDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLDKIPDEMA  244

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN--DD  410
            K+AI +F+AVV+TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKY+Q+R P   + 
Sbjct  245  KSAIINFAAVVSTIMQQQEDEISLRNKCEETRKELGRKIRQFEDWYHKYIQKRGPEGMNP  304

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
             E D  H D   + RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LPELF AMS
Sbjct  305  DEADNDHNDEVAV-RQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTRLPELFQAMS  363

Query  229  EFSRACSIMYQTLESITHPLNRES  158
            E + +CS MY+   +IT+   R+S
Sbjct  364  EVAYSCSDMYR---AITYASKRQS  384



>gb|EYU21542.1| hypothetical protein MIMGU_mgv1a001881mg [Erythranthe guttata]
Length=745

 Score =   315 bits (806),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/260 (57%), Positives = 197/260 (76%), Gaps = 0/260 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWET++   ENQ  IV ALRSLD SQSPKETS+HH+ERT QLG VVQ+W + F ++
Sbjct  483  GMATMWETIRIQQENQSNIVQALRSLDTSQSPKETSDHHHERTRQLGGVVQDWFTNFTEL  542

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QKEYIR LN WLKLNLVPIDTN KEK +SP R  +PPI  LL+AW D + KLPDE A
Sbjct  543  MSQQKEYIRALNTWLKLNLVPIDTNWKEKPTSPNRHHSPPIQTLLNAWHDHLEKLPDEPA  602

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +  I +F+A+V TI Q+Q +E++ +++C D+RK+L ++TR+FE WY+K+MQ+R P DDT+
Sbjct  603  RATINNFAAIVKTIWQYQKEELEFRNKCSDSRKDLVRKTREFESWYNKFMQKRGPPDDTD  662

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             D  H+ +++ ERQL +E  K +L+E+EE Y + C+QVR KSL SL++ LPELF A+SEF
Sbjct  663  PDRVHDSDHIAERQLIVEIAKHKLEEDEEGYRKLCVQVREKSLVSLKSHLPELFRALSEF  722

Query  223  SRACSIMYQTLESITHPLNR  164
            S ACS MY  L SI+HP +R
Sbjct  723  SLACSDMYSNLRSISHPRHR  742



>ref|XP_011001614.1| PREDICTED: uncharacterized protein LOC105108845 [Populus euphratica]
Length=698

 Score =   313 bits (803),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/258 (60%), Positives = 204/258 (79%), Gaps = 4/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW+TM  HHE+Q +IV ALR LD+SQS KETSEHH++RT+QL VVVQEW SQF K+
Sbjct  434  GMATMWKTMLVHHEDQSKIVNALRFLDISQSSKETSEHHHDRTFQLLVVVQEWQSQFCKL  493

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I +QK YI+ LN WL+LNL+PI+++LKEKVSSP R +NPPI  L+ AW D + KLPDE+A
Sbjct  494  IDNQKAYIKALNSWLRLNLIPIESSLKEKVSSPPRVRNPPIQPLIIAWHDFLDKLPDEVA  553

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DT  407
            +TAI +F+AV++ I+QHQ +EMKLK++C++TRKEL ++TR+FE+W  KYM++RTP++ D 
Sbjct  554  RTAINTFAAVIHAILQHQEEEMKLKEKCEETRKELSQKTRKFEEWRRKYMRQRTPDELDP  613

Query  406  E--QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            E  +D  H D  + ERQ  ++A+K RLKEEEEAY + C+QVR KS+ SL+  LPELF AM
Sbjct  614  ERTEDNSHND-AIAERQSVVDAVKNRLKEEEEAYWKHCLQVREKSMASLKARLPELFRAM  672

Query  232  SEFSRACSIMYQTLESIT  179
            SE + ACS MY+ L SI+
Sbjct  673  SEVAHACSEMYKNLRSIS  690



>ref|XP_006465528.1| PREDICTED: uncharacterized protein LOC102613887 [Citrus sinensis]
Length=736

 Score =   313 bits (803),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 204/259 (79%), Gaps = 1/259 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW TM+ HH++Q ++V AL+SLD+SQSPKETSEHH+ERT QL  VVQEW+SQF K+
Sbjct  473  GMALMWGTMQFHHKSQSKVVTALKSLDISQSPKETSEHHHERTIQLWAVVQEWNSQFCKL  532

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQK YI+ LN WLKLNL+PI+++L+EKVSSP R Q PPI  LL AWQDL+ KLPDE+A
Sbjct  533  IDHQKAYIKALNSWLKLNLIPIESSLREKVSSPPRIQTPPIQRLLLAWQDLLQKLPDEIA  592

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            ++AI +F+A++NTI+ HQ +EMKLK+RC++T+KEL ++TRQFEDWY+KY+ RRT  ++ +
Sbjct  593  RSAIGNFAALINTIMHHQEEEMKLKERCEETKKELSRKTRQFEDWYNKYITRRT-QEELD  651

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             D     + V ER+  ++ LK+RL+EEEEAY RQC  VR KSLTSLR  LPELF AMSE 
Sbjct  652  ADDTTLKDAVTERKFVVDVLKKRLEEEEEAYQRQCGAVREKSLTSLRNHLPELFKAMSEI  711

Query  223  SRACSIMYQTLESITHPLN  167
            S ACS MY+ L++I    N
Sbjct  712  SFACSGMYRDLKNIAQHKN  730



>ref|NP_001117469.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001117470.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_564604.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32782.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
 gb|AEE32784.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
 gb|AEE32785.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
Length=472

 Score =   306 bits (783),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 153/264 (58%), Positives = 198/264 (75%), Gaps = 6/264 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  199  AMGKMWEMMQIHHQRQAEISKVLRSLDVSQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  258

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + K+PDE+A
Sbjct  259  IDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLDKIPDEMA  318

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN--DD  410
            K+AI +F+AVV+TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKY+Q+R P   + 
Sbjct  319  KSAIINFAAVVSTIMQQQEDEISLRNKCEETRKELGRKIRQFEDWYHKYIQKRGPEGMNP  378

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
             E D  H D  V  RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LPELF AMS
Sbjct  379  DEADNDHND-EVAVRQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTRLPELFQAMS  437

Query  229  EFSRACSIMYQTLESITHPLNRES  158
            E + +CS MY+   +IT+   R+S
Sbjct  438  EVAYSCSDMYR---AITYASKRQS  458



>gb|KHM98761.1| hypothetical protein glysoja_030814 [Glycine soja]
Length=636

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/262 (57%), Positives = 194/262 (74%), Gaps = 4/262 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW+TM  HH  Q + V  LR+LD+SQSPK TSEHHY+RTYQL +VVQ+WHS FE +
Sbjct  372  GMATMWKTMLEHHVKQSETVTLLRNLDISQSPKTTSEHHYDRTYQLFLVVQQWHSHFENL  431

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YI+ LN WLKLN++PI+++LKEKVSSP R ++PPI  LL+AW D + KLPDELA
Sbjct  432  VNHQKGYIKALNTWLKLNIIPIESSLKEKVSSPPRVRSPPIQGLLYAWNDRLDKLPDELA  491

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP---ND  413
            +TAI +F AV+ TI   Q +E+ LK +C+DTRKEL ++TRQFEDWY+KYMQ++ P   N 
Sbjct  492  RTAIGNFVAVIETIYHQQQEEIALKRKCEDTRKELSRKTRQFEDWYNKYMQKKIPDEYNP  551

Query  412  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            D  +D    D  V+ RQ  +E +K+RL++EEEAY RQC+QVR K+L SL+  +PELF AM
Sbjct  552  DRAEDANAPD-EVVTRQSAVEQVKKRLEDEEEAYARQCLQVRQKTLVSLKNRMPELFRAM  610

Query  232  SEFSRACSIMYQTLESITHPLN  167
            S+FS  CS MY  L  I+  L 
Sbjct  611  SDFSLECSRMYSELRPISQNLG  632



>ref|XP_006427010.1| hypothetical protein CICLE_v10024988mg [Citrus clementina]
 gb|ESR40250.1| hypothetical protein CICLE_v10024988mg [Citrus clementina]
Length=736

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/259 (61%), Positives = 203/259 (78%), Gaps = 1/259 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW TM+ HH++Q ++V AL+SLD+SQSPKETSEHH+ERT QL  VVQEW+SQF K+
Sbjct  473  GMALMWGTMQFHHKSQSKVVTALKSLDISQSPKETSEHHHERTIQLWAVVQEWNSQFCKL  532

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQK YI+ LN WLKLNL+PI+++L+EKVSSP R Q PPI  LL AW DL+ KLPDE+A
Sbjct  533  IDHQKAYIKALNSWLKLNLIPIESSLREKVSSPPRIQTPPIQRLLLAWHDLLQKLPDEIA  592

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            ++AI +F+A++NTI+ HQ +EMKLK+RC++T+KEL ++TRQFEDWY+KY+ RRT  ++ +
Sbjct  593  RSAIGNFAALINTIMHHQEEEMKLKERCEETKKELSRKTRQFEDWYNKYITRRT-QEELD  651

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             D     + V ER+  ++ LK+RL+EEEEAY RQC  VR KSLTSLR  LPELF AMSE 
Sbjct  652  ADDTTLKDAVTERKFVVDVLKKRLEEEEEAYQRQCGAVREKSLTSLRNHLPELFKAMSEI  711

Query  223  SRACSIMYQTLESITHPLN  167
            S ACS MY+ L++I    N
Sbjct  712  SFACSGMYRDLKNIAQHKN  730



>ref|XP_011026550.1| PREDICTED: uncharacterized protein LOC105127120 [Populus euphratica]
Length=755

 Score =   311 bits (797),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 199/257 (77%), Gaps = 2/257 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW +M  HH++Q +IV  L+SLD++ + KET++HH+ERT QL  VVQ WHS FEK+
Sbjct  489  GMAKMWASMCLHHDSQLKIVTNLKSLDVNHAIKETTKHHHERTIQLLKVVQGWHSHFEKL  548

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  L  WLKLNL+PI++NLKEK+SSP R QNPPI ALLH+W D + KLPDELA
Sbjct  549  VTHQKQYIHTLTSWLKLNLIPIESNLKEKISSPPRAQNPPIQALLHSWHDYLEKLPDELA  608

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AVV TIV HQ +EMKLK++C++TR+E  ++++ FE+WY KYMQRRTP D+T+
Sbjct  609  KSAISSFAAVVETIVHHQEEEMKLKEKCEETRREFLRKSQAFEEWYQKYMQRRTPTDETD  668

Query  403  QDGPHE--DNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
             D   +   N V ERQ  +E+LK+RL+EE EA+ + C+QVR KS+ SL+  LPELF AMS
Sbjct  669  ADRGEDANPNPVSERQFVVESLKKRLEEEIEAHGKHCLQVREKSVGSLKIRLPELFRAMS  728

Query  229  EFSRACSIMYQTLESIT  179
            +++ ACS  Y+ L SIT
Sbjct  729  DYAHACSDAYEKLRSIT  745



>gb|KHN10238.1| hypothetical protein glysoja_017842 [Glycine soja]
Length=547

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/263 (56%), Positives = 199/263 (76%), Gaps = 2/263 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA MWE M  HH++Q +IV  L+SLD+SQ+PKET++HHY+RT QL  V+QEWH QFEK++
Sbjct  285  MANMWENMCIHHDSQLKIVTDLKSLDISQAPKETTKHHYDRTVQLEKVIQEWHLQFEKLV  344

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
              QK YI+ LN WLKLNL+PI++NLKEK+SSP + QNPPI ALLHAW D + KLPDELAK
Sbjct  345  TQQKHYIKALNSWLKLNLIPIESNLKEKISSPPKAQNPPIQALLHAWHDYVDKLPDELAK  404

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            +AI SF AV+ TI+  Q +EMKLK+RC++TRKE  K+ + FE+WY K++ RR P++   +
Sbjct  405  SAISSFVAVIKTIILQQEEEMKLKERCEETRKEYFKKKQAFEEWYQKHLMRRGPDEAEHE  464

Query  400  DGP--HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
             G   + +N V ERQ  +E+LK+RL+EE E++ + C+QVR KSL SL+T LPELF A+S+
Sbjct  465  RGEEVNANNPVSERQFVVESLKKRLEEEIESHQKHCVQVREKSLQSLKTRLPELFRALSD  524

Query  226  FSRACSIMYQTLESITHPLNRES  158
            ++ AC+  Y+ L+ IT     E+
Sbjct  525  YAHACADAYEKLKLITQSRGGEA  547



>ref|XP_004305292.1| PREDICTED: uncharacterized protein LOC101294200 [Fragaria vesca 
subsp. vesca]
Length=733

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 198/256 (77%), Gaps = 4/256 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWE M+ HHE+Q +IV ALRS D+SQ PK T++HH+ERT QL  VVQEWHSQF K+
Sbjct  466  GMATMWEAMRCHHESQSKIVTALRSFDISQCPKYTTDHHHERTVQLWYVVQEWHSQFVKL  525

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QKEY++ L +WLKLNL+PI++NLKEKVSSP R QNPPI  LL  W D + KLPDE+A
Sbjct  526  VSKQKEYVKALRNWLKLNLIPIESNLKEKVSSPPRIQNPPIQGLLLEWNDHLDKLPDEVA  585

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +TAI++F+ +++TI+  Q +EMK+K++C+D+RKEL+++ RQFEDWYHKYM +  P D+ +
Sbjct  586  RTAIHNFAGIIHTIMLKQEEEMKMKEKCEDSRKELDRKKRQFEDWYHKYMNKNIP-DEVD  644

Query  403  QDGPHED---NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             + P  +   + V E+Q  +E +++RL+EEEEAY R C+QVR KS+TSL+TGLPELF A+
Sbjct  645  PERPESNVRGDVVAEKQFNVEVVQKRLEEEEEAYARLCLQVREKSITSLKTGLPELFRAL  704

Query  232  SEFSRACSIMYQTLES  185
              F+ +CS MY+ L S
Sbjct  705  VAFAVSCSEMYKHLNS  720



>ref|XP_004486732.1| PREDICTED: uncharacterized protein LOC101506888 isoform X1 [Cicer 
arietinum]
 ref|XP_004486733.1| PREDICTED: uncharacterized protein LOC101506888 isoform X2 [Cicer 
arietinum]
Length=753

 Score =   310 bits (793),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/265 (57%), Positives = 199/265 (75%), Gaps = 3/265 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA MW+ M  HHE Q + V  L+SLD SQSPK+TSEHH+ERTYQL VVVQ+WHSQFEK++
Sbjct  489  MATMWKKMLSHHEKQSETVTLLKSLDPSQSPKQTSEHHHERTYQLLVVVQQWHSQFEKLV  548

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             +QK YI+ LN+WLKLNL+PI++NLKEKVSSP R ++PP+  LLHAW D + KLPDELA+
Sbjct  549  NNQKGYIKSLNNWLKLNLIPIESNLKEKVSSPPRVRSPPVQGLLHAWHDRLEKLPDELAR  608

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND---D  410
            TAI +F+AV++TI   Q +EM  K +C+D+RKEL ++TRQF+DWYHKYMQR+TP +   D
Sbjct  609  TAIGNFAAVLDTIFNQQDEEMIKKRKCEDSRKELARKTRQFDDWYHKYMQRKTPEEFDPD  668

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
              +D    D  V E+Q+ +E +++RL+ EE  Y +QC+QVR K+L SL+  +PELF AM 
Sbjct  669  KAEDPNAPDEVVTEKQILVEQVRKRLEAEEADYEKQCLQVRQKTLGSLKNRMPELFRAMC  728

Query  229  EFSRACSIMYQTLESITHPLNREST  155
            +FS  CS MY  L SI   L + S+
Sbjct  729  DFSLECSKMYIELCSIAQHLGQNSS  753



>ref|XP_006392932.1| hypothetical protein EUTSA_v10011250mg [Eutrema salsugineum]
 gb|ESQ30218.1| hypothetical protein EUTSA_v10011250mg [Eutrema salsugineum]
Length=790

 Score =   310 bits (793),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 150/259 (58%), Positives = 197/259 (76%), Gaps = 5/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +MA+MWE M+ HH+ Q +I   L+SLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  515  AMAKMWEMMQMHHQRQAEISKVLKSLDVSQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  574

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQK YI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLH W D + K+PDE+A
Sbjct  575  IDHQKAYIKSLGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHIWYDRLDKIPDEMA  634

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +TAI +F+AV++TI+Q Q +E+KL+DRC++TRKEL ++ RQFEDWY+KYMQ+R P +D  
Sbjct  635  RTAIINFAAVISTIMQQQEEEIKLRDRCEETRKELGRKIRQFEDWYYKYMQKRGP-EDMN  693

Query  403  QDGPHEDNN----VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
             DG   DN+    V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LPELF A
Sbjct  694  PDGSEADNDHKDEVVVRQFNVEQIKKRLEEEEEAYQRQSQQVREKSLASLRTRLPELFQA  753

Query  235  MSEFSRACSIMYQTLESIT  179
            MSE + +CS MY+ +  +T
Sbjct  754  MSEVAYSCSDMYRAVVYVT  772



>gb|KDO51231.1| hypothetical protein CISIN_1g044677mg, partial [Citrus sinensis]
Length=250

 Score =   293 bits (750),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/245 (61%), Positives = 193/245 (79%), Gaps = 1/245 (0%)
 Frame = -2

Query  901  NQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDW  722
            +Q ++V AL+SLD+SQSPKETSEHH+ERT QL  VVQEW+SQF K+I HQK YI+ LN W
Sbjct  1    SQSKVVTALKSLDISQSPKETSEHHHERTIQLWAVVQEWNSQFCKLIDHQKAYIKALNSW  60

Query  721  LKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTI  542
            LKLNL+PI+++L+EKVSSP R Q PPI  LL AW DL+ KLPDE+A++AI +F+A++NTI
Sbjct  61   LKLNLIPIESSLREKVSSPPRIQTPPIQRLLLAWHDLLQKLPDEIARSAIGNFAALINTI  120

Query  541  VQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQ  362
            + HQ +EMKLK+RC++T+KEL ++TRQFEDWY+KY+ RRT  ++ + D     + V ER+
Sbjct  121  MHHQEEEMKLKERCEETKKELSRKTRQFEDWYNKYITRRT-QEELDADDTTLKDAVTERK  179

Query  361  LQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  182
              ++ LK+RL+EEEEAY RQC  VR KSLTSLR  LPELF AMSE S ACS MY+ L++I
Sbjct  180  FVVDVLKKRLEEEEEAYQRQCGAVREKSLTSLRNHLPELFKAMSEISFACSGMYRDLKNI  239

Query  181  THPLN  167
                N
Sbjct  240  AQHKN  244



>gb|KFK35788.1| hypothetical protein AALP_AA4G036700 [Arabis alpina]
Length=807

 Score =   310 bits (793),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 198/256 (77%), Gaps = 2/256 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   L+SLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  495  AMGKMWEMMQMHHQRQAEISKILKSLDVSQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  554

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + K+PDE+A
Sbjct  555  IDHQKEYIKSLGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLDKIPDEMA  614

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +TAI +F+AV++TI+Q Q +EMKL+DRC++T+KEL ++ RQFE+WY+KYMQ+R P +DT 
Sbjct  615  RTAIINFAAVISTIMQQQEEEMKLRDRCEETKKELARKIRQFEEWYYKYMQKRGP-EDTN  673

Query  403  QDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
             DG   D + V+ RQ  +E +K+RL+EEEE+Y RQ  QVR KSL SLRT LPELF AMSE
Sbjct  674  PDGTEVDKDEVVVRQFNVEQIKKRLEEEEESYHRQSHQVREKSLASLRTRLPELFQAMSE  733

Query  226  FSRACSIMYQTLESIT  179
             + +CS MY+ +  +T
Sbjct  734  VAYSCSDMYRAVAYVT  749



>emb|CDY52975.1| BnaA06g01600D [Brassica napus]
Length=747

 Score =   307 bits (787),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 194/255 (76%), Gaps = 5/255 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  462  AMGKMWEMMQMHHQRQAEISKVLRSLDISQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  521

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I +QK YI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLH W D + K+PDE+A
Sbjct  522  IDNQKMYIKSLGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHVWYDRLDKIPDEMA  581

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN----  416
            +TAI +F+AVV+TI+Q Q +EMKL+DRC++TRKEL ++ RQFEDWYHKYMQ+R P     
Sbjct  582  RTAIINFAAVVSTIMQQQEEEMKLRDRCEETRKELGRKIRQFEDWYHKYMQKRGPEDMNA  641

Query  415  DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            D +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KS+ SLRT LPELF A
Sbjct  642  DGSEGDNEHKDEVVV-RQFNVEQIKKRLEEEEEAYQRQSQQVREKSIASLRTRLPELFQA  700

Query  235  MSEFSRACSIMYQTL  191
            MSE + +CS MY+ +
Sbjct  701  MSEVAYSCSGMYRAV  715



>ref|XP_003603595.1| hypothetical protein MTR_3g109450 [Medicago truncatula]
 gb|AES73846.1| BZIP protein [Medicago truncatula]
Length=712

 Score =   306 bits (783),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 199/256 (78%), Gaps = 1/256 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWE M  HH++Q +IV  L+SLD+SQ  KET++HHY+RT QL  V+QEW SQFEK+
Sbjct  451  GMANMWENMFMHHDSQLKIVTDLKSLDISQDHKETTKHHYDRTVQLWNVIQEWESQFEKL  510

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QK YI+ L  WLKLNL+PI++NLKEK+SSP R QNPPI ALL+AW D + KLPDELA
Sbjct  511  VTQQKHYIQALFSWLKLNLIPIESNLKEKISSPPRAQNPPIQALLYAWHDYLDKLPDELA  570

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+  Q +EMKLK++C++TRKE  ++ + FE+WY K++QRR P DD E
Sbjct  571  KSAITSFAAVIKTIILQQEEEMKLKEKCEETRKEFLRKNQAFEEWYQKHLQRRGP-DDPE  629

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
            +D  + +N V E+Q  +E+LK+RL+EE E++ + C+QVR KSL SL+T LPELF A+S++
Sbjct  630  RDDVNTNNPVSEKQFVVESLKKRLEEETESHKKLCVQVREKSLQSLKTRLPELFRALSDY  689

Query  223  SRACSIMYQTLESITH  176
            ++ACS  Y+ L+SI H
Sbjct  690  TQACSDAYEKLKSIAH  705



>ref|XP_009147692.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103871216 
[Brassica rapa]
Length=800

 Score =   308 bits (788),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 194/255 (76%), Gaps = 5/255 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  515  AMGKMWEMMQMHHQRQAEISKVLRSLDISQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  574

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I +QK YI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLH W D + K+PDE+A
Sbjct  575  IDNQKMYIKSLGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHVWYDRLDKIPDEMA  634

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND---  413
            +TAI +F+AVV+TI+Q Q +EMKL+DRC++TRKEL ++ RQFEDWYHKYMQ+R P D   
Sbjct  635  RTAIINFAAVVSTIMQQQEEEMKLRDRCEETRKELGRKIRQFEDWYHKYMQKRGPEDMNA  694

Query  412  -DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
              +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KS+ SLRT LPELF A
Sbjct  695  EGSEGDNEHKD-EVVVRQFNVEQIKKRLEEEEEAYQRQSQQVREKSIASLRTRLPELFQA  753

Query  235  MSEFSRACSIMYQTL  191
            MSE + +CS MY+ +
Sbjct  754  MSEVAYSCSGMYRAV  768



>ref|XP_003523728.1| PREDICTED: formin-like protein 8-like [Glycine max]
Length=699

 Score =   305 bits (781),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 146/263 (56%), Positives = 199/263 (76%), Gaps = 2/263 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA MWE M  HH++Q +IV  L+SLD+SQ+PKET++HHY+RT QL  V+QEWH QFEK++
Sbjct  437  MANMWENMCIHHDSQLKIVTDLKSLDISQAPKETTKHHYDRTVQLEKVIQEWHLQFEKLV  496

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
              QK YI+ LN WLKLNL+PI++NLKEK+SSP + QNPPI ALLHAW D + KLPDELAK
Sbjct  497  TQQKHYIKALNSWLKLNLIPIESNLKEKISSPPKAQNPPIQALLHAWHDYVDKLPDELAK  556

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            +AI SF AV+ TI+  Q +EMKLK+RC++TRKE  K+ + FE+WY K++ RR P++   +
Sbjct  557  SAISSFVAVIKTIILQQEEEMKLKERCEETRKEYFKKKQAFEEWYQKHLMRRGPDEAEHE  616

Query  400  DGP--HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
             G   + +N V ERQ  +E+LK+RL+EE E++ + C+QVR KSL SL+T LPELF A+S+
Sbjct  617  RGEEVNANNPVSERQFVVESLKKRLEEEIESHQKHCVQVREKSLQSLKTRLPELFRALSD  676

Query  226  FSRACSIMYQTLESITHPLNRES  158
            ++ AC+  Y+ L+ IT     E+
Sbjct  677  YAHACADAYEKLKLITQSRGGEA  699



>ref|XP_002308623.2| hypothetical protein POPTR_0006s26050g [Populus trichocarpa]
 gb|EEE92146.2| hypothetical protein POPTR_0006s26050g [Populus trichocarpa]
Length=767

 Score =   306 bits (783),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 152/259 (59%), Positives = 200/259 (77%), Gaps = 5/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW +M  HH++Q  IV  L+SLD++ + KETS+HH+ERT QL  VVQ WHSQFEK+
Sbjct  501  GMAKMWASMCMHHDSQLNIVTDLKSLDVNHAIKETSKHHHERTIQLWKVVQGWHSQFEKL  560

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  L  WLKLNL+PI+++LKEK SSP R QNPPI ALLH+W D + KLPD+LA
Sbjct  561  VTHQKQYIHTLTSWLKLNLIPIESSLKEKTSSPLRAQNPPIQALLHSWHDNLEKLPDDLA  620

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI+SF+AV+ TIV+HQ +EMKLK++C++TRKEL ++ + FE+W+ KYMQRRTP D T+
Sbjct  621  KSAIFSFAAVIETIVRHQEEEMKLKEKCEETRKELLRKNQAFEEWHQKYMQRRTP-DGTD  679

Query  403  QDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             D   ED N   V ERQL +E+L  RLKEE EA+ + C+QVR KS+ SL+  LPELF A+
Sbjct  680  ADRG-EDTNPNPVSERQLAVESLNIRLKEELEAHQKHCLQVREKSVGSLKLRLPELFRAL  738

Query  232  SEFSRACSIMYQTLESITH  176
            S+++ ACS  Y+ L SITH
Sbjct  739  SDYAHACSDSYEKLRSITH  757



>ref|XP_007150659.1| hypothetical protein PHAVU_005G170800g [Phaseolus vulgaris]
 gb|ESW22653.1| hypothetical protein PHAVU_005G170800g [Phaseolus vulgaris]
Length=744

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 196/266 (74%), Gaps = 3/266 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             +A MW+ M  +HE Q   V  L+ LD+SQSPK+TS+HH++RTYQL +VVQ+WHSQFE +
Sbjct  479  GIAEMWKLMLEYHEKQSDTVKLLKMLDISQSPKQTSDHHHDRTYQLLLVVQQWHSQFEML  538

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
              HQK YI  LN WLKLNL+PI+++LKEKVSSP R ++ PI  LL AW D + KLPDELA
Sbjct  539  ANHQKGYIMALNTWLKLNLIPIESSLKEKVSSPPRVRSTPIQGLLLAWNDRLEKLPDELA  598

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP---ND  413
            KT I +F AV++TI   Q DE+ +K +C+DTRKEL ++TRQFEDWY+KYMQ++ P   N 
Sbjct  599  KTNIGNFVAVIDTIFHQQADEITMKRKCEDTRKELSRKTRQFEDWYNKYMQKKIPDEYNP  658

Query  412  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            DT +D    D  V ERQ+ +E +K+RL++EEEAY RQC+QVR K+L SL+  +P+LF AM
Sbjct  659  DTAEDSNGPDEAVTERQVAVEQVKKRLEDEEEAYARQCLQVRQKTLGSLKNLMPDLFRAM  718

Query  232  SEFSRACSIMYQTLESITHPLNREST  155
            S+FS  CS MY  L SI+  L + S+
Sbjct  719  SDFSLECSKMYSELRSISQNLGQSSS  744



>ref|XP_007012028.1| Golgin subfamily A member 4 [Theobroma cacao]
 gb|EOY29647.1| Golgin subfamily A member 4 [Theobroma cacao]
Length=741

 Score =   305 bits (781),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 197/258 (76%), Gaps = 3/258 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW +M  HH +Q QIV  L+ LD++ + KET++HH+ERT QL  VVQEWH QF+K+
Sbjct  474  GMANMWASMCIHHNSQLQIVEKLKPLDIAHASKETTKHHHERTIQLHNVVQEWHLQFDKL  533

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R QNPPI ALLHAW D + KLPDE+A
Sbjct  534  VTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRAQNPPIQALLHAWHDYLEKLPDEVA  593

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K++I SF+AV+ TI+ HQ +EMKLK++C++TRKE  ++ + FE+WY KY QRRT +D+ +
Sbjct  594  KSSILSFAAVIKTIIIHQDEEMKLKEKCEETRKEFFRKNQAFEEWYQKYKQRRTASDEID  653

Query  403  QDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             +   + N    V ERQ  +++LK+RL+EE EAY + C+QVR KSL SL+  LPELF AM
Sbjct  654  AERGEDANAKDPVSERQFAVDSLKKRLEEEVEAYQKHCIQVREKSLGSLKIRLPELFRAM  713

Query  232  SEFSRACSIMYQTLESIT  179
            S++SRACS  Y+ L +IT
Sbjct  714  SDYSRACSDAYEKLRTIT  731



>ref|XP_002324252.2| hypothetical protein POPTR_0018s00880g [Populus trichocarpa]
 gb|EEF02817.2| hypothetical protein POPTR_0018s00880g [Populus trichocarpa]
Length=764

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 197/257 (77%), Gaps = 2/257 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW +M  HH++Q +IV  L+SLD++ + KET++HH+ERT QL  VVQ W S FEK+
Sbjct  498  GMAKMWASMCMHHDSQLKIVTNLKSLDVNHAIKETTKHHHERTIQLLKVVQGWLSHFEKL  557

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  L  WLKLNL+PI+++LKEK+SSP R QNPPI ALLH+W D + KLPDELA
Sbjct  558  VTHQKQYIHTLTSWLKLNLIPIESSLKEKISSPPRAQNPPIQALLHSWHDYLEKLPDELA  617

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AVV TIV HQ +EMKLK++C++TR+E  ++ + FE+WY KYMQRRTP D+T+
Sbjct  618  KSAISSFAAVVETIVHHQEEEMKLKEKCEETRREFMRKNQAFEEWYQKYMQRRTPTDETD  677

Query  403  QDGPHE--DNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
             D   +   N V ERQ  +E+LK+RL+EE EA+ + C+QVR KS+ SL+  LPELF AMS
Sbjct  678  ADRGEDANPNPVSERQFVVESLKKRLEEEIEAHGKHCLQVREKSVGSLKIRLPELFRAMS  737

Query  229  EFSRACSIMYQTLESIT  179
            +++ ACS  Y+ L SIT
Sbjct  738  DYAHACSDAYEKLRSIT  754



>ref|XP_010462070.1| PREDICTED: uncharacterized protein LOC104742736 [Camelina sativa]
Length=808

 Score =   306 bits (784),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 195/259 (75%), Gaps = 5/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  533  AMGKMWEMMQKHHQRQAEISKVLRSLDVSQTVKETNDHHHERTIQLLAVVQEWHTQFCRM  592

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQKEYI+ L  W+KLNL+PI++ LKEKVSSP R  NP I  LLH W D + K+PDE+A
Sbjct  593  VDHQKEYIKALAGWIKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHVWYDRLDKIPDEMA  652

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +TAI +F+AV++TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWY+KYMQ+R P +   
Sbjct  653  RTAIINFAAVISTIMQQQEDEINLRNKCEETRKELGRKIRQFEDWYYKYMQKRGP-EGMN  711

Query  403  QDGPHEDNN----VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
             DG   DNN    V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LPELF A
Sbjct  712  PDGSEADNNHKDEVVVRQFNVEQIKKRLEEEEEAYHRQSQQVREKSLASLRTRLPELFQA  771

Query  235  MSEFSRACSIMYQTLESIT  179
            MSE + +CS MY+ +  +T
Sbjct  772  MSEVAYSCSDMYRAVTYVT  790



>emb|CDY61085.1| BnaC06g41130D [Brassica napus]
Length=746

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 193/255 (76%), Gaps = 5/255 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   L+SLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  461  AMGKMWEMMQMHHQRQAEISKLLKSLDISQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  520

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I +QK YI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLH W D + K+PDE+A
Sbjct  521  IDNQKMYIKSLGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHIWYDRLDKIPDEMA  580

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN----  416
            +TAI +F+AVV+TI+Q Q +EMKL+DRC +TRKEL ++ RQFEDWYHKYMQ+R P     
Sbjct  581  RTAIINFAAVVSTIMQQQEEEMKLRDRCGETRKELGRKIRQFEDWYHKYMQKRGPEDMNA  640

Query  415  DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            D +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KS+ SLRT LPELF A
Sbjct  641  DGSEADNEHKD-EVVVRQFNVEQIKKRLEEEEEAYQRQSQQVREKSIASLRTRLPELFQA  699

Query  235  MSEFSRACSIMYQTL  191
            MSE + +CS MY+ +
Sbjct  700  MSEVAYSCSGMYRAV  714



>gb|KHN18210.1| hypothetical protein glysoja_025100 [Glycine soja]
Length=625

 Score =   301 bits (770),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 197/256 (77%), Gaps = 2/256 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA MWE M  HH++Q +IV  L+SLD+SQ+PKET++HHY+RT QL  V+ EWH QFEK++
Sbjct  363  MANMWENMCLHHDSQLKIVTDLKSLDISQAPKETTKHHYDRTVQLEKVILEWHLQFEKLV  422

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
              QK YI+ LN WLKLNL+PI++NLKEK+SSP + QNPPI ALLHAW D + KLPDELAK
Sbjct  423  TQQKHYIKALNSWLKLNLIPIESNLKEKISSPPKAQNPPIQALLHAWHDYVDKLPDELAK  482

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            +AI SF+AV+ TI+  Q +EMKLK+RC++TRKE  K+ + FE+WY K++ RR P++   +
Sbjct  483  SAISSFAAVIKTILLQQEEEMKLKERCEETRKEYLKKKQAFEEWYQKHLMRRGPDEAEHE  542

Query  400  DGP--HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
             G   + +N V ERQ  +E+L++RL+EE E++ + C+QVR KSL SL+T LPELF A+S+
Sbjct  543  RGEEVNTNNPVSERQFVVESLQKRLEEEIESHQKHCIQVREKSLQSLKTRLPELFRALSD  602

Query  226  FSRACSIMYQTLESIT  179
            ++ AC+  Y+ L+ IT
Sbjct  603  YAHACAEAYEKLKLIT  618



>dbj|BAF00450.1| putative bZIP protein [Arabidopsis thaliana]
Length=798

 Score =   305 bits (780),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  525  AMGKMWEMMQIHHQRQAEISKVLRSLDVSQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  584

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + K+PDE+A
Sbjct  585  IDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLDKIPDEMA  644

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP---ND  413
            K+AI +F+AVV+TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKY+Q+R P   N 
Sbjct  645  KSAIINFAAVVSTIMQQQEDEISLRNKCEETRKELGRKIRQFEDWYHKYIQKRGPEGMNP  704

Query  412  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            D E D  H D  V  RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LPELF AM
Sbjct  705  D-EADNDHND-EVAVRQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTRLPELFQAM  762

Query  232  SEFSRACSIMYQTLESITHPLNRES  158
            SE + +CS MY+   +IT+   R+S
Sbjct  763  SEVAYSCSDMYR---AITYASKRQS  784



>ref|NP_849796.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG51544.1|AC037424_9 bZIP protein, putative; 48652-45869 [Arabidopsis thaliana]
 gb|AEE32783.1| uncharacterized protein AT1G52320 [Arabidopsis thaliana]
Length=798

 Score =   305 bits (780),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 155/265 (58%), Positives = 199/265 (75%), Gaps = 8/265 (3%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  525  AMGKMWEMMQIHHQRQAEISKVLRSLDVSQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  584

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + K+PDE+A
Sbjct  585  IDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLDKIPDEMA  644

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP---ND  413
            K+AI +F+AVV+TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKY+Q+R P   N 
Sbjct  645  KSAIINFAAVVSTIMQQQEDEISLRNKCEETRKELGRKIRQFEDWYHKYIQKRGPEGMNP  704

Query  412  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            D E D  H D  V  RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LPELF AM
Sbjct  705  D-EADNDHND-EVAVRQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTRLPELFQAM  762

Query  232  SEFSRACSIMYQTLESITHPLNRES  158
            SE + +CS MY+   +IT+   R+S
Sbjct  763  SEVAYSCSDMYR---AITYASKRQS  784



>ref|XP_002891687.1| hypothetical protein ARALYDRAFT_474348 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67946.1| hypothetical protein ARALYDRAFT_474348 [Arabidopsis lyrata subsp. 
lyrata]
Length=800

 Score =   304 bits (779),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 197/259 (76%), Gaps = 5/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   L+SLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  521  AMGKMWEMMQMHHQRQAEISKVLKSLDVSQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  580

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D I K+PDE+A
Sbjct  581  IDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRIDKIPDEMA  640

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN----  416
            +TAI +F+AVV+TI+Q Q DE+ L+++C++T+KEL ++ RQFE+WY+KYMQ+R P     
Sbjct  641  RTAIINFAAVVSTIMQQQEDEINLRNKCEETKKELGRKIRQFEEWYYKYMQKRGPEGMNP  700

Query  415  DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            + +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LPELF A
Sbjct  701  EGSEADNDHKD-EVMVRQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTRLPELFQA  759

Query  235  MSEFSRACSIMYQTLESIT  179
            MSE + +CS MY+ +  +T
Sbjct  760  MSEVAYSCSDMYRAVTYVT  778



>ref|XP_011007598.1| PREDICTED: uncharacterized protein LOC105113217 [Populus euphratica]
Length=688

 Score =   301 bits (772),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 147/261 (56%), Positives = 206/261 (79%), Gaps = 2/261 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW+TM+ HHE Q +IV ALR+LD+SQSPKETSEHH++RT+QL VVVQ W SQF K+
Sbjct  426  GMATMWDTMRYHHEAQSKIVNALRALDISQSPKETSEHHHDRTFQLLVVVQGWQSQFCKL  485

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I +QK Y++ LN WLKLNL+PI+++LKEKVSSP R QNPPI +LL AW D + KLPDE+A
Sbjct  486  IDNQKGYVKALNCWLKLNLIPIESSLKEKVSSPPRVQNPPIQSLLIAWHDFLDKLPDEVA  545

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DT  407
            ++AI +F++V++ I+Q+Q +EMKLK++C++TRKEL ++T++F+ WY K+MQ++ P + D 
Sbjct  546  RSAINNFASVIHAILQNQEEEMKLKEKCEETRKELSQKTKKFQSWYRKHMQQKMPAEFDP  605

Query  406  EQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            E      DN+ V +RQ  ++A+K+RL+EEEEAY +Q +QVR KSL SL+T LP+LF AM 
Sbjct  606  ELTEDKSDNDAVADRQFAVDAVKKRLEEEEEAYKKQRIQVREKSLASLKTRLPDLFRAMF  665

Query  229  EFSRACSIMYQTLESITHPLN  167
            + ++ACS MY+ L+ I+   N
Sbjct  666  DIAQACSEMYRNLKFISQRRN  686



>ref|XP_002516584.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45925.1| conserved hypothetical protein [Ricinus communis]
Length=728

 Score =   302 bits (774),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 198/259 (76%), Gaps = 3/259 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW +M+ HH++Q +IV  L+SLD+S + KET+ HH+ RT QL  VVQEWH+QF+K+
Sbjct  461  GMAKMWASMRVHHDSQLKIVTDLKSLDVSHAVKETTNHHHARTKQLYNVVQEWHTQFDKL  520

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ L  WLKLNL+PI+++LKEK+SSP +  NPPI ALL++W D + KLPDE+A
Sbjct  521  LTHQKQYIQILKSWLKLNLIPIESSLKEKISSPPKIPNPPIQALLYSWHDHLEKLPDEVA  580

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI  HQ +EMKLK++C++TRKE  ++ + F+DWY K+MQRR P D+TE
Sbjct  581  KSAISSFAAVIKTIELHQEEEMKLKEKCEETRKEFLRKNQAFDDWYQKHMQRRNPTDETE  640

Query  403  QDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             D   + N+   V ERQ  +E+LK+RL+EE E Y R C+QVR KSL SL+  LPELF AM
Sbjct  641  ADRGEDANSRDLVSERQFAVESLKKRLEEEVETYQRHCLQVREKSLGSLKIRLPELFRAM  700

Query  232  SEFSRACSIMYQTLESITH  176
            S+++ ACS  Y+ L ++TH
Sbjct  701  SDYAYACSDAYEKLRALTH  719



>ref|XP_002281782.1| PREDICTED: uncharacterized protein LOC100259547 [Vitis vinifera]
 ref|XP_010648551.1| PREDICTED: uncharacterized protein LOC100259547 [Vitis vinifera]
Length=707

 Score =   301 bits (772),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 200/258 (78%), Gaps = 3/258 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M   H +Q ++V  L+S+D+SQ+PKETS+HH+ERT QL   +Q WHSQFEK+
Sbjct  440  GMAKMWNDMCMQHNSQLKMVTDLKSIDISQAPKETSKHHHERTIQLWNEIQGWHSQFEKL  499

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + H+K+YI+ LN WLKLNL+PI+++LKEK+SSP RPQ+PPI ALLH+W D + KLP ELA
Sbjct  500  VTHEKQYIQALNSWLKLNLIPIESSLKEKISSPPRPQHPPIQALLHSWHDSLEKLPHELA  559

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK++C++T+KE  ++ + F+DWY KYMQRRTP D+T+
Sbjct  560  KSAISSFAAVIKTIILHQEEEMKLKEKCEETQKEYSRKHQAFQDWYQKYMQRRTPPDETD  619

Query  403  QDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             +   E N    + E+Q  +E+LK++L+EE EA+ R C+QVR KSL SL+  LPELF A+
Sbjct  620  PEKGDEANPKDPISEKQFVVESLKKKLEEEVEAHQRHCVQVREKSLGSLKLRLPELFRAL  679

Query  232  SEFSRACSIMYQTLESIT  179
            ++++ ACS  YQ L++IT
Sbjct  680  TDYTHACSDAYQRLKAIT  697



>ref|XP_011019684.1| PREDICTED: uncharacterized protein LOC105122326 [Populus euphratica]
Length=763

 Score =   303 bits (776),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/259 (59%), Positives = 198/259 (76%), Gaps = 5/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW +M  HH++Q  IV  L+SLD++ + KETS+HH+ERT QL  VVQ WHSQFEK+
Sbjct  497  GMAKMWASMCMHHDSQLNIVTDLKSLDVNHAIKETSKHHHERTIQLWKVVQGWHSQFEKL  556

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  L  WLKLNL+PI+++LKEK SSP R QNPPI ALLH+W D + KLPD+LA
Sbjct  557  VTHQKQYIHTLTSWLKLNLIPIESSLKEKTSSPPRAQNPPIQALLHSWHDNLEKLPDDLA  616

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV  TIV HQ +EMKLK++C++TRKEL ++ + F++W+ KYMQRRTP D T+
Sbjct  617  KSAILSFAAVKETIVHHQEEEMKLKEKCEETRKELLRKNQAFKEWHQKYMQRRTP-DGTD  675

Query  403  QDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             D   ED N   V ERQL +E+L  RLKEE EA+ + C+QVR KS+ SL+  LPELF A+
Sbjct  676  ADRG-EDTNPDPVSERQLAVESLNIRLKEEVEAHQKHCLQVREKSVGSLKLRLPELFRAL  734

Query  232  SEFSRACSIMYQTLESITH  176
            S+++RACS  Y+ L SITH
Sbjct  735  SDYARACSDSYEKLRSITH  753



>ref|XP_003527819.1| PREDICTED: uncharacterized protein LOC100807597 [Glycine max]
Length=711

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 197/256 (77%), Gaps = 2/256 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA MWE M  HH++Q +IV  L+SLD+SQ+PKET++HHY+RT QL  V+ EWH QFEK++
Sbjct  449  MANMWENMCLHHDSQLKIVTDLKSLDISQAPKETTKHHYDRTVQLEKVILEWHLQFEKLV  508

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
              QK YI+ LN WLKLNL+PI++NLKEK+SSP + QNPPI ALLHAW D + KLPDELAK
Sbjct  509  TQQKHYIKALNSWLKLNLIPIESNLKEKISSPPKAQNPPIQALLHAWHDYVDKLPDELAK  568

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            +AI SF+AV+ TI+  Q +EMKLK+RC++TRKE  K+ + FE+WY K++ RR P++   +
Sbjct  569  SAISSFAAVIKTILLQQEEEMKLKERCEETRKEYLKKKQAFEEWYQKHLMRRGPDEAEHE  628

Query  400  DGP--HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
             G   + +N V ERQ  +E+L++RL+EE E++ + C+QVR KSL SL+T LPELF A+S+
Sbjct  629  RGEEVNTNNPVSERQFVVESLQKRLEEEIESHQKHCIQVREKSLQSLKTRLPELFRALSD  688

Query  226  FSRACSIMYQTLESIT  179
            ++ AC+  Y+ L+ IT
Sbjct  689  YAHACAEAYEKLKLIT  704



>ref|XP_010500831.1| PREDICTED: uncharacterized protein LOC104778154 [Camelina sativa]
Length=809

 Score =   303 bits (776),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 195/259 (75%), Gaps = 5/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  534  AMGKMWEMMQKHHQRQAEISKVLRSLDVSQTVKETNDHHHERTIQLLAVVQEWHTQFCRM  593

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ L  W+KLNL+PI++ LKEKVSSP R  NP I  LL  W D + K+PDE+A
Sbjct  594  IDHQKEYIKALAGWIKLNLIPIESTLKEKVSSPPRVPNPAIQKLLTVWYDRLDKIPDEMA  653

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN----  416
            +TAI +F+AV++TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWY+KYMQ+R P     
Sbjct  654  RTAIINFAAVISTIMQQQEDEINLRNKCEETRKELGRKIRQFEDWYYKYMQKRGPEGMNP  713

Query  415  DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            D +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LPELF A
Sbjct  714  DGSEADNDHKD-EVVVRQFNVEQIKKRLEEEEEAYHRQSQQVREKSLASLRTRLPELFQA  772

Query  235  MSEFSRACSIMYQTLESIT  179
            MSE + +CS MY+ +  +T
Sbjct  773  MSEVAYSCSDMYRAVTYVT  791



>ref|XP_010479738.1| PREDICTED: kinesin-related protein 4-like [Camelina sativa]
Length=804

 Score =   303 bits (775),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 194/259 (75%), Gaps = 5/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M  HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  529  AMGKMWEMMHLHHQRQAEISKVLRSLDVSQTVKETNDHHHERTIQLLAVVQEWHTQFCRM  588

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQKEYI+ L  W+KLNL+PI++ LKEKVSSP R  NP I  LL  W D + K+PDE+A
Sbjct  589  VDHQKEYIKALAGWIKLNLIPIESTLKEKVSSPPRVPNPAIQKLLTVWYDRLDKIPDEMA  648

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN----  416
            +TAI +F+AV++TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKYMQ+R P     
Sbjct  649  RTAIINFAAVISTIMQQQEDEINLRNKCEETRKELGRKIRQFEDWYHKYMQKRGPEGMNP  708

Query  415  DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            D +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LPELF A
Sbjct  709  DGSEADNDHKD-EVVVRQFNVEQIKKRLEEEEEAYHRQSQQVREKSLASLRTRLPELFQA  767

Query  235  MSEFSRACSIMYQTLESIT  179
            MSE + +CS MY+ +  +T
Sbjct  768  MSEVAYSCSDMYRAVTYVT  786



>gb|KJB54879.1| hypothetical protein B456_009G052500 [Gossypium raimondii]
Length=736

 Score =   301 bits (771),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/257 (56%), Positives = 198/257 (77%), Gaps = 3/257 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW  M  HH++Q +IV  L+SLD++ + KET++HH+ERT QL  VVQEWHSQF+K+
Sbjct  468  GMANMWARMCMHHDSQLKIVEKLKSLDIAFASKETTKHHHERTIQLHNVVQEWHSQFDKL  527

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ LN+WLKLNL+PI+++LKEKVSSP R QNPPI  LLH W D + KLPDE+A
Sbjct  528  VTHQKQYIQALNNWLKLNLIPIESSLKEKVSSPPRAQNPPIQKLLHTWHDYLEKLPDEVA  587

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK++C++TRKE  ++++ FE+WYHKY QRR+ +D+ +
Sbjct  588  KSAISSFAAVIKTIIIHQEEEMKLKEKCEETRKEFLRKSQAFEEWYHKYRQRRSGSDEMD  647

Query  403  QDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             +   + N    V ERQ  +E+LK+RL+EE EA+ + C+QVR KSL SL+  LPELF AM
Sbjct  648  AERGEDANAKDPVSERQFAVESLKKRLEEEVEAHEKHCIQVREKSLGSLKIRLPELFRAM  707

Query  232  SEFSRACSIMYQTLESI  182
            S++S ACS  Y+ L ++
Sbjct  708  SDYSHACSDAYEKLRTV  724



>ref|XP_008362707.1| PREDICTED: uncharacterized protein LOC103426389 isoform X2 [Malus 
domestica]
Length=711

 Score =   300 bits (768),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 199/254 (78%), Gaps = 2/254 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            M  MW TM+ HHE Q +IV ALRSLD+SQ PK TSEHH+ERT QL  VVQ WH +FEK++
Sbjct  445  MXSMWGTMRAHHETQSKIVTALRSLDISQCPKHTSEHHHERTIQLFGVVQGWHGEFEKLV  504

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
              QKEYI+ LN+WLKLNL+PI++NLKEKVSSP R Q PPI  LL AW D + KLPD++A+
Sbjct  505  SQQKEYIKALNNWLKLNLIPIESNLKEKVSSPPRIQRPPIQELLLAWHDHLEKLPDDVAR  564

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DTE  404
             AI++F+AV+NTI+ HQ +E+K+K++C+DTRKEL ++ RQFEDWY+K M +  P++ DT+
Sbjct  565  MAIHNFAAVINTIMIHQEEEIKMKEKCEDTRKELSRKARQFEDWYNKNMHKTIPDEGDTD  624

Query  403  QDGPHEDNNVI-ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
            +   H  ++V+ E+Q  +E +K+RL+EEEE+Y R C+QVR KS+ SL+T LPELF  +S+
Sbjct  625  RPEGHTRSDVVAEKQFAVETVKKRLEEEEESYERLCLQVREKSIASLKTRLPELFGVLSD  684

Query  226  FSRACSIMYQTLES  185
            F+ +CS MY++L S
Sbjct  685  FAYSCSEMYRSLRS  698



>ref|XP_003597769.1| hypothetical protein MTR_2g102050 [Medicago truncatula]
 gb|AES68020.1| BZIP protein [Medicago truncatula]
Length=760

 Score =   301 bits (771),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 195/264 (74%), Gaps = 2/264 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA MW+ M   HE Q + V  LRSLD SQSPK+TSEHH+ERTYQL VVVQ+WH QFE ++
Sbjct  497  MAAMWKKMLSEHEKQSETVTLLRSLDPSQSPKQTSEHHHERTYQLLVVVQQWHLQFEMLV  556

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             +QK YI+ L++WLKLNL+PI+++LKEKVSSP R ++PP+  LLHAW D + K+PD+LA+
Sbjct  557  NNQKGYIKSLSNWLKLNLIPIESSLKEKVSSPPRVRSPPVQGLLHAWHDRLEKIPDDLAR  616

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN--DDT  407
            TAI +F+AV++TI   Q DEM LK +C+++RKEL ++TRQFEDWYHKYMQR+ P   D  
Sbjct  617  TAIGNFAAVIDTIFNQQEDEMVLKRKCEESRKELSRKTRQFEDWYHKYMQRKMPEEVDPE  676

Query  406  EQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
             +D    D  V E+Q  +E +++RL+ EE  Y +QC+QVR K+L SL+  +PELF AM +
Sbjct  677  AEDANAPDEVVTEKQFLVEQVRKRLEHEEAEYEKQCIQVRQKTLGSLKNRMPELFRAMCD  736

Query  226  FSRACSIMYQTLESITHPLNREST  155
            FS  CS MY  L SI+  L + S+
Sbjct  737  FSLECSKMYMELGSISQHLGQNSS  760



>ref|XP_008362706.1| PREDICTED: uncharacterized protein LOC103426389 isoform X1 [Malus 
domestica]
Length=744

 Score =   300 bits (768),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 199/255 (78%), Gaps = 2/255 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW TM+ HHE Q +IV ALRSLD+SQ PK TSEHH+ERT QL  VVQ WH +FEK+
Sbjct  477  GMXSMWGTMRAHHETQSKIVTALRSLDISQCPKHTSEHHHERTIQLFGVVQGWHGEFEKL  536

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QKEYI+ LN+WLKLNL+PI++NLKEKVSSP R Q PPI  LL AW D + KLPD++A
Sbjct  537  VSQQKEYIKALNNWLKLNLIPIESNLKEKVSSPPRIQRPPIQELLLAWHDHLEKLPDDVA  596

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DT  407
            + AI++F+AV+NTI+ HQ +E+K+K++C+DTRKEL ++ RQFEDWY+K M +  P++ DT
Sbjct  597  RMAIHNFAAVINTIMIHQEEEIKMKEKCEDTRKELSRKARQFEDWYNKNMHKTIPDEGDT  656

Query  406  EQDGPHEDNNVI-ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            ++   H  ++V+ E+Q  +E +K+RL+EEEE+Y R C+QVR KS+ SL+T LPELF  +S
Sbjct  657  DRPEGHTRSDVVAEKQFAVETVKKRLEEEEESYERLCLQVREKSIASLKTRLPELFGVLS  716

Query  229  EFSRACSIMYQTLES  185
            +F+ +CS MY++L S
Sbjct  717  DFAYSCSEMYRSLRS  731



>ref|XP_007024146.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007024147.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007024148.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26768.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26769.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY26770.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=736

 Score =   300 bits (767),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 208/261 (80%), Gaps = 2/261 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWETMK  H++Q +IV  L+ LD+SQSPKETSEHH+ERT QL  +VQ+WH QF K+
Sbjct  471  GMATMWETMKVQHDSQFRIVTVLKDLDLSQSPKETSEHHHERTIQLLAIVQDWHMQFCKL  530

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YI  LN+WL+LNLVPI+++LKEKVSSP R + PPIL LL AWQ+ + KLPDE+A
Sbjct  531  VDHQKGYIIALNNWLRLNLVPIESSLKEKVSSPPRVETPPILGLLTAWQNQLEKLPDEIA  590

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DT  407
            ++AI +F+ V++TI+QHQLDEMKLK++C+++ KEL+++ RQF+DWYHKYMQRRTP + D 
Sbjct  591  RSAINNFAHVLDTIMQHQLDEMKLKEKCEESEKELQRKERQFKDWYHKYMQRRTPEELDP  650

Query  406  EQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            E+   + +N  V ERQ+ +EA+K+R +EE+EAY R C+QVR KS+ SL+T LPELF+AM+
Sbjct  651  ERTEANPNNEAVTERQVMVEAVKKRWEEEKEAYQRLCIQVREKSMVSLKTRLPELFNAMT  710

Query  229  EFSRACSIMYQTLESITHPLN  167
              ++ACS +Y  L SI+H  N
Sbjct  711  GIAKACSKLYGELRSISHSKN  731



>ref|XP_007137162.1| hypothetical protein PHAVU_009G105100g [Phaseolus vulgaris]
 gb|ESW09156.1| hypothetical protein PHAVU_009G105100g [Phaseolus vulgaris]
Length=694

 Score =   298 bits (764),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 194/256 (76%), Gaps = 2/256 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            M  MWE M  +H++Q +IV  ++SLD+SQ+PKET++HHYERT QL  V+QEWH QFEK++
Sbjct  432  MGNMWEHMCSYHDSQLKIVTDIKSLDISQAPKETTKHHYERTVQLWNVIQEWHLQFEKLV  491

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
              QK YI+ LN WLKLNL+PI+ NLKEK+SSP + QNPPI ALLHAW D + KLPDELAK
Sbjct  492  SQQKHYIKALNSWLKLNLIPIERNLKEKISSPPKAQNPPIQALLHAWHDYVDKLPDELAK  551

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            +AI SF+AV+ TI+  Q +EMKLK+RC++TRKE  K+ + FE+WY K++ R+ P D   +
Sbjct  552  SAISSFAAVIKTIILQQEEEMKLKERCEETRKEYLKKKQAFEEWYQKHLMRKGPEDAEHE  611

Query  400  DGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
             G   +  N V +RQ  +E+L+++L+EE E++ +QC+QVR KSL S +T LPELF A+S+
Sbjct  612  RGEEVNTHNPVSDRQFVVESLQKKLEEEIESHQKQCVQVREKSLQSFKTRLPELFRALSD  671

Query  226  FSRACSIMYQTLESIT  179
            +S AC   Y+ L+SIT
Sbjct  672  YSHACFDAYEKLKSIT  687



>ref|XP_010251918.1| PREDICTED: uncharacterized protein LOC104593650 [Nelumbo nucifera]
Length=740

 Score =   299 bits (766),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 196/258 (76%), Gaps = 5/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +MA MWE+M  HH++Q +IV  LR+LD+S +PKETSEHH+ERT QL  VVQEWHSQF+K+
Sbjct  473  AMANMWESMHAHHDSQLKIVSDLRALDLSHAPKETSEHHHERTVQLCRVVQEWHSQFQKL  532

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQKEYIR LN+WLKLNL+PI+++LKEKVSSP R   PPI +LLHAW D + KLP ELA
Sbjct  533  VTHQKEYIRALNNWLKLNLIPIESSLKEKVSSPLRVHRPPIQSLLHAWHDNLEKLPYELA  592

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
             TAI +F+AV+ TI+ HQ DEMKLK++ ++T KE  ++ + FE+W+ KYMQRRT +D+ +
Sbjct  593  GTAISTFAAVIKTIIVHQEDEMKLKEKWEETNKEYIRKKQAFEEWHQKYMQRRTQSDEMD  652

Query  403  ----QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
                +D  H+D  V E+Q  +E L++RL+EE EA+ + C QVR KS  SL+  LPELF A
Sbjct  653  PERAEDANHKD-PVTEKQFVVETLRKRLEEEIEAHQKLCRQVREKSAGSLKMHLPELFRA  711

Query  235  MSEFSRACSIMYQTLESI  182
            MS+F+ ACS MY  L SI
Sbjct  712  MSDFAFACSDMYNRLRSI  729



>ref|XP_010942485.1| PREDICTED: uncharacterized protein LOC105060463 [Elaeis guineensis]
Length=734

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/263 (56%), Positives = 193/263 (73%), Gaps = 4/263 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH+NQ + VL L+ LD+S +PKETS+HHY+RT QL  VV+ WHSQF+K+
Sbjct  468  GMAKMWEAMYVHHDNQLKTVLNLKILDISNAPKETSQHHYKRTMQLFDVVKGWHSQFDKL  527

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ L+ WLK N++PI+++LKEKVSSP RP  PPI ALLHAW D + KLPDELA
Sbjct  528  VSHQKDYIQALSSWLKSNVIPIESSLKEKVSSPPRPHQPPIQALLHAWHDHLEKLPDELA  587

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP----N  416
            K+AI SFSAV+NTI+  Q +E+K K++C +TRKE  K+TR FEDWY KY  RR       
Sbjct  588  KSAILSFSAVINTIMTLQQEELKQKEKCNETRKEYLKKTRAFEDWYSKYSHRRAALSEEA  647

Query  415  DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
                 +G  + + V+ER++ +E +K RL EEEE + + C QVR KS  SL+T LPELF A
Sbjct  648  GQEGGEGADQKDPVVERKIAVETVKSRLDEEEENHEKLCKQVREKSFGSLKTHLPELFRA  707

Query  235  MSEFSRACSIMYQTLESITHPLN  167
            MS+F+ ACS MY+ L+SI+ P N
Sbjct  708  MSDFAHACSEMYKMLKSISQPQN  730



>ref|XP_006306796.1| hypothetical protein CARUB_v10008333mg [Capsella rubella]
 gb|EOA39694.1| hypothetical protein CARUB_v10008333mg [Capsella rubella]
Length=801

 Score =   299 bits (765),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 196/259 (76%), Gaps = 5/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  526  AMGKMWEMMQMHHQRQAEISKVLRSLDISQAVKETNDHHHERTIQLLAVVQEWHTQFCRM  585

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LL  W D + K+PDE+A
Sbjct  586  IDHQKEYIKALLGWLKLNLIPIESTLKEKVSSPPRVPNPAIHKLLTIWYDRLDKIPDEMA  645

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN----  416
            +TAI +F+AV++TI+Q Q DE+ L+++C++TRKEL ++ RQFE+WY+KYMQ+R P     
Sbjct  646  RTAIINFAAVISTIMQQQEDEISLRNKCEETRKELGRKIRQFEEWYYKYMQKRGPEGMNP  705

Query  415  DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            D +E D  H+D  V+ RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LPELF A
Sbjct  706  DGSEADNDHKD-EVVVRQFNVEQIKKRLEEEEEAYHRQSQQVREKSLASLRTRLPELFQA  764

Query  235  MSEFSRACSIMYQTLESIT  179
            MSE + +CS MY+++  +T
Sbjct  765  MSEVAYSCSDMYRSVTYMT  783



>ref|XP_004292865.1| PREDICTED: uncharacterized protein LOC101308445 [Fragaria vesca 
subsp. vesca]
Length=722

 Score =   297 bits (760),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 195/260 (75%), Gaps = 4/260 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M  HH +Q  IV  L++LD+S +P ET++HH+ERT QL  VVQ WHS+FEK+
Sbjct  455  AMGKMWENMGAHHSSQLTIVTDLKALDISHTPMETTKHHHERTEQLFNVVQHWHSEFEKL  514

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            ++HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q PPI  LL AW D + KLPDELA
Sbjct  515  VLHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQRPPIQPLLLAWHDFLEKLPDELA  574

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND---  413
            K+A  SF+AV+ TI+ HQ +EMKLK++ ++TRKE  ++ + F+DWY KYMQR  P +   
Sbjct  575  KSATSSFAAVIKTILLHQEEEMKLKEQFENTRKEFLRKNQAFDDWYQKYMQRHGPGEADQ  634

Query  412  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            +  +D  H+D  + ERQ  +E+LK++++EE EA+ R C+QVR KSL SL+T LPELF AM
Sbjct  635  ERSEDANHKD-PIAERQFAVESLKKKMEEEAEAHQRHCIQVREKSLGSLKTRLPELFRAM  693

Query  232  SEFSRACSIMYQTLESITHP  173
            S+++ AC+  Y  L+S+T P
Sbjct  694  SDYAHACADAYGKLKSVTMP  713



>ref|XP_008447501.1| PREDICTED: uncharacterized protein LOC103489933 [Cucumis melo]
Length=736

 Score =   297 bits (760),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 195/256 (76%), Gaps = 2/256 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW TM+ HHE Q +IV ALR++D+SQSPKETS HHYERT QL  VV+EWHSQFEK+
Sbjct  478  GMAMMWNTMRAHHEAQLKIVSALRAMDLSQSPKETSTHHYERTVQLCGVVREWHSQFEKL  537

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QK+YI+ LN WLKLNL+PI+++LKEKVSSP R QNPPI  LL AW D + +LPDE  
Sbjct  538  VRCQKDYIKSLNSWLKLNLIPIESSLKEKVSSPPRVQNPPIQKLLLAWHDQLERLPDEHL  597

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DT  407
            +TAI++F AV+NTI+  Q +E KLK + ++T KEL+++ R F+DW++KY QRR P+D D 
Sbjct  598  RTAIFTFGAVINTIMLQQDEERKLKLKWEETEKELDRKQRHFDDWHYKYQQRRIPDDMDP  657

Query  406  EQDGPH-EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            E+     +D  V E+ + +E+LK+RL+EE+E + +QC+ VR KSL SL+  LPELF A+S
Sbjct  658  ERSEERTQDAAVTEKSIAVESLKKRLEEEKETHAKQCLHVREKSLVSLKNQLPELFRALS  717

Query  229  EFSRACSIMYQTLESI  182
            EFS A S MY++L SI
Sbjct  718  EFSFASSEMYKSLSSI  733



>gb|KJB13152.1| hypothetical protein B456_002G059600 [Gossypium raimondii]
 gb|KJB13153.1| hypothetical protein B456_002G059600 [Gossypium raimondii]
Length=742

 Score =   295 bits (755),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 201/261 (77%), Gaps = 3/261 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRS-LDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            M  MWETM+  H++QC+IV  LR  LD+SQS +ETSEHH+ERT QL  +VQ+WH QF K+
Sbjct  477  MVIMWETMREEHDSQCRIVAILRDHLDLSQSAQETSEHHHERTIQLLAIVQDWHMQFCKL  536

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ LN+WL+LNL+PI+++LKEKVSSP R ++PPI  L+ AWQD + KLPDE+A
Sbjct  537  IDHQKEYIKALNNWLRLNLIPIESSLKEKVSSPPRVESPPIQRLIFAWQDKLDKLPDEIA  596

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN--DD  410
            ++AI +F+ V++ I+QHQLDEMKLK++C+ ++KEL+K+ +QFEDWY+KYMQRRTP   D 
Sbjct  597  RSAINNFAHVIDAIMQHQLDEMKLKEKCEGSQKELKKKQQQFEDWYNKYMQRRTPEELDP  656

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            T  D    ++ V ERQL ++A+K+RL EEEEAY    +QVR KSL SL+T LPELF AMS
Sbjct  657  TRTDDNSNNDAVTERQLMVDAVKKRLGEEEEAYRILRIQVREKSLVSLKTRLPELFRAMS  716

Query  229  EFSRACSIMYQTLESITHPLN  167
              + ACS MY  L +I+   N
Sbjct  717  TIAVACSKMYGELRAISRSRN  737



>ref|XP_004150356.1| PREDICTED: uncharacterized protein LOC101203914 [Cucumis sativus]
 gb|KGN58063.1| hypothetical protein Csa_3G481230 [Cucumis sativus]
Length=722

 Score =   295 bits (754),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 191/256 (75%), Gaps = 2/256 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW+TM+ HHE Q +IV ALR LD+SQSPKETS HH+ERT QL  VV+EWHSQFEK+
Sbjct  464  GMMLMWDTMRMHHEEQLKIVNALRYLDLSQSPKETSLHHHERTVQLCNVVREWHSQFEKL  523

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
               QK+YI+ LN WLKLNL+PI+++LKEKVSSP R QNPPI  LL AW D + KLPDE  
Sbjct  524  AYRQKDYIKALNSWLKLNLIPIESSLKEKVSSPPRAQNPPIQRLLTAWHDQLEKLPDEHL  583

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN--DD  410
            +TAI SFSAV++TI+  Q +EMKLK RC +T KEL ++ RQF+DW++KY QRR P+  D 
Sbjct  584  RTAISSFSAVISTIMLQQEEEMKLKLRCDETEKELMRKQRQFDDWHYKYQQRRMPDELDP  643

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
             + +   +D  V ER + +E+LK+RL+EE+E + +QC+ VR KSL SL+  LPELF A+S
Sbjct  644  EKSEENSQDAAVTERLVVVESLKKRLEEEKETHAKQCLHVREKSLVSLKNQLPELFRALS  703

Query  229  EFSRACSIMYQTLESI  182
            EFS A S MY+ L  I
Sbjct  704  EFSSAGSDMYKNLRLI  719



>ref|XP_004172478.1| PREDICTED: uncharacterized protein LOC101231290 [Cucumis sativus]
Length=696

 Score =   294 bits (752),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 191/256 (75%), Gaps = 2/256 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW+TM+ HHE Q +IV ALR LD+SQSPKETS HH+ERT QL  VV+EWHSQFEK+
Sbjct  438  GMMLMWDTMRMHHEEQLKIVNALRYLDLSQSPKETSLHHHERTVQLCNVVREWHSQFEKL  497

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
               QK+YI+ LN WLKLNL+PI+++LKEKVSSP R QNPPI  LL AW D + KLPDE  
Sbjct  498  AYRQKDYIKALNSWLKLNLIPIESSLKEKVSSPPRAQNPPIQRLLTAWHDQLEKLPDEHL  557

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN--DD  410
            +TAI SFSAV++TI+  Q +EMKLK RC +T KEL ++ RQF+DW++KY QRR P+  D 
Sbjct  558  RTAISSFSAVISTIMLQQEEEMKLKLRCDETEKELMRKQRQFDDWHYKYQQRRMPDELDP  617

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
             + +   +D  V ER + +E+LK+RL+EE+E + +QC+ VR KSL SL+  LPELF A+S
Sbjct  618  EKSEENSQDAAVTERLVVVESLKKRLEEEKETHAKQCLHVREKSLVSLKNQLPELFRALS  677

Query  229  EFSRACSIMYQTLESI  182
            EFS A S MY+ L  I
Sbjct  678  EFSSAGSDMYKNLRLI  693



>gb|KJB65700.1| hypothetical protein B456_010G109200 [Gossypium raimondii]
Length=726

 Score =   293 bits (751),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 197/257 (77%), Gaps = 3/257 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW +M  HH+ Q ++V  L+SLD++ S KET++ H++ T QL  VVQEWHSQF K+
Sbjct  461  GMANMWASMCIHHDRQLKVVEKLKSLDVALSSKETTKQHHDWTIQLHNVVQEWHSQFNKL  520

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+YI  LN+WLKLNL+PI+++LKEK+SSP R QNPPI ALLHAW D + KLPDE+A
Sbjct  521  VTNQKQYILALNNWLKLNLIPIESSLKEKISSPPRAQNPPIQALLHAWHDCLEKLPDEVA  580

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND--D  410
            K+AI SF+AV+ TI+ HQ +EMKLK++C++TRKE  ++++ FE+WYHKY QRR+  D  D
Sbjct  581  KSAISSFAAVIKTIIIHQDEEMKLKEKCEETRKEFLRKSQAFEEWYHKYKQRRSALDEID  640

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
              +D   +D  V ERQL +E+LK+RL+EE EA+ + C+QVR KS+ SL+  LPE+F A+S
Sbjct  641  AGEDANAKD-PVSERQLVVESLKKRLEEEAEAHKKHCIQVREKSIGSLKIRLPEIFRALS  699

Query  229  EFSRACSIMYQTLESIT  179
            ++S ACS  Y+ L S+T
Sbjct  700  DYSHACSEAYEKLRSVT  716



>ref|XP_010938806.1| PREDICTED: uncharacterized protein LOC105057803 [Elaeis guineensis]
Length=670

 Score =   291 bits (746),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 193/263 (73%), Gaps = 5/263 (2%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MWE M  HH+NQ +IV  L+ LD++ +PKETSEHHY+RT QL  +V+EWHSQF+K++
Sbjct  404  MAKMWEAMYVHHDNQLKIVSNLKILDITNAPKETSEHHYKRTLQLFEIVKEWHSQFDKLV  463

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             HQK YI+ LN+WLKLN++PI+++LKE+VSSP RP  PPI ALL AW++ + KLPDELAK
Sbjct  464  SHQKVYIQALNNWLKLNVIPIESSLKERVSSPPRPHQPPIQALLLAWREHLEKLPDELAK  523

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            +AI SFSAV+NTIV  Q +E+K K++C +TRKE  K+TR FEDWY KY QRR      E 
Sbjct  524  SAILSFSAVINTIVTLQQEELKQKEKCDETRKEYLKKTRAFEDWYSKYSQRRATALSEEA  583

Query  400  -----DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
                 +G  + + V ER+  +E++K RL +EE+ + + C QVR KS  SL+T LPELF A
Sbjct  584  MQEGTEGATQKDPVAERKFAVESVKLRLDDEEDNHRKLCKQVREKSFGSLKTHLPELFRA  643

Query  235  MSEFSRACSIMYQTLESITHPLN  167
            MS+F+ A S MY  L+S++   N
Sbjct  644  MSDFAYASSDMYMKLKSVSQGQN  666



>gb|KDP34224.1| hypothetical protein JCGZ_07795 [Jatropha curcas]
Length=751

 Score =   293 bits (750),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 195/258 (76%), Gaps = 3/258 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW +M  HH++Q +IV  L+SLD+S S KET+  H++RT QL  VVQEWHS FEK+
Sbjct  484  GMAKMWASMCAHHDSQLKIVTDLKSLDVSHSAKETTRQHHDRTKQLHNVVQEWHSHFEKL  543

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+YI+ LN WLKLNL+PI+++LKEK+SSP +  NPPI  LLH W D + KLPDE+A
Sbjct  544  VTYQKQYIQILNSWLKLNLIPIESSLKEKISSPPKVPNPPIQPLLHTWHDYLEKLPDEVA  603

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI  HQ +EMKLK++C++TRKE  +R++ F++WY K+MQRRTP D+ +
Sbjct  604  KSAISSFAAVIKTIELHQEEEMKLKEKCEETRKEFLRRSQAFDEWYQKHMQRRTPTDEID  663

Query  403  QDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             +   + N    V ERQ  +E+LK+RL+EE EA+ R C+QVR KSL SL+  LPELF AM
Sbjct  664  AERGEDANAKDPVYERQSAVESLKKRLEEEIEAHQRHCVQVREKSLGSLKIRLPELFRAM  723

Query  232  SEFSRACSIMYQTLESIT  179
            S+++ ACS  Y+ L ++T
Sbjct  724  SDYAHACSDAYEKLRALT  741



>ref|XP_006356661.1| PREDICTED: uncharacterized protein LOC102596799 [Solanum tuberosum]
Length=719

 Score =   292 bits (747),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 190/258 (74%), Gaps = 3/258 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MWE M  HH+NQ Q+   L+++++S  P ETS+HH+ERT QLG V++EWH  F+ +
Sbjct  450  GMVSMWEFMFSHHKNQLQLATDLKAIEISGFPLETSKHHHERTIQLGNVIKEWHDHFDNL  509

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK YI+ L+ WLKLNL+PI+++LKEK+SSP R Q+PPI ALLH+WQ+L+ KLPDELA
Sbjct  510  VKNQKLYIQTLHSWLKLNLIPIESSLKEKISSPPRAQSPPIQALLHSWQELLEKLPDELA  569

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            ++AI SF AV+ TI+ HQ +EMKLKD+C++T+KE  ++ + FEDWY KYMQRRTP D T+
Sbjct  570  RSAIASFEAVIRTIIIHQEEEMKLKDKCEETKKEYIRKRQAFEDWYQKYMQRRTPPDMTD  629

Query  403  QDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             D   E N    V+E+QL ++ LK+RL EE EA+ R C+QVR KSL SL+  LPELF  M
Sbjct  630  TDRATESNPKDPVVEKQLLVDTLKKRLDEETEAHQRLCIQVREKSLGSLKIRLPELFRVM  689

Query  232  SEFSRACSIMYQTLESIT  179
            SE+S AC   Y  L  I 
Sbjct  690  SEYSYACLEAYGRLRLIV  707



>ref|XP_007024149.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY26771.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=743

 Score =   293 bits (749),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 211/274 (77%), Gaps = 9/274 (3%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWETMK  H++Q +IV  L+ LD+SQSPKETSEHH+ERT QL  +VQ+WH QF K+
Sbjct  471  GMATMWETMKVQHDSQFRIVTVLKDLDLSQSPKETSEHHHERTIQLLAIVQDWHMQFCKL  530

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YI  LN+WL+LNLVPI+++LKEKVSSP R + PPIL LL AWQ+ + KLPDE+A
Sbjct  531  VDHQKGYIIALNNWLRLNLVPIESSLKEKVSSPPRVETPPILGLLTAWQNQLEKLPDEIA  590

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DT  407
            ++AI +F+ V++TI+QHQLDEMKLK++C+++ KEL+++ RQF+DWYHKYMQRRTP + D 
Sbjct  591  RSAINNFAHVLDTIMQHQLDEMKLKEKCEESEKELQRKERQFKDWYHKYMQRRTPEELDP  650

Query  406  EQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            E+   + +N  V ERQ+ +EA+K+R +EE+EAY R C+QVR KS+ SL+T LPELF+AM+
Sbjct  651  ERTEANPNNEAVTERQVMVEAVKKRWEEEKEAYQRLCIQVREKSMVSLKTRLPELFNAMT  710

Query  229  EFSRACSIMYQTLE-SITHPLNREST*PGNVWPH  131
              ++ACS +Y  L   ++ P   +      +WPH
Sbjct  711  GIAKACSKLYGELRYCVSEPFLPQ------LWPH  738



>ref|XP_004150357.1| PREDICTED: uncharacterized protein LOC101204163 [Cucumis sativus]
Length=707

 Score =   291 bits (746),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 196/258 (76%), Gaps = 4/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW TM+ HHE Q +IV ALR++D+SQSPKETS HHYERT QL  VV+EWHSQFEK+
Sbjct  447  GMAMMWNTMRAHHEAQLKIVSALRAMDLSQSPKETSTHHYERTVQLCGVVREWHSQFEKL  506

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKV--SSPQRPQNPPILALLHAWQDLIGKLPDE  590
            +  QKEYI+ LN WLKLNL+PI+++LKEKV  SSP R QNPPI  LL AW D + +LPDE
Sbjct  507  VRCQKEYIKSLNSWLKLNLIPIESSLKEKVSLSSPPRVQNPPIQKLLLAWHDQLERLPDE  566

Query  589  LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-  413
              +TAI++F AV+NTI+  Q +E KLK + ++T KELE++ R F++W++KY QRR P+D 
Sbjct  567  HLRTAIFTFGAVINTIMLQQDEERKLKLKWEETEKELERKQRHFDEWHYKYQQRRMPDDV  626

Query  412  DTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            D E+ +   +D  V E+ + +E+LK+RL+EE+E + +QC+ VR KSL SL+  LPELF A
Sbjct  627  DPERSEAGMQDAAVTEKLIAVESLKKRLEEEKETHGKQCLHVREKSLVSLKNQLPELFRA  686

Query  235  MSEFSRACSIMYQTLESI  182
            +SEFS A S MY++L SI
Sbjct  687  LSEFSFASSEMYKSLSSI  704



>ref|XP_004169923.1| PREDICTED: uncharacterized LOC101204163 [Cucumis sativus]
Length=715

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 196/258 (76%), Gaps = 4/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW TM+ HHE Q +IV ALR++D+SQSPKETS HHYERT QL  VV+EWHSQFEK+
Sbjct  455  GMAMMWNTMRAHHEAQLKIVSALRAMDLSQSPKETSTHHYERTVQLCGVVREWHSQFEKL  514

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKV--SSPQRPQNPPILALLHAWQDLIGKLPDE  590
            +  QKEYI+ LN WLKLNL+PI+++LKEKV  SSP R QNPPI  LL AW D + +LPDE
Sbjct  515  VRCQKEYIKSLNSWLKLNLIPIESSLKEKVSLSSPPRVQNPPIQKLLLAWHDQLERLPDE  574

Query  589  LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-  413
              +TAI++F AV+NTI+  Q +E KLK + ++T KELE++ R F++W++KY QRR P+D 
Sbjct  575  HLRTAIFTFGAVINTIMLQQDEERKLKLKWEETEKELERKQRHFDEWHYKYQQRRMPDDV  634

Query  412  DTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            D E+ +   +D  V E+ + +E+LK+RL+EE+E + +QC+ VR KSL SL+  LPELF A
Sbjct  635  DPERSEAGMQDAAVTEKLIAVESLKKRLEEEKETHGKQCLHVREKSLVSLKNQLPELFRA  694

Query  235  MSEFSRACSIMYQTLESI  182
            +SEFS A S MY++L SI
Sbjct  695  LSEFSFASSEMYKSLSSI  712



>gb|KGN58062.1| hypothetical protein Csa_3G481220 [Cucumis sativus]
Length=736

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 196/258 (76%), Gaps = 4/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW TM+ HHE Q +IV ALR++D+SQSPKETS HHYERT QL  VV+EWHSQFEK+
Sbjct  476  GMAMMWNTMRAHHEAQLKIVSALRAMDLSQSPKETSTHHYERTVQLCGVVREWHSQFEKL  535

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKV--SSPQRPQNPPILALLHAWQDLIGKLPDE  590
            +  QKEYI+ LN WLKLNL+PI+++LKEKV  SSP R QNPPI  LL AW D + +LPDE
Sbjct  536  VRCQKEYIKSLNSWLKLNLIPIESSLKEKVSLSSPPRVQNPPIQKLLLAWHDQLERLPDE  595

Query  589  LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-  413
              +TAI++F AV+NTI+  Q +E KLK + ++T KELE++ R F++W++KY QRR P+D 
Sbjct  596  HLRTAIFTFGAVINTIMLQQDEERKLKLKWEETEKELERKQRHFDEWHYKYQQRRMPDDV  655

Query  412  DTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            D E+ +   +D  V E+ + +E+LK+RL+EE+E + +QC+ VR KSL SL+  LPELF A
Sbjct  656  DPERSEAGMQDAAVTEKLIAVESLKKRLEEEKETHGKQCLHVREKSLVSLKNQLPELFRA  715

Query  235  MSEFSRACSIMYQTLESI  182
            +SEFS A S MY++L SI
Sbjct  716  LSEFSFASSEMYKSLSSI  733



>ref|XP_009383699.1| PREDICTED: uncharacterized protein LOC103971407 [Musa acuminata 
subsp. malaccensis]
Length=751

 Score =   292 bits (747),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 188/258 (73%), Gaps = 3/258 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH+ Q +IV  L+SLD++ SP+ETSEHH++ T+QL  + +EWH+QF K+
Sbjct  487  GMAQMWYAMYMHHQAQLKIVEGLKSLDVTNSPRETSEHHHKHTFQLLEIAKEWHTQFNKL  546

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+Y+  LN WLKL L+PI+++LKEKVSSPQRP + PI +LLHAW + +GKLPDELA
Sbjct  547  VSHQKDYVESLNSWLKLTLIPIESSLKEKVSSPQRPAHAPIQSLLHAWHEYLGKLPDELA  606

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SFSAV+NTIV  Q +E K K++C++  KE  K+ R F+DW+ KY QRR  +   E
Sbjct  607  KSAILSFSAVINTIVTLQQEERKQKEKCEEAHKEYSKKNRAFDDWFQKYSQRRMGSSVGE  666

Query  403  QDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             DG    N    V ER+  +E+LK +  EE EA+ R C QVR KSL+SL+T LPELF AM
Sbjct  667  PDGGEGSNQKDPVEERRFMVESLKSKFDEEVEAHRRLCKQVREKSLSSLKTHLPELFRAM  726

Query  232  SEFSRACSIMYQTLESIT  179
            S+F+ ACS MY +L+ IT
Sbjct  727  SDFANACSKMYASLKMIT  744



>ref|XP_007225191.1| hypothetical protein PRUPE_ppa002131mg [Prunus persica]
 gb|EMJ26390.1| hypothetical protein PRUPE_ppa002131mg [Prunus persica]
Length=711

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 192/257 (75%), Gaps = 0/257 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH +Q +IV  L+SLD++ +P ET++HH++RT QL  V+QEW SQF+K+
Sbjct  453  GMAKMWENMCTHHGSQLKIVTDLKSLDIAHTPMETTKHHHDRTVQLYNVLQEWLSQFDKL  512

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q+PPI  LLH+W D + KLPDELA
Sbjct  513  VTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQHPPIQVLLHSWHDFLEKLPDELA  572

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK++ ++TRKE  ++++ F+DWY KY QR    D   
Sbjct  573  KSAISSFAAVIKTIILHQEEEMKLKEKFEETRKEYLRKSQAFDDWYQKYAQRHAEMDQER  632

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +  +  + V ER+  +E+LK++L+EE EA+ R C+QVR KSL SLRT LPE+F AMS++
Sbjct  633  GEDANPKDPVAERKFIVESLKKKLEEEVEAHQRHCIQVREKSLGSLRTRLPEIFRAMSDY  692

Query  223  SRACSIMYQTLESITHP  173
            +  CS  Y  L S+T P
Sbjct  693  AHTCSESYGKLRSLTEP  709



>ref|XP_004245249.1| PREDICTED: uncharacterized protein LOC101255018 [Solanum lycopersicum]
Length=725

 Score =   290 bits (742),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 190/258 (74%), Gaps = 3/258 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MWE M  HH+NQ Q+   L+++++S  P ETS+HH+ERT QLG V++EWH  F+ +
Sbjct  459  GMVSMWEFMFSHHKNQLQLATDLKAIEISGFPLETSKHHHERTIQLGNVIKEWHDHFDNL  518

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK YI+ L+ WLKLNL+PI+++LKEK+SSP R Q+PPI ALLH+WQ+L+ KLPDELA
Sbjct  519  VKNQKLYIQTLHSWLKLNLIPIESSLKEKISSPPRAQSPPIQALLHSWQELLEKLPDELA  578

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            ++AI SF AV+ TI+ HQ +EMKLKD+C++T+KE  ++ + FEDWY KYMQRRTP D T+
Sbjct  579  RSAIASFEAVIRTIIIHQEEEMKLKDKCEETKKEYIRKRQAFEDWYQKYMQRRTPPDMTD  638

Query  403  QDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             D   + N    V+E+QL ++ LK+RL EE EA+ R C+QVR KSL SL+  LPELF  M
Sbjct  639  PDRAADSNPKDPVVEKQLLVDTLKKRLDEETEAHQRLCIQVREKSLGSLKIRLPELFRVM  698

Query  232  SEFSRACSIMYQTLESIT  179
            SE+S AC   Y  L  I 
Sbjct  699  SEYSYACLEAYGRLRLIV  716



>ref|XP_009799127.1| PREDICTED: uncharacterized protein LOC104245243 [Nicotiana sylvestris]
Length=726

 Score =   290 bits (742),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/257 (56%), Positives = 189/257 (74%), Gaps = 3/257 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  M E M  HH+NQ ++   L+++++S  P ETS+HH+ERT QLG VV+EWH  F+ +
Sbjct  460  GMVNMSEFMYSHHKNQLEMATDLKAIEISGFPLETSKHHHERTIQLGNVVKEWHDHFDNL  519

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK YI+ L++WLKLNL+PI+++LKEK+SSP R QNPPI ALLH+WQ+L+ KLPDELA
Sbjct  520  VKNQKLYIQTLHNWLKLNLIPIESSLKEKISSPPRAQNPPIQALLHSWQELLEKLPDELA  579

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF AV+ TI+ HQ +EMKLK++C++TRKE  ++ + FEDWY KYMQRRTP D  +
Sbjct  580  KSAIASFEAVIRTIIIHQEEEMKLKEKCEETRKEYIRKRQAFEDWYQKYMQRRTPPDVAD  639

Query  403  QDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             D   E N    V E+Q  +EALK+RL EE EA+ + C+QVR KSL SL+  LPELF AM
Sbjct  640  PDRATESNPKDPVAEKQFLVEALKKRLDEETEAHQKHCIQVREKSLGSLKIRLPELFRAM  699

Query  232  SEFSRACSIMYQTLESI  182
            SE+S AC   Y  L  I
Sbjct  700  SEYSYACLEAYGRLRVI  716



>emb|CBI36151.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   285 bits (728),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 178/255 (70%), Gaps = 35/255 (14%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW TM  HH++Q +  +AL+SLD+SQSPKETSEHH++RT QL +VVQEWHSQF+K+
Sbjct  302  GMATMWGTMLEHHKSQSKTAMALKSLDISQSPKETSEHHHKRTIQLWIVVQEWHSQFDKL  361

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK YI  L  WL+LNL+PI++NLKEKVSSP RPQNPPI ALL AW D + KLPDELA
Sbjct  362  VTNQKNYITALKKWLRLNLIPIESNLKEKVSSPPRPQNPPIQALLQAWNDHLEKLPDELA  421

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            KT+I +F+A++ TI+QHQ DEM+LK +C++T KELE++TRQF DW+ K            
Sbjct  422  KTSISNFAAIIETIMQHQQDEMRLKAKCEETAKELERKTRQFNDWHSK------------  469

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
                                   LK+EEE Y ++C+ VR KSL SL+  LPELF A+SEF
Sbjct  470  -----------------------LKDEEETYQKECVLVRDKSLASLKNHLPELFRALSEF  506

Query  223  SRACSIMYQTLESIT  179
            S ACS MY  L SI+
Sbjct  507  SYACSDMYSRLRSIS  521



>ref|XP_010049074.1| PREDICTED: uncharacterized protein LOC104437750 [Eucalyptus grandis]
Length=650

 Score =   288 bits (736),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 188/255 (74%), Gaps = 0/255 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWE M+ HH+ Q  IV  L SLD S +PKET++HHY+RT QL   V EW  QF+K+
Sbjct  386  GMANMWEKMRMHHDKQESIVRDLMSLDSSNAPKETTKHHYDRTDQLHKYVLEWQLQFDKL  445

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQK+YI+ L+ WLKLNL+PI+++LKEK+SSP R QNPPI AL+ +W D + KLPDELA
Sbjct  446  ITHQKQYIQALHSWLKLNLIPIESSLKEKISSPPRAQNPPIQALIVSWHDYLEKLPDELA  505

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI++F+AV++ I+ HQ +EMKLKD+C++TR+E  ++ + FEDWY KY  RR P++   
Sbjct  506  KSAIFAFAAVIHNIIAHQEEEMKLKDKCEETRREYLRKKQAFEDWYQKYEHRRVPDETRT  565

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
            +D  H D  VIERQ  +E+L ++L+++ EA+ R C+QVR KSL +L+  LPELF AM+ +
Sbjct  566  EDANHHDPVVIERQAVVESLYKKLEDDVEAHRRLCIQVREKSLGNLKNRLPELFRAMAAY  625

Query  223  SRACSIMYQTLESIT  179
            S+ C+  Y  L  IT
Sbjct  626  SQHCADAYGNLRFIT  640



>ref|XP_008220000.1| PREDICTED: uncharacterized protein LOC103320143 [Prunus mume]
Length=713

 Score =   288 bits (738),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 192/257 (75%), Gaps = 0/257 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH +Q +IV  L+SLD++ +P ET++HH++RT QL  V+QEW SQF+K+
Sbjct  455  GMAKMWENMCTHHGSQLKIVTDLKSLDIAYTPMETTKHHHDRTVQLYNVLQEWLSQFDKL  514

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q+PPI  LLH+W D + KLPDELA
Sbjct  515  VTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQHPPIQVLLHSWHDFLEKLPDELA  574

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK++ ++TRKE  ++++ F+DWY KY QR    D   
Sbjct  575  KSAISSFAAVIKTIILHQEEEMKLKEKFEETRKEYLRKSQAFDDWYQKYTQRHAEMDQER  634

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +  +  + V ER+  +E+LK++L+EE EA+ R C+QVR KSL SL+T LPE+F AMS++
Sbjct  635  GEDANPKDPVAERKFIVESLKKKLEEEVEAHQRHCIQVREKSLGSLKTRLPEIFRAMSDY  694

Query  223  SRACSIMYQTLESITHP  173
            +  CS  Y  L S+T P
Sbjct  695  AHTCSESYGKLRSLTEP  711



>ref|XP_008462152.1| PREDICTED: uncharacterized protein LOC103500575 [Cucumis melo]
Length=705

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 200/259 (77%), Gaps = 1/259 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWETM  HH +Q ++V ALR LD+SQSPKETS+HH+ERT QL  VVQEWHSQ EK+
Sbjct  430  GMASMWETMHFHHGSQLKVVAALRMLDISQSPKETSDHHHERTVQLWAVVQEWHSQLEKL  489

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QK+YI+ L++WL+LNL+P +++LKEKVSSP R ++PPI +LLHAWQD + KLPDE+ 
Sbjct  490  VNRQKDYIKALSNWLRLNLIPTESSLKEKVSSPPRVRSPPIQSLLHAWQDHLEKLPDEVL  549

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN-DDT  407
            +  I++F+ V++TI+Q Q +EMKLK +C++T KEL ++++QF+DW  KY+QRR  N D+ 
Sbjct  550  RNTIFTFATVIHTIMQSQEEEMKLKLKCQETEKELARKSKQFKDWQKKYVQRRGSNADEV  609

Query  406  EQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
            + + P + + + ERQ  +EA+++RL+EE E + + C+ VR KSL SL+  LPELF A+ E
Sbjct  610  DMEEPGDKDAIAERQAAVEAVEKRLEEEREEHQKLCLHVREKSLGSLKNQLPELFRALFE  669

Query  226  FSRACSIMYQTLESITHPL  170
            FS ACS MY+ L+SI+ P+
Sbjct  670  FSLACSRMYRHLKSISQPI  688



>ref|XP_009338711.1| PREDICTED: uncharacterized protein LOC103931028 [Pyrus x bretschneideri]
Length=709

 Score =   287 bits (734),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 190/255 (75%), Gaps = 0/255 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH +Q +IV  L+SLD++ +P ET++HH++RT QL  V+QEWHS FEK+
Sbjct  451  GMAKMWENMCTHHGSQLEIVTDLKSLDIAHTPMETTKHHHDRTVQLWNVLQEWHSHFEKL  510

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ LN W+KLNL+PI+++LKEK+SSP R Q PPI ALLH+W D + KLPDELA
Sbjct  511  VTHQKQYIQALNSWVKLNLIPIESSLKEKISSPPRVQRPPIQALLHSWHDSLEKLPDELA  570

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK++ ++TRKE  ++ + FEDWY KY QR    D   
Sbjct  571  KSAISSFAAVIKTIILHQEEEMKLKEKFEETRKEFLRKNQAFEDWYQKYAQRHAEMDQER  630

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +     + V E++  +E+LK+R+++E EA+ R C+QVR KSL SL+T LPE+F AM+++
Sbjct  631  GEDAIPKDPVSEKKFIVESLKKRMEDECEAHQRHCIQVREKSLGSLKTRLPEIFRAMTDY  690

Query  223  SRACSIMYQTLESIT  179
            + ACS +Y  L S T
Sbjct  691  AHACSEVYGKLRSTT  705



>ref|XP_004141776.1| PREDICTED: uncharacterized protein LOC101222402 [Cucumis sativus]
 ref|XP_004169318.1| PREDICTED: uncharacterized protein LOC101224589 [Cucumis sativus]
 gb|KGN45358.1| hypothetical protein Csa_7G446740 [Cucumis sativus]
Length=700

 Score =   287 bits (734),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 199/259 (77%), Gaps = 1/259 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWETM  HH +Q + V ALR LD+SQSPKETS+HH+ERT QL  VVQEWHSQ EK+
Sbjct  430  GMASMWETMHFHHGSQLKAVAALRMLDISQSPKETSDHHHERTVQLWAVVQEWHSQLEKL  489

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QK+YI+ L++WL+LNL+P +++LKEKVSSP R ++PPI  LLHAWQD + KLPDE+ 
Sbjct  490  VNRQKDYIKALSNWLRLNLIPTESSLKEKVSSPPRVRSPPIQILLHAWQDHLEKLPDEVL  549

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN-DDT  407
            + AI++F+ V++TI+Q Q +EMKLK +C++T KEL ++++QF+DW  KY+QRR  N D+ 
Sbjct  550  RNAIFTFATVIHTIMQSQEEEMKLKLKCQETEKELARKSKQFKDWQKKYVQRRGSNADEV  609

Query  406  EQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
            + + P + + + ERQ  +EA++++L+EE E + + C+ VR KSL SL+  LPELF A+ E
Sbjct  610  DMEEPADKDAIAERQAAVEAVEKKLEEEREEHQKLCLHVREKSLGSLKNQLPELFRALFE  669

Query  226  FSRACSIMYQTLESITHPL  170
            FS ACS MY+ L+SI+ P+
Sbjct  670  FSLACSRMYRHLKSISQPM  688



>ref|XP_009368022.1| PREDICTED: uncharacterized protein LOC103957563 [Pyrus x bretschneideri]
Length=709

 Score =   287 bits (734),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 190/255 (75%), Gaps = 0/255 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH +Q +IV  L+SLD++ +P ET++HH++RT QL  V+QEWHS FEK+
Sbjct  451  GMAKMWENMCTHHGSQLEIVTDLKSLDIAHTPMETTKHHHDRTVQLWNVLQEWHSHFEKL  510

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ LN W+KLNL+PI+++LKEK+SSP R Q PPI ALLH+W D + KLPDELA
Sbjct  511  VTHQKQYIQALNSWVKLNLIPIESSLKEKISSPPRVQRPPIQALLHSWHDSLEKLPDELA  570

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK++ ++TRKE  ++ + FEDWY KY QR    D   
Sbjct  571  KSAISSFAAVIKTIILHQEEEMKLKEKFEETRKEFLRKNQAFEDWYQKYAQRHAEMDQER  630

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +     + V E++  +E+LK+R+++E EA+ R C+QVR KSL SL+T LPE+F AM+++
Sbjct  631  GEDAIPKDPVSEKKFIVESLKKRMEDECEAHQRHCIQVREKSLGSLKTRLPEIFRAMTDY  690

Query  223  SRACSIMYQTLESIT  179
            + ACS +Y  L S T
Sbjct  691  AHACSEVYGKLRSTT  705



>gb|KCW81524.1| hypothetical protein EUGRSUZ_C02885 [Eucalyptus grandis]
Length=747

 Score =   288 bits (736),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 188/255 (74%), Gaps = 0/255 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWE M+ HH+ Q  IV  L SLD S +PKET++HHY+RT QL   V EW  QF+K+
Sbjct  483  GMANMWEKMRMHHDKQESIVRDLMSLDSSNAPKETTKHHYDRTDQLHKYVLEWQLQFDKL  542

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQK+YI+ L+ WLKLNL+PI+++LKEK+SSP R QNPPI AL+ +W D + KLPDELA
Sbjct  543  ITHQKQYIQALHSWLKLNLIPIESSLKEKISSPPRAQNPPIQALIVSWHDYLEKLPDELA  602

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI++F+AV++ I+ HQ +EMKLKD+C++TR+E  ++ + FEDWY KY  RR P++   
Sbjct  603  KSAIFAFAAVIHNIIAHQEEEMKLKDKCEETRREYLRKKQAFEDWYQKYEHRRVPDETRT  662

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
            +D  H D  VIERQ  +E+L ++L+++ EA+ R C+QVR KSL +L+  LPELF AM+ +
Sbjct  663  EDANHHDPVVIERQAVVESLYKKLEDDVEAHRRLCIQVREKSLGNLKNRLPELFRAMAAY  722

Query  223  SRACSIMYQTLESIT  179
            S+ C+  Y  L  IT
Sbjct  723  SQHCADAYGNLRFIT  737



>ref|XP_008228519.1| PREDICTED: uncharacterized protein LOC103327921 [Prunus mume]
Length=537

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 194/254 (76%), Gaps = 4/254 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW+ M+ HHE Q + V ALRSLD S  PK+TS+HH+ERT QL  VVQ WHS+  K+
Sbjct  270  GMATMWDIMRLHHETQSKRVTALRSLDTSHCPKQTSQHHHERTIQLLGVVQGWHSEIGKL  329

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK YI+ LN+WLKLNL+PI+++LKEKVSSP R Q PPI  LL AWQD + KLPD++A
Sbjct  330  VTYQKVYIKALNNWLKLNLIPIESSLKEKVSSPPRIQRPPIQGLLLAWQDHLEKLPDDVA  389

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +TAI++F AV++TIV  Q DE+K+KD+C++TRKEL ++ R FEDW +K M +  P D+ +
Sbjct  390  RTAIHNFGAVISTIVTLQEDEIKMKDKCEETRKELARKKRHFEDWCNKNMHKTIP-DEID  448

Query  403  QDGP--HEDNNVI-ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             D P  H  N+V+ E+Q  +E +K+RL+EEEEAY R C+QVR KS+ S+++ LPELF A+
Sbjct  449  PDRPEGHTRNDVVAEKQFAVEIVKKRLEEEEEAYERLCLQVREKSIASIKSRLPELFRAL  508

Query  232  SEFSRACSIMYQTL  191
            S+F+ +CS MY++L
Sbjct  509  SDFASSCSEMYRSL  522



>ref|XP_009616206.1| PREDICTED: uncharacterized protein LOC104108786 [Nicotiana tomentosiformis]
Length=728

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 187/257 (73%), Gaps = 3/257 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  M E M  HH+NQ ++   L+++++S  P ETS+HH+ERT QLG VV+EWH  F+ +
Sbjct  462  GMVNMSEFMFSHHKNQLEMATDLKAIEISGFPLETSKHHHERTIQLGNVVKEWHDHFDNL  521

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK YI+ L+ WLKLNL+PI+++LKEK+SSP R QNPPI ALLH+WQ+L+ K PDELA
Sbjct  522  VKNQKLYIQTLHSWLKLNLIPIESSLKEKISSPPRAQNPPIQALLHSWQELLEKFPDELA  581

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF AV+ TI+ HQ +EMKLK++C++TRKE  ++ + FEDWY KYMQRRTP D  +
Sbjct  582  KSAIASFEAVIRTIIIHQEEEMKLKEKCEETRKEYIRKRQAFEDWYQKYMQRRTPPDVAD  641

Query  403  QDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             D   E N    V E+Q  ++ALK+RL EE EA+ + C+QVR KSL SL+  LPELF AM
Sbjct  642  PDRATESNPKDPVAEKQFLVDALKKRLDEETEAHQKHCIQVREKSLGSLKIRLPELFRAM  701

Query  232  SEFSRACSIMYQTLESI  182
            SE+S AC   Y  L  I
Sbjct  702  SEYSYACLEAYGRLRLI  718



>emb|CDX88193.1| BnaA06g27840D [Brassica napus]
Length=737

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 196/255 (77%), Gaps = 4/255 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M   H+ Q  IV  L+SL++S S KET++ H+++T Q   V++EWH QFEK+
Sbjct  478  GMAKMWSNMCIQHDTQLNIVGELKSLEISTSQKETTKQHHQQTRQFCTVLEEWHVQFEKL  537

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++LKE+VSSP RPQ+PPI ALLH+W D + KLPDE+A
Sbjct  538  VTHQKQYINSLNTWLKLNLIPIESSLKERVSSPPRPQHPPIQALLHSWHDRLEKLPDEVA  597

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK+RC+DTR+E  ++ + FE+WY K++++R P    E
Sbjct  598  KSAISSFAAVIRTILLHQEEEMKLKERCEDTRREFIRKKQGFEEWYQKHLEKRGP---VE  654

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
            ++G  ED++V ER++ +E+LK+RL++EEEA+ R C+QVR KSL SL+  LPE+F A+S++
Sbjct  655  EEGG-EDDHVTERRIVVESLKKRLEDEEEAHQRHCVQVREKSLNSLKIRLPEIFRALSDY  713

Query  223  SRACSIMYQTLESIT  179
            + AC+  Y+ L  I+
Sbjct  714  AHACADSYEKLRIIS  728



>ref|XP_010691307.1| PREDICTED: uncharacterized protein LOC104904665 [Beta vulgaris 
subsp. vulgaris]
Length=777

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/260 (52%), Positives = 196/260 (75%), Gaps = 4/260 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +MA MWE M+ HHENQ  I   LR +D+SQS KET++HH+ERT QL  +V+EW++ FEKM
Sbjct  503  AMATMWEVMQVHHENQRNIAAHLRFIDISQSNKETTDHHHERTIQLWAIVREWNTHFEKM  562

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQKEYIR LN WLKLNL+PI+++LKEKVSSP R QNPPI  LL AW D + KLPDE A
Sbjct  563  VNHQKEYIRALNSWLKLNLIPIESSLKEKVSSPPRAQNPPIQNLLFAWHDHLEKLPDEHA  622

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K AIY+F+AV++T+VQ Q DE++ + + +++R++LEK+ RQ+  W ++YMQ+R P+DD +
Sbjct  623  KGAIYNFAAVLDTLVQQQDDEIRQRAKVEESRRDLEKKQRQYNKWLNEYMQKRVPSDDMD  682

Query  403  ----QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
                +DG ++D  +++++  +E  K++L+++ E Y R C  VR KSLTSL+T LPELF +
Sbjct  683  PSSIEDGVNKDEIMVDKEFVVENAKKKLEDDTEEYERLCTHVREKSLTSLKTRLPELFLS  742

Query  235  MSEFSRACSIMYQTLESITH  176
            +SEF+ + S MY  L+++ H
Sbjct  743  LSEFALSASEMYSNLKALCH  762



>ref|XP_004501198.1| PREDICTED: uncharacterized protein LOC101510604 [Cicer arietinum]
Length=696

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 192/253 (76%), Gaps = 0/253 (0%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA MWE M  +HE+Q +IV  L+SLD+SQ  KET++HHY+RT QL  V+QEW SQFEK++
Sbjct  435  MANMWENMFINHESQLKIVTDLKSLDISQDHKETTKHHYDRTLQLWNVIQEWQSQFEKLV  494

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
              QK+YI+ LN WLKLNL+PI++NLKEK+SSP + QNPPI ALLHAW D + KLPDELAK
Sbjct  495  TQQKQYIQALNSWLKLNLIPIESNLKEKISSPPKAQNPPIQALLHAWHDYLDKLPDELAK  554

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            +AI SF+AV+ TI+    +EMKLK++C++TRKE  ++ + FE+WY K++ RR P+D    
Sbjct  555  SAISSFAAVIKTILLXXXEEMKLKEKCEETRKEFLRKNQAFEEWYQKHLLRRGPDDAERG  614

Query  400  DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  221
            +  + +N + E+Q  + +L+++L+EE E++ + C+QVR KSL SL+T LPELF A+S+++
Sbjct  615  EEGNTNNPLSEKQYVVGSLQKKLEEETESHKKLCVQVREKSLQSLKTRLPELFRALSDYT  674

Query  220  RACSIMYQTLESI  182
             AC   Y+ L+ I
Sbjct  675  HACYDAYEKLKLI  687



>ref|XP_009151092.1| PREDICTED: uncharacterized protein LOC103874418 [Brassica rapa]
Length=735

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 196/255 (77%), Gaps = 4/255 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M   H+ Q  IV  L+SL++S S KET++ H+++T Q   V++EWH QFE++
Sbjct  476  GMAKMWSNMCIQHDTQLNIVGELKSLEISTSQKETTKQHHQQTRQFCTVLEEWHVQFERL  535

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++LKE+VSSP RPQ+PPI ALLH+W D + KLPDE+A
Sbjct  536  VTHQKQYINSLNTWLKLNLIPIESSLKERVSSPPRPQHPPIQALLHSWHDRLEKLPDEVA  595

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK+RC+DTRKE  ++ + FE+WY K++++R P    E
Sbjct  596  KSAISSFAAVIRTILLHQEEEMKLKERCEDTRKEFIRKKQGFEEWYQKHLEKRGP---VE  652

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
            ++G  ED++V ER++ +E+LK+RL++EEEA+ R C+QVR KSL SL+  LPE+F A+S++
Sbjct  653  EEGG-EDDHVTERRIVVESLKKRLEDEEEAHQRHCVQVREKSLNSLKIRLPEIFRALSDY  711

Query  223  SRACSIMYQTLESIT  179
            + AC+  Y+ L  I+
Sbjct  712  AHACADSYEKLRIIS  726



>ref|XP_008378117.1| PREDICTED: uncharacterized protein LOC103441188 [Malus domestica]
Length=710

 Score =   285 bits (728),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 187/254 (74%), Gaps = 0/254 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWE M  H ++Q +IV  L+SLD+  +P ET++HH+ RT QL  V+ EWHS FE +
Sbjct  452  GMASMWENMCTHXDSQLKIVTDLKSLDIGHTPMETTKHHHARTVQLWNVLXEWHSHFENL  511

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q+PPI ALLH+W D + KLPDELA
Sbjct  512  VTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQHPPIQALLHSWHDFLEKLPDELA  571

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SFSAV+ TI+ HQ +EMKLK++ ++TRKE  ++ + FEDWY KY QR    D+  
Sbjct  572  KSAISSFSAVIKTIILHQEEEMKLKEKFEETRKEYLRKNQAFEDWYQKYSQRHAEMDEER  631

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +     + V E++  +++LK+RL+EE EA+ R C+QVR KSL SL+T LPE+F AM+++
Sbjct  632  GEDAVPKDPVSEKKFIVDSLKKRLEEECEAHQRHCIQVREKSLGSLKTRLPEIFRAMTDY  691

Query  223  SRACSIMYQTLESI  182
            +RACS  Y  L SI
Sbjct  692  ARACSEAYGKLRSI  705



>ref|XP_010667633.1| PREDICTED: uncharacterized protein LOC104884645 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=708

 Score =   284 bits (726),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 187/257 (73%), Gaps = 4/257 (2%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MWE +  HH+NQ QI   L+SLD+  +P+ETS+ HY  T QL  VVQ+W  +FE ++
Sbjct  443  MAQMWEDICIHHDNQLQIATELKSLDVILTPRETSKPHYHCTLQLSNVVQQWQDRFETLV  502

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
              QK Y+R LN WLKLNL+PI++NLKEK+SSP R  +PPI ALLHAW D + KLPDE+ +
Sbjct  503  HQQKHYVRSLNSWLKLNLIPIESNLKEKISSPPRAHHPPIQALLHAWHDALEKLPDEVTR  562

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP---NDD  410
            TAI SF A++ TI+ HQ +EM+LK++C++TRKE  ++ + FEDWYHKYMQR+ P   + +
Sbjct  563  TAISSFGAMIKTIILHQDEEMRLKEKCEETRKEFLRKNQAFEDWYHKYMQRKGPEAMDSE  622

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
              +DGP +D  V ERQ+ +E+LK RL++E E Y R C+QVR KSL +L+T LPELF A+S
Sbjct  623  RGEDGPGKD-PVSERQVVVESLKNRLEDELEKYQRHCVQVREKSLGTLKTRLPELFRALS  681

Query  229  EFSRACSIMYQTLESIT  179
            E++ A    Y  L +I 
Sbjct  682  EYAHASYDSYNKLRAIV  698



>ref|XP_002516075.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46495.1| conserved hypothetical protein [Ricinus communis]
Length=714

 Score =   284 bits (726),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 198/257 (77%), Gaps = 2/257 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWETM+ HH+NQ +IV ALRSLD+SQS KETSE+HY+RT QL  VV++WH+QF ++
Sbjct  453  GMATMWETMQYHHDNQSKIVYALRSLDISQSLKETSEYHYDRTCQLCGVVRDWHAQFCRL  512

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I +QK+YI+ LN+W+KLNL+PI++NLKEKVSSP R QNPPI  LL AW D + +LPDE+A
Sbjct  513  IDYQKDYIKALNNWIKLNLIPIESNLKEKVSSPPRIQNPPIHVLLIAWHDHLDRLPDEIA  572

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DT  407
            ++AI +F+AVV TIV HQ +E+K++++C+ TRKEL +R RQ +DW +K+  R    D + 
Sbjct  573  RSAISNFAAVVQTIVHHQEEEVKMREKCEATRKELSRRIRQLDDWKNKHNVRDDELDPEA  632

Query  406  EQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
            E++ PH  N ++ERQ  ++ LK++L+EEEEA  +  +QVR KSL SL+T LPELF AMS+
Sbjct  633  EEENPHR-NAMMERQGVVDLLKKQLEEEEEACQKLSLQVREKSLASLKTRLPELFRAMSD  691

Query  226  FSRACSIMYQTLESITH  176
             + AC+ MY  L SI H
Sbjct  692  IALACADMYSNLRSIAH  708



>ref|XP_008393906.1| PREDICTED: uncharacterized protein LOC103456054 [Malus domestica]
Length=711

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 188/255 (74%), Gaps = 0/255 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH +Q +IV  L+SLD+  +P ET++HH++RT QL  V+QEWHS FEK+
Sbjct  453  GMAKMWENMCTHHGSQLKIVTDLKSLDIPHTPMETTKHHHDRTVQLWNVLQEWHSHFEKL  512

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q PPI ALLH+W D + KLPDELA
Sbjct  513  VTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQRPPIQALLHSWHDSLEKLPDELA  572

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ +Q +EMKLK++ ++TRKE  ++++ FEDWY KY QR    D   
Sbjct  573  KSAISSFAAVIKTIILNQEEEMKLKEKFEETRKEFLRKSQAFEDWYQKYAQRHAEMDQER  632

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +     + V E++  +E+LK+R++EE E + R C+QVR KSL SL+T LPE+F +M+++
Sbjct  633  GEDAIPKDPVSEKKFIVESLKKRMEEEYEXHQRHCIQVREKSLGSLKTRLPEIFRSMTDY  692

Query  223  SRACSIMYQTLESIT  179
            + ACS  Y  L S T
Sbjct  693  ANACSEAYGKLRSTT  707



>ref|XP_010112163.1| hypothetical protein L484_019902 [Morus notabilis]
 gb|EXC32788.1| hypothetical protein L484_019902 [Morus notabilis]
Length=821

 Score =   285 bits (728),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/258 (55%), Positives = 199/258 (77%), Gaps = 6/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWE+M  HH++Q +IV  L+ LD++ +PKET++ H++RT QL  ++QEWHSQFEK+
Sbjct  485  GMATMWESMCIHHDSQLKIVTDLKGLDLAHAPKETTKQHHDRTVQLYNIIQEWHSQFEKL  544

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ LN WLKLNLVPI+++LKE +SSP R Q+PPI ALLH+W DL+ KLPDELA
Sbjct  545  VTHQKQYIQALNSWLKLNLVPIESSLKEIISSPPRAQHPPIQALLHSWHDLLEKLPDELA  604

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+A  SF+AV+ TI+ HQ +EMKLK++C++TRKE  +R + FEDWY K+MQRR P++   
Sbjct  605  KSAASSFAAVIKTIILHQEEEMKLKEKCEETRKEYLRRNQAFEDWYQKHMQRRGPDEMDP  664

Query  403  QDGPHEDNN----VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            + G  ED N    V E+Q  +++LK+RL+EE EA+ + C+QVR KSL SL+T LPE+F A
Sbjct  665  ERG--EDANTKDPVSEKQFVVDSLKKRLEEEIEAHQKHCLQVREKSLGSLKTRLPEIFRA  722

Query  235  MSEFSRACSIMYQTLESI  182
            MS++S+ACS  Y+ L  +
Sbjct  723  MSDYSQACSDGYEKLSCV  740



>emb|CDP18480.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   281 bits (720),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 190/258 (74%), Gaps = 3/258 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M +MWE+M  HH++Q QI   L+ LD+S +P ETS+HH+ERT QL   V++ HS  EK+
Sbjct  459  GMTKMWESMWMHHQDQKQIATDLKLLDVSAAPGETSKHHHERTCQLLHHVEDLHSHLEKL  518

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +Q +YI  LN WLK NL+PI+++LKEK+SSP R QNPPI  LL  W D + KLPD+ A
Sbjct  519  MTNQNQYIHFLNSWLKQNLIPIESSLKEKISSPPRSQNPPIQPLLQMWHDHLEKLPDDAA  578

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI++FS VV  I+ HQ +EMKLK+ C++TRKE  ++++ FEDWYHKYMQRRTP+DD +
Sbjct  579  KSAIHTFSEVVKRILVHQEEEMKLKETCEETRKEYLRKSQAFEDWYHKYMQRRTPHDDAD  638

Query  403  QDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             D P E N    + E++  +E+LK+RL+EE EA+ + C+QVR KSLTSL+ GLP+LF AM
Sbjct  639  PDRPEETNPNDPLAEKRFVVESLKKRLEEEMEAHQKHCIQVREKSLTSLKIGLPDLFRAM  698

Query  232  SEFSRACSIMYQTLESIT  179
            S+++ AC   Y +L S+ 
Sbjct  699  SDYAEACLNAYGSLRSLA  716



>ref|XP_008776462.1| PREDICTED: uncharacterized protein LOC103696569 [Phoenix dactylifera]
Length=375

 Score =   272 bits (695),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 194/263 (74%), Gaps = 4/263 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH+NQ +IVL L+ LD+S +P ETSEHH   T QL  +V+EWH QF+K+
Sbjct  109  GMAKMWEAMYVHHDNQLKIVLNLKILDISNAPMETSEHHNRHTIQLFDIVKEWHLQFDKL  168

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ L+ WLKLN++PI+++LKEKVSSP RP+ PPI ALLHAW D + KLPDELA
Sbjct  169  VSHQKDYIQALSSWLKLNIIPIESSLKEKVSSPPRPRQPPIQALLHAWHDHLDKLPDELA  228

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP-NDDT  407
            K+AI SFSAV+NTIV  Q +E+K +++C +TRKE  K+ R FEDWY KY  RR   +++ 
Sbjct  229  KSAILSFSAVINTIVTLQQEELKQREKCDETRKEYLKKIRAFEDWYSKYSHRRAALSEEA  288

Query  406  EQ---DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
             Q   +G ++++ V ER++ +E+ K RL EEEE + + C QVR KS  +L+T LPEL  A
Sbjct  289  GQEGSEGANQNDPVAERKVAVESAKSRLDEEEENHEKLCKQVREKSFGTLKTHLPELIRA  348

Query  235  MSEFSRACSIMYQTLESITHPLN  167
            MS+FS ACS MY+ L+SI+   N
Sbjct  349  MSDFSHACSEMYKKLKSISQSQN  371



>ref|XP_009345256.1| PREDICTED: uncharacterized protein LOC103937065 [Pyrus x bretschneideri]
Length=713

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/254 (53%), Positives = 188/254 (74%), Gaps = 0/254 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M   H+NQ +IV  L+SLD++ +P ET++HH+ RT QL  V+QEWHS F  +
Sbjct  455  GMAKMWENMCTDHDNQLKIVTDLKSLDIALTPMETTKHHHARTVQLWNVLQEWHSHFVNL  514

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ LN WLKLNL+PI+++LKEK+SSP R Q+PPI ALLH+W D + KLPDELA
Sbjct  515  VTHQKQYIQALNSWLKLNLIPIESSLKEKISSPPRVQHPPIQALLHSWHDFLEKLPDELA  574

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI S SAV+ TI+ HQ +EMKLK++ ++TRKE  ++ + F+DWY KY QR    D+  
Sbjct  575  KSAISSCSAVIKTIILHQEEEMKLKEKFEETRKEYLRKNQAFDDWYQKYSQRHAQMDEER  634

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +     + V E++  +++LK+RL+EE EA+ R C+QVR KSL SL+T LPE+F AM+++
Sbjct  635  GEDAVPKDPVSEKKFIVDSLKKRLEEECEAHQRHCIQVREKSLGSLKTRLPEIFRAMTDY  694

Query  223  SRACSIMYQTLESI  182
            +RACS  Y  L SI
Sbjct  695  ARACSEAYGKLRSI  708



>ref|XP_011089542.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105170443 
[Sesamum indicum]
Length=717

 Score =   279 bits (713),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 191/263 (73%), Gaps = 6/263 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MWE+M  HH++Q +IV  L+SLD+S    ETS+HH+ERT QL  VV++WH QFEK+
Sbjct  451  GMTNMWESMCQHHDSQLKIVTDLKSLDVSGVLIETSKHHHERTKQLSNVVEQWHLQFEKL  510

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +Q+ YI  LN+WLKLNL+PI+++LKEKVSSP R  NPPI  LL +W D + KLPDE+A
Sbjct  511  VTNQRHYINSLNNWLKLNLIPIESSLKEKVSSPPRTLNPPIQPLLRSWHDHLEKLPDEVA  570

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLKD+ ++TRKE  ++ + FE+WY KYMQRR P D+T+
Sbjct  571  KSAIASFAAVIKTIIIHQEEEMKLKDKYEETRKEYFRKKQAFEEWYQKYMQRRPPMDETD  630

Query  403  QDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             D   E N    V ERQ  +E+LK+RL++E E + + C+QVR KSL SL+  LPELF A+
Sbjct  631  PDKAVETNAKDPVSERQFLVESLKKRLEDEMEDHQKHCVQVREKSLGSLKIRLPELFRAL  690

Query  232  SEFSRACSIMYQTLESIT---HP  173
            S+++ AC   Y+ L  IT   HP
Sbjct  691  SDYAHACFDAYERLRLITQSQHP  713



>ref|XP_008775372.1| PREDICTED: uncharacterized protein LOC103695745 [Phoenix dactylifera]
Length=557

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 192/262 (73%), Gaps = 3/262 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWETM  HH  Q +IV  LR+ D+S +PKETSE H+E T QL  VV+EWHSQ EK+
Sbjct  294  GMANMWETMHVHHGTQYKIVANLRAFDISFAPKETSEEHHECTAQLWRVVREWHSQIEKL  353

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+YI+ LN WLKLNL+PI+++LKEKVSSP RP  PPI ALLH+W D + KL DELA
Sbjct  354  MKNQKDYIKSLNSWLKLNLIPIESSLKEKVSSPPRPSRPPIQALLHSWNDQLEKLSDELA  413

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP-NDDT  407
            ++AIYSFS VV TIV HQ DE+K+K++C+D RKE  ++ R FEDWY KY +++    +D 
Sbjct  414  RSAIYSFSEVVRTIVVHQEDELKMKEKCEDLRKEFMRKKRAFEDWYRKYSEKKAASGEDA  473

Query  406  EQDGPHEDNN--VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
              +G    N     ER+L++EAL+ +LK+EEEAY R C QVR KSL +LRT LPELF  +
Sbjct  474  NPEGGEGSNQDRGTERKLEVEALEIKLKDEEEAYARLCKQVREKSLGTLRTHLPELFRNV  533

Query  232  SEFSRACSIMYQTLESITHPLN  167
            S+F+ ACS MY+ L S++  L+
Sbjct  534  SDFALACSEMYKKLRSVSQSLD  555



>ref|XP_008447502.1| PREDICTED: uncharacterized protein LOC103489935 [Cucumis melo]
Length=722

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 191/256 (75%), Gaps = 2/256 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW+TM+ HHE Q +IV ALR LD+SQSPKETS HH+ERT QL  VV+EWHSQFEK+
Sbjct  464  GMMLMWDTMRMHHEEQLKIVNALRYLDLSQSPKETSVHHHERTVQLCNVVREWHSQFEKL  523

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
               QK+YI+ LN WLKLNL+PI+++LKEKVSSP R QNPPI  LL AW D + KLPDE  
Sbjct  524  AYRQKDYIKALNSWLKLNLIPIESSLKEKVSSPPRAQNPPIQRLLIAWHDQLEKLPDEHL  583

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN--DD  410
            +TAI SFSAV++TI+  Q +EMKLK RC +T KEL ++ RQF+DW++KY QRR P+  D 
Sbjct  584  RTAISSFSAVISTIMLQQEEEMKLKLRCDETEKELVRKQRQFDDWHYKYQQRRMPDELDP  643

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
             + +   +D  V ER + +E+LK++L+EE+E + +QC+ VR KSL SL+  LPELF A+S
Sbjct  644  EKSEENSQDAAVTERFVVVESLKKKLEEEKETHAKQCLHVREKSLVSLKNQLPELFRALS  703

Query  229  EFSRACSIMYQTLESI  182
            EFS A S MY+ L  I
Sbjct  704  EFSSAGSEMYKNLRLI  719



>gb|KDP37214.1| hypothetical protein JCGZ_06270 [Jatropha curcas]
Length=729

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 189/257 (74%), Gaps = 3/257 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MWETM+ HH  Q ++V ALRSLD+S+SPKETSE+HY+RT+QL  VV++W +QF K+
Sbjct  465  GMATMWETMQYHHHTQSKLVYALRSLDISESPKETSEYHYDRTFQLCGVVRDWQNQFCKL  524

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YI+ LN WLKLNL+PI++NLKEK+SSP R QNPPI ALL AW D + KLPDE+A
Sbjct  525  VDHQKGYIKALNSWLKLNLIPIESNLKEKISSPPRVQNPPIHALLIAWNDDLEKLPDEIA  584

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM--QRRTPNDD  410
            ++AI +F+AV+ TIV HQ +E+K++++C+ TR+EL ++T+QF +W  K+M       + D
Sbjct  585  RSAIVNFAAVIQTIVHHQEEELKIREKCEATRRELARKTKQFNEWKQKHMVETHDETDPD  644

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
              ++ PH +  + +RQ  ++AL ++L+EEEE   R   QVR KSL SL+  LPELF AMS
Sbjct  645  RAEENPHRE-ALTDRQFVIDALTKQLEEEEEGCRRLSQQVREKSLASLKHRLPELFTAMS  703

Query  229  EFSRACSIMYQTLESIT  179
            + + A S MY  L SI 
Sbjct  704  DIALAFSAMYSNLRSIA  720



>gb|KDO79698.1| hypothetical protein CISIN_1g004600mg [Citrus sinensis]
Length=743

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 194/260 (75%), Gaps = 1/260 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH++Q  IV  L+ LD++ + KET++HH+ERT +L  VVQ+WH++FEK 
Sbjct  476  GMAKMWENMCIHHDSQLTIVSELKPLDIAHAVKETTQHHHERTEELFTVVQKWHTEFEKF  535

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK++I+ L  WLKLNL+PI+++LKE+V+SP R  NPPI ALLH+W D + KLPDE+A
Sbjct  536  VNHQKQFIQALTSWLKLNLIPIESSLKERVTSPPRAPNPPIQALLHSWHDYLEKLPDEIA  595

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK++C++TRKEL ++T  +E+W+ KY +  +   + E
Sbjct  596  KSAISSFAAVIKTIMLHQEEEMKLKEKCEETRKELLRKTHAYEEWHRKYKKTHSEESEAE  655

Query  403  Q-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
            + D  +  + V++RQ+ +E+L++RL+EE EA+ R C+QVR KSL SL+  LP+LF A+S+
Sbjct  656  RGDDANTRDPVLDRQIVIESLRKRLEEETEAFRRHCLQVREKSLGSLKLRLPDLFRAVSD  715

Query  226  FSRACSIMYQTLESITHPLN  167
            F+ A    Y+ L SIT   N
Sbjct  716  FAHASFDAYEKLRSITQSQN  735



>ref|XP_006476157.1| PREDICTED: myosin-9-like [Citrus sinensis]
Length=745

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 194/260 (75%), Gaps = 1/260 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH++Q  IV  L+ LD++ + KET++HH+ERT +L  VVQ+WH++FEK 
Sbjct  478  GMAKMWENMCIHHDSQLTIVSELKPLDIAHAVKETTQHHHERTEELFTVVQKWHTEFEKF  537

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK++I+ L  WLKLNL+PI+++LKE+V+SP R  NPPI ALLH+W D + KLPDE+A
Sbjct  538  VNHQKQFIQALTSWLKLNLIPIESSLKERVTSPPRAPNPPIQALLHSWHDYLEKLPDEIA  597

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK++C++TRKEL ++T  +E+W+ KY +  +   + E
Sbjct  598  KSAISSFAAVIKTIMLHQEEEMKLKEKCEETRKELLRKTHAYEEWHRKYKKTHSEESEAE  657

Query  403  Q-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
            + D  +  + V++RQ+ +E+L++RL+EE EA+ R C+QVR KSL SL+  LP+LF A+S+
Sbjct  658  RGDDANTRDPVLDRQIVIESLRKRLEEETEAFRRHCLQVREKSLGSLKLRLPDLFRAVSD  717

Query  226  FSRACSIMYQTLESITHPLN  167
            F+ A    Y+ L SIT   N
Sbjct  718  FAHASFDAYEKLRSITQSQN  737



>ref|XP_006450611.1| hypothetical protein CICLE_v10007564mg [Citrus clementina]
 gb|ESR63851.1| hypothetical protein CICLE_v10007564mg [Citrus clementina]
Length=745

 Score =   278 bits (711),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 194/260 (75%), Gaps = 1/260 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH++Q  IV  L+ LD++ + KET++HH+ERT +L  VVQ+WH++FEK 
Sbjct  478  GMAKMWENMCIHHDSQLTIVSELKPLDIAHAVKETTQHHHERTEELFTVVQKWHTEFEKF  537

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK++I+ L  WLKLNL+PI+++LKE+V+SP R  NPPI ALLH+W D + KLPDE+A
Sbjct  538  VNHQKQFIQALTSWLKLNLIPIESSLKERVTSPPRAPNPPIQALLHSWHDYLEKLPDEIA  597

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK++C++TRKEL ++T  +E+W+ KY +  +   + E
Sbjct  598  KSAISSFAAVIKTIMLHQEEEMKLKEKCEETRKELLRKTHAYEEWHRKYKKTHSEESEAE  657

Query  403  Q-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
            + D  +  + V++RQ+ +E+L++RL+EE EA+ R C+QVR KSL SL+  LP+LF A+S+
Sbjct  658  RGDDANTRDPVLDRQIVIESLRKRLEEETEAFRRHCLQVREKSLGSLKLRLPDLFRAVSD  717

Query  226  FSRACSIMYQTLESITHPLN  167
            F+ A    Y+ L SIT   N
Sbjct  718  FAHASFDAYEKLRSITQSQN  737



>ref|XP_008799874.1| PREDICTED: uncharacterized protein LOC103714416 [Phoenix dactylifera]
Length=559

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 192/264 (73%), Gaps = 5/264 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH+NQ +IVL L+ LD++  PKETSEHHY+RT QL  +V+EWHSQF+K+
Sbjct  292  GMAKMWEAMYVHHDNQLKIVLNLKILDITNVPKETSEHHYKRTLQLFEIVKEWHSQFDKL  351

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YIR LN+WLKLN++PI+++LKE+VSSP RP+ PPI ALL AW D + K+PDELA
Sbjct  352  VSHQKDYIRALNNWLKLNIIPIESSLKERVSSPPRPRQPPIQALLLAWHDHLEKIPDELA  411

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SFSAV+NTIV  Q +E+K K++C +TRKE  K+ R FEDWY KY QRR      E
Sbjct  412  KSAILSFSAVINTIVILQQEELKQKEKCDETRKEYLKKARAFEDWYSKYSQRRATALSEE  471

Query  403  -----QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
                  +   + + V ER+  +E++K RL EEE+ + + C QVR KS  SL+T LPELF 
Sbjct  472  AVQEDSEAASQKDPVAERKFAVESVKSRLDEEEDNHRKLCKQVREKSFGSLKTHLPELFR  531

Query  238  AMSEFSRACSIMYQTLESITHPLN  167
            AMS+F+ A S MY  L+SI+   N
Sbjct  532  AMSDFAYASSDMYMKLKSISQGQN  555



>emb|CAN72109.1| hypothetical protein VITISV_044047 [Vitis vinifera]
Length=728

 Score =   277 bits (708),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 172/219 (79%), Gaps = 4/219 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW TM  HH++Q +  +AL+SLD+SQSPKETSEHH++RT QL  VVQEWHSQF+K+
Sbjct  458  GMATMWGTMLEHHKSQSKTAMALKSLDISQSPKETSEHHHKRTIQLWXVVQEWHSQFDKL  517

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK YI  L  WL+LNL+PI++NLKEKVSSP R QNPPI ALL AW D + KLPDELA
Sbjct  518  VTNQKNYITALKKWLRLNLIPIESNLKEKVSSPPRXQNPPIQALLQAWNDHLEKLPDELA  577

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            KT+I +F+A++ TI+QHQ DEM+LK +C++T KELE++TRQF DW+ KYMQ+R P+++  
Sbjct  578  KTSISNFAAIIETIMQHQQDEMRLKAKCEETAKELERKTRQFNDWHSKYMQKRIPDENDR  637

Query  403  Q---DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCM  296
            +   D PH D  VIER+L +E L  RLK+EEE Y ++C+
Sbjct  638  EHPGDDPH-DEVVIERKLVVETLSNRLKDEEETYQKECV  675



>gb|EPS57690.1| hypothetical protein M569_17127, partial [Genlisea aurea]
Length=245

 Score =   263 bits (671),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 184/257 (72%), Gaps = 15/257 (6%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVL-ALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            MA MW TMK +HENQ ++V  +LR LD S SPKET++HH+ERT QLG VVQEW++   + 
Sbjct  1    MATMWGTMKFYHENQFKVVHESLRLLDASHSPKETTDHHHERTRQLGGVVQEWYTNLTEF  60

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKE-KVSSPQRPQ-NPPILALLHAWQDLIGKLPDE  590
               QKEYI+ LN+WLKLNL+PIDTNLK+   SSP RP+ NPPI  LLHAW + + KLPDE
Sbjct  61   TTQQKEYIKALNNWLKLNLIPIDTNLKDPSASSPARPESNPPIQLLLHAWNEYLQKLPDE  120

Query  589  LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDD  410
             A++AI +F+A V TI +HQ +E++ ++RC ++ K+L+++TR FE+WY K+        +
Sbjct  121  AARSAINNFAAAVKTIWEHQKEELEFRNRCAESSKDLKRKTRDFENWYRKHFT------E  174

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
             E+D       V E+Q+ +E  K+RL+E+EEAY RQC+QVR KS+ SL+T LPELF A+S
Sbjct  175  VEKDV------VSEKQIAVEIAKKRLEEDEEAYRRQCVQVRDKSVMSLKTHLPELFRALS  228

Query  229  EFSRACSIMYQTLESIT  179
             F+ A + MY  L ++ 
Sbjct  229  AFAGAGADMYSHLRNVA  245



>ref|XP_008342705.1| PREDICTED: uncharacterized protein LOC103405477 [Malus domestica]
Length=736

 Score =   277 bits (708),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 188/256 (73%), Gaps = 4/256 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW TM+ HHE Q  I   LR LD+SQ PK TSEHH+ERT QL  VVQ W S+F K+
Sbjct  469  GMTIMWATMRSHHETQSNIAKELRWLDISQCPKHTSEHHHERTIQLFGVVQGWQSEFVKL  528

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QKEYI+ LN WLKLNL+PI++ LKEKVSSP R Q PPI  LL AW D + KLPD++A
Sbjct  529  VSQQKEYIKALNSWLKLNLIPIESXLKEKVSSPPRIQRPPIQGLLLAWHDHLEKLPDDVA  588

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +TAIY+F+A +NTI+ HQ +E+K+K++C+DTRKEL ++ RQF++WY K   +  P D+ +
Sbjct  589  RTAIYNFAAAINTIMIHQEEEIKMKEKCEDTRKELSRKMRQFQEWYDKNKHKTIP-DEGD  647

Query  403  QDGP--HEDNNVI-ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             DGP  H  ++V+ E+Q  +E +K+RL+EEEE Y R  +QVR KS+ SL+T LPELF A+
Sbjct  648  TDGPEGHTRSDVLAEKQFAVEIVKKRLEEEEETYERLGLQVREKSVVSLKTRLPELFRAL  707

Query  232  SEFSRACSIMYQTLES  185
            S+F+ +CS MY+ L S
Sbjct  708  SDFAYSCSEMYRGLRS  723



>emb|CDX80528.1| BnaC07g29160D [Brassica napus]
Length=733

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/255 (51%), Positives = 194/255 (76%), Gaps = 4/255 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M   H+ Q  IV  L+SL++S   KET++ H+++T Q   V++EWH QFE++
Sbjct  474  GMAKMWSNMCIQHDTQLIIVGELKSLEISTCQKETTKQHHQQTRQFCAVLEEWHVQFERL  533

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+ I+++LKE+VSSP RPQ+PPI ALLH+W D + KLPDE+A
Sbjct  534  VTHQKQYINSLNTWLKLNLISIESSLKERVSSPPRPQHPPIQALLHSWHDRLEKLPDEVA  593

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK+RC++TR+E  ++ + FE+WY K++++R P    E
Sbjct  594  KSAISSFAAVIRTILLHQEEEMKLKERCEETRREFIRKKQGFEEWYQKHLEKRGP---VE  650

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
            ++G  ED++V ER++ +E+LK+RL++EEEA+ R C+QVR KSL SL+  LPE+F A+S++
Sbjct  651  EEGG-EDDHVTERRIVVESLKKRLEDEEEAHQRHCVQVREKSLHSLKIRLPEIFRALSDY  709

Query  223  SRACSIMYQTLESIT  179
            + AC+  Y+ L  I+
Sbjct  710  AHACADSYEKLRIIS  724



>ref|XP_010907260.1| PREDICTED: LOW QUALITY PROTEIN: proline-rich receptor-like protein 
kinase PERK14 [Elaeis guineensis]
Length=740

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 192/262 (73%), Gaps = 3/262 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWET+  HH  Q +IV+ LR+ D+S +PKETSE H+ERT QL  +V++WH QFEK+
Sbjct  477  GMAKMWETVHAHHGTQHEIVVNLRAFDISLAPKETSEQHHERTVQLWQIVRQWHLQFEKL  536

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
               QKEYI+ LN WL+LNL+PI+++LKEKVSSP +P  PPI ALLH+W D + KLPDELA
Sbjct  537  TKSQKEYIKALNSWLRLNLIPIESSLKEKVSSPPQPSQPPIQALLHSWNDQLEKLPDELA  596

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN-DDT  407
            + AIYSFS VV TIV HQ DE+K K++C+D RK+  ++ R F+DW +KY++RR  + ++ 
Sbjct  597  RNAIYSFSEVVRTIVVHQQDELKTKEKCEDLRKKFIRKKRAFDDWSYKYLERRAASGEEA  656

Query  406  EQDGPHEDN--NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
              +G    N   + ER+L +E L+ RLK EEEAY + C QVR KSL SL+T LPELF A+
Sbjct  657  NPEGGRASNQDTLAERKLAIETLESRLKNEEEAYGKLCQQVREKSLGSLQTHLPELFRAV  716

Query  232  SEFSRACSIMYQTLESITHPLN  167
            S+F+ ACS MY+ L S+T   N
Sbjct  717  SDFALACSEMYKKLRSVTQSQN  738



>ref|XP_010931963.1| PREDICTED: uncharacterized protein LOC105052734 [Elaeis guineensis]
 ref|XP_010931964.1| PREDICTED: uncharacterized protein LOC105052734 [Elaeis guineensis]
Length=740

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 191/262 (73%), Gaps = 3/262 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWETM  HH  Q +IV  LR+  +S SPKETSE H+E T QL  VV+EWHSQFEK+
Sbjct  477  GMAKMWETMHVHHGTQHKIVANLRAFAISSSPKETSEQHHECTVQLWRVVREWHSQFEKL  536

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QKEYI+ LN WLKLNL+PI+++LKEKVSSP RP  PPI  LLH+W D + KLPDELA
Sbjct  537  MKNQKEYIKSLNSWLKLNLIPIESSLKEKVSSPPRPSRPPIQPLLHSWNDQLEKLPDELA  596

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            ++AIYSFS V+ TIV HQ +E+K+K++C+D RKE  ++ R F+DWY KY++++  + +  
Sbjct  597  RSAIYSFSEVIRTIVVHQQEELKMKEKCEDMRKEFMRKKRAFDDWYQKYLEKKAASGEEA  656

Query  403  QDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
                 E +N   V ER+L+++ L  RLK E+E + + C QVR KSL SLRT LPELF +M
Sbjct  657  NPEGGEGSNQDRVAERKLEVDGLDARLKAEDENHGKLCKQVRDKSLGSLRTHLPELFRSM  716

Query  232  SEFSRACSIMYQTLESITHPLN  167
            S+F+  CS MY+ L S+T  LN
Sbjct  717  SDFALECSEMYKRLISVTRSLN  738



>emb|CDX87081.1| BnaC09g03960D [Brassica napus]
Length=534

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 195/258 (76%), Gaps = 3/258 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M   H+ Q QIV  L+SL++S S KET++ H+++T Q   V++EWH QFE++
Sbjct  268  GMAKMWTNMCTQHDTQLQIVGELKSLEISTSQKETTKQHHQQTRQFCTVLEEWHVQFERL  327

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D + KLPDE+A
Sbjct  328  VTHQKQYINSLNTWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDRLEKLPDEVA  387

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND---  413
            K+AI SF+AV+ TI+ HQ +EMKLK++C++TR+E  ++ + FE+WY K++Q+R P +   
Sbjct  388  KSAISSFAAVMKTILLHQEEEMKLKEKCEETRREFIRKKQGFEEWYQKHLQKRGPTEEGV  447

Query  412  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            D E+    +D++V ER++ +E LK+RL++EEEAY R C+QVR KSL SL+  LPE+F A+
Sbjct  448  DGEEGSGRDDDHVTERRIVVETLKKRLEDEEEAYQRHCVQVREKSLNSLKIRLPEIFRAL  507

Query  232  SEFSRACSIMYQTLESIT  179
            S+++ AC+  Y+ L  I+
Sbjct  508  SDYAHACADSYEKLRVIS  525



>ref|XP_008808244.1| PREDICTED: uncharacterized protein LOC103720359 [Phoenix dactylifera]
Length=735

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 194/263 (74%), Gaps = 4/263 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH+NQ +IVL L+ LD+S +P ETSEHH   T QL  +V+EWH QF+K+
Sbjct  469  GMAKMWEAMYVHHDNQLKIVLNLKILDISNAPMETSEHHNRHTIQLFDIVKEWHLQFDKL  528

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI+ L+ WLKLN++PI+++LKEKVSSP RP+ PPI ALLHAW D + KLPDELA
Sbjct  529  VSHQKDYIQALSSWLKLNIIPIESSLKEKVSSPPRPRQPPIQALLHAWHDHLDKLPDELA  588

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP-NDDT  407
            K+AI SFSAV+NTIV  Q +E+K +++C +TRKE  K+ R FEDWY KY  RR   +++ 
Sbjct  589  KSAILSFSAVINTIVTLQQEELKQREKCDETRKEYLKKIRAFEDWYSKYSHRRAALSEEA  648

Query  406  EQ---DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
             Q   +G ++++ V ER++ +E+ K RL EEEE + + C QVR KS  +L+T LPEL  A
Sbjct  649  GQEGSEGANQNDPVAERKVAVESAKSRLDEEEENHEKLCKQVREKSFGTLKTHLPELIRA  708

Query  235  MSEFSRACSIMYQTLESITHPLN  167
            MS+FS ACS MY+ L+SI+   N
Sbjct  709  MSDFSHACSEMYKKLKSISQSQN  731



>ref|XP_010519919.1| PREDICTED: uncharacterized protein LOC104799211 [Tarenaya hassleriana]
Length=762

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 193/259 (75%), Gaps = 4/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH+ Q +IV  L+ L++  S KET++HH+ERT Q G +V+EWH QFE++
Sbjct  491  GMAKMWGNMCIHHDTQLKIVGDLKPLEICGSLKETTKHHHERTRQFGNIVEEWHVQFERL  550

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            ++HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH W D + KLPDE+A
Sbjct  551  VMHQKQYINALNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHTWHDWLEKLPDEVA  610

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DT  407
            K+AI SF+AV+ TI+ HQ +EMKLK+RC++TRKE  K+ + FE+WY K++Q+R P++ + 
Sbjct  611  KSAISSFAAVIKTILLHQEEEMKLKERCEETRKEFLKKNQAFEEWYQKHLQKRGPDEAEG  670

Query  406  EQDGPHEDN---NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
             +DG    N    V ER+  +E L++RL++E EAY R C+QVR KSL SL+  LPELF A
Sbjct  671  GEDGASVTNPKDPVSERRFAVETLRKRLEDEVEAYQRHCVQVREKSLNSLKIRLPELFRA  730

Query  235  MSEFSRACSIMYQTLESIT  179
            +S+++ AC+  Y+ L  IT
Sbjct  731  LSDYAHACADAYEKLRIIT  749



>gb|EMT28812.1| hypothetical protein F775_16807 [Aegilops tauschii]
Length=445

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/258 (51%), Positives = 174/258 (67%), Gaps = 4/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW+ M  HH+ Q +I+  L+S D+S + +ETSE H ERT QL  VVQEWH Q+ K 
Sbjct  183  GMGHMWDAMYKHHKAQLKIISELKSFDISVAARETSEQHNERTVQLWQVVQEWHVQYSKF  242

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QKEY+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D++GKLPDE A
Sbjct  243  MASQKEYVGNLYSWIKLNVIPIDTNLKANSSQPVET-TPPIKRLLHAWHDMLGKLPDEDA  301

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRT--PNDD  410
            + AI++FS VV+ I+ HQ +E+KL+ R +DTRKE E+++RQFEDW  KYM++R   P + 
Sbjct  302  RKAIHTFSEVVHIILVHQDEEIKLRQRIQDTRKEHERKSRQFEDWARKYMEKRAGIPPEA  361

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
               DG   D  + ER+  +E L+  LKE EEAY +QC  VR KSL+ LRT LPELF  +S
Sbjct  362  GNPDGTRAD-PLAERKAAMEKLENSLKELEEAYTKQCKVVREKSLSLLRTNLPELFRIVS  420

Query  229  EFSRACSIMYQTLESITH  176
            EFS   + M++ L SI++
Sbjct  421  EFSLQSAAMFKDLWSISN  438



>gb|KFK27812.1| hypothetical protein AALP_AA8G433100 [Arabis alpina]
Length=755

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 195/259 (75%), Gaps = 4/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH+ Q +IV  L+SL++S S KET++ H+ +T Q   V++EWH QF+++
Sbjct  488  GMAKMWTNMCIHHDTQLKIVGELKSLEISTSNKETTKQHHHQTRQFCTVLEEWHVQFDRL  547

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++L+EKVSSP RPQ PPI ALLH+W D + KLPDE+A
Sbjct  548  VTHQKQYINSLNSWLKLNLIPIESSLREKVSSPPRPQRPPIQALLHSWHDRLEKLPDEVA  607

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK++C++TR+E  ++ + FEDWY K++ ++ P ++ E
Sbjct  608  KSAISSFAAVIKTILLHQEEEMKLKEKCEETRREFIRKKQGFEDWYQKHLHKKGPTEEAE  667

Query  403  --QDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
              +DG      ++V ER++ +EALK+RL++EEEA+ R C+QVR KSL SL+  LPE+F A
Sbjct  668  GGEDGTTNTSRDHVSERRIVVEALKKRLEDEEEAHQRHCVQVREKSLNSLKIRLPEIFRA  727

Query  235  MSEFSRACSIMYQTLESIT  179
            +S+++ AC+  Y+ L  I+
Sbjct  728  LSDYAHACADSYEKLRMIS  746



>gb|EMS56206.1| hypothetical protein TRIUR3_11325 [Triticum urartu]
Length=472

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/258 (50%), Positives = 174/258 (67%), Gaps = 4/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW+TM  +H+ Q +I+  L+S D+S + +ETSE H ERT QL  VVQEWH+Q+ K 
Sbjct  210  GMGHMWDTMYKNHKAQFKIISELKSFDISVAARETSEQHNERTVQLWQVVQEWHAQYSKF  269

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QKEY+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D + KLPDE A
Sbjct  270  MASQKEYVGNLYSWIKLNVIPIDTNLKSNSSQPVET-TPPIKRLLHAWHDNLAKLPDEDA  328

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRT--PNDD  410
            + AI++FS VV+ I+ HQ +E+KL+ R +DTRKE E+++RQFEDW  KYM++R   P + 
Sbjct  329  RKAIHTFSEVVHIILVHQDEEIKLRQRIQDTRKEHERKSRQFEDWAQKYMEKRAGIPPEA  388

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
               DG   D  + ER+  +E L+  LKE EEAY +QC  VR KSL+ LRT LPELF  +S
Sbjct  389  GNPDGTRAD-PLAERKAAMEKLENSLKELEEAYTKQCKVVREKSLSLLRTNLPELFRIVS  447

Query  229  EFSRACSIMYQTLESITH  176
            EFS   + M++ L SI++
Sbjct  448  EFSLQSAAMFKGLWSISN  465



>ref|XP_006658396.1| PREDICTED: uncharacterized protein LOC102701368, partial [Oryza 
brachyantha]
Length=437

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 175/258 (68%), Gaps = 4/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW+TM  HH+ Q +I+  L+SLD+S + +ETS+ H++RT QL  VVQ+WH+QF+K 
Sbjct  175  GMGVMWDTMYIHHKTQLRIISGLKSLDISVAARETSDQHHDRTVQLYNVVQDWHAQFDKF  234

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+Y+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D++GKLPDE A
Sbjct  235  MTYQKQYVGSLYSWIKLNVIPIDTNLKPNSSQPHET-TPPIKRLLHAWHDILGKLPDEAA  293

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP--NDD  410
            K AIY+F+ +V TI+ HQ DE+KL+ + +DTR+E  ++ RQF+DW  KYM +      +D
Sbjct  294  KKAIYTFAEIVKTILVHQEDELKLRLKIEDTRREHGRKRRQFDDWAQKYMHKTAGILPED  353

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
               DG   D  ++ER+  +E ++  +KE EE Y++QC  VR KSL  LRT LPELF  +S
Sbjct  354  GNPDGLRAD-PMVERKAAMERMELSMKELEETYVKQCRVVREKSLNLLRTSLPELFTVVS  412

Query  229  EFSRACSIMYQTLESITH  176
            +FS   + M++ L SI H
Sbjct  413  DFSLQSAGMFKGLWSIAH  430



>gb|EYU29268.1| hypothetical protein MIMGU_mgv1a002196mg [Erythranthe guttata]
Length=702

 Score =   255 bits (651),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 181/254 (71%), Gaps = 0/254 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M +MWE+M  HH++Q  IV  L+SL++S S  ET++HH+ERT QL  VV +WHSQFEK+
Sbjct  442  GMTKMWESMCTHHDSQLSIVSNLKSLEISGSLIETTKHHHERTNQLSAVVDQWHSQFEKL  501

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+YI  LN WLKLNL+PI+++LKEKVSSP     PPI  LL +W DL+ KLPDE+A
Sbjct  502  VNNQKQYINSLNSWLKLNLIPIESSLKEKVSSPPHTPTPPIHPLLRSWHDLLEKLPDEVA  561

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            KTAI SF+AV+ TI  HQ +EMK+K++ ++TR+E  ++ + FE+WY KYMQRR   +D  
Sbjct  562  KTAISSFAAVIKTIGIHQEEEMKMKEKYEETRREYYRKKQSFEEWYQKYMQRRAGQNDEN  621

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
                   + V ERQ  +++LK+RL EE E + + C+QVR KSL SL+  LPELF A+S++
Sbjct  622  DPDKGVKDPVSERQFVVDSLKKRLDEEMEEHQKMCVQVREKSLGSLKIRLPELFRALSDY  681

Query  223  SRACSIMYQTLESI  182
            + +C   YQ L  I
Sbjct  682  AHSCFDAYQRLRLI  695



>ref|XP_006655291.1| PREDICTED: uncharacterized protein LOC102706661 [Oryza brachyantha]
Length=553

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 176/251 (70%), Gaps = 1/251 (0%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MWE M  HHENQ + VL L+S+D+S S  ETS+HH+  T QL  +V++W + F  ++
Sbjct  289  MAKMWEDMHLHHENQLKTVLNLKSVDISDSHIETSDHHHSHTRQLRDIVEKWTANFSDLM  348

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             +QKEY+  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + + KLPD+LAK
Sbjct  349  SYQKEYVNALYSWLKLNLIPIESSLKEKVASPPRAQQPPVKALLQAWNEHLTKLPDDLAK  408

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            TAI SF AV++TI+  Q +E+K K+ C+ TRKE  ++ R FEDWYHK+ QRR  + D E 
Sbjct  409  TAIVSFRAVLDTILSVQDEELKQKETCEHTRKEYTRKARAFEDWYHKHAQRRAFDVDPES  468

Query  400  -DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +G  + + V E++  +E+LK +L +E EA+ +   QVR KSL+ L+  LPELF A+++F
Sbjct  469  GEGTTQKDTVAEKRFAVESLKNKLDDEVEAHNKLSKQVREKSLSILKAHLPELFRALTDF  528

Query  223  SRACSIMYQTL  191
            S A   MY  L
Sbjct  529  SHASFDMYSKL  539



>ref|XP_009393120.1| PREDICTED: uncharacterized protein LOC103978894 [Musa acuminata 
subsp. malaccensis]
Length=668

 Score =   248 bits (634),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 183/265 (69%), Gaps = 3/265 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW+ M  HH +Q +++  +++LD+S + KETSEHH++RT QL   V+EW SQ  K+
Sbjct  404  GMAKMWQAMHMHHYSQLKMMEGIKALDISNASKETSEHHHKRTLQLLDTVREWQSQLHKL  463

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGK-LPDEL  587
            + HQK+Y+  L+ WLKLNL+PID +LKEKVSSPQRP + PI  L+HAW + + K LP+EL
Sbjct  464  VTHQKQYVGALDSWLKLNLIPIDGSLKEKVSSPQRPAHAPIQTLVHAWHEYLEKQLPEEL  523

Query  586  AKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDT  407
            A TA+ SFSAV+NTI   Q +E+K K+RC + +K   ++ R FEDW  K+ Q+R    +T
Sbjct  524  ANTALLSFSAVLNTIEAVQQEELKQKERCGEIQKAYLRKKRAFEDWCQKHSQKRMGEPET  583

Query  406  EQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
              +   +++ V ER+  +E+LK +L E  EA+   C QVR KS  +L+T LPELF A+S+
Sbjct  584  GGEAASQNDPVGERRRVVESLKSKLDEGVEAHKGICKQVREKSSVTLKTHLPELFRAVSD  643

Query  226  FSRACSIMYQTLESIT--HPLNRES  158
            F+  CS MY +L+ +T  +PL + +
Sbjct  644  FAELCSKMYTSLKLVTDQNPLTKAT  668



>gb|EEE63626.1| hypothetical protein OsJ_18443 [Oryza sativa Japonica Group]
Length=663

 Score =   248 bits (634),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 176/251 (70%), Gaps = 1/251 (0%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MWE M  HHENQ + VL L+S+D+S S  ETS+HH+  T QL  +V++W + F  ++
Sbjct  401  MAKMWEDMHLHHENQLKTVLNLKSVDISDSHIETSDHHHSHTRQLRDIVEKWTTNFSDLM  460

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + + KLPD+LAK
Sbjct  461  SYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEHLTKLPDDLAK  520

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            TAI SF AV++TI+  Q +E+K K+ C+ TRKE  ++ R FEDWYHK+ QRR  + D E 
Sbjct  521  TAIVSFRAVLDTILSVQDEELKQKETCEHTRKEYMRKARAFEDWYHKHAQRRAFDVDPES  580

Query  400  -DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +G  + + V E++  +E+LK +L +E EA+ +   QVR KSL+ L+  LPELF A+++F
Sbjct  581  GEGTSQKDTVAEKRFAVESLKNKLDDEVEAHNKLSKQVREKSLSILKAHLPELFRALTDF  640

Query  223  SRACSIMYQTL  191
            S A   MY  +
Sbjct  641  SLASFEMYSKM  651



>dbj|BAJ96225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=731

 Score =   249 bits (637),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 173/257 (67%), Gaps = 4/257 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW+ M  HH+ Q +I+  L+S D+S +  +TSE H ERT QL  VV+EWH+Q+ K 
Sbjct  469  GMGHMWDAMYKHHKAQLKIISELKSFDVSVAAPDTSERHNERTMQLWQVVREWHAQYSKF  528

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQKEY+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D++GKLPDE A
Sbjct  529  MEHQKEYVGNLYSWIKLNVIPIDTNLKSNSSQPVE-TTPPIKRLLHAWHDILGKLPDEAA  587

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRT--PNDD  410
            K +I++FS V+ TI+ HQ +EMKL  R +DTRKE E+++RQFEDW  KYM++R   P + 
Sbjct  588  KNSIHTFSEVIRTILVHQGEEMKLWQRIQDTRKEHERKSRQFEDWARKYMEKRAGIPPEA  647

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
               DG   D  + +R+  +E L+  LK+ EE Y +QC  VR KSL+ LRT LPELF  +S
Sbjct  648  GNPDGTRAD-PLADRKASMERLELSLKDLEEEYTKQCKVVREKSLSLLRTSLPELFRVVS  706

Query  229  EFSRACSIMYQTLESIT  179
            +FS   + M+++L SI+
Sbjct  707  DFSLQSAAMFKSLWSIS  723



>gb|EMT20964.1| hypothetical protein F775_31339 [Aegilops tauschii]
Length=268

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 182/266 (68%), Gaps = 8/266 (3%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA MW +M  HH++Q   +  +R+ ++   P+ET++ HY++T +L  +V+EWH QF+K++
Sbjct  1    MANMWSSMHRHHKSQFLTISGIRAFEVPPVPRETTDLHYKQTCELRDIVREWHMQFDKLM  60

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             HQK YIR LN WLKLNL+ I++NLKEKVSSP R   PPI  LL+AW DL+ +LP ELAK
Sbjct  61   DHQKGYIRALNAWLKLNLISIESNLKEKVSSPPRQVEPPIKNLLYAWHDLLERLPVELAK  120

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            TAI SF+ V++ IV  Q +E+ L+ RC++TR++L+++  QFEDW+ +Y +R+      E+
Sbjct  121  TAIKSFTEVISNIVLLQEEEVSLRRRCEETRRDLDRKRAQFEDWHRRYTERKA--SQGEE  178

Query  400  DGPHEDN-----NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
              P   N     +V ER++ +E ++ RLKEEE+ ++R   QVR K+L +LR  LPELF  
Sbjct  179  ANPEAANTPSLDHVNERRITIEEVEIRLKEEEKLHLRLARQVREKTLANLRMHLPELFRN  238

Query  235  MSEFSRACSIMYQTL-ESITHPLNRE  161
            M++FS  C  MY +L +S   P+ R+
Sbjct  239  MADFSFFCHDMYSSLRKSAVLPMLRD  264



>ref|XP_002874269.1| hypothetical protein ARALYDRAFT_910621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50528.1| hypothetical protein ARALYDRAFT_910621 [Arabidopsis lyrata subsp. 
lyrata]
Length=764

 Score =   249 bits (637),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 195/268 (73%), Gaps = 5/268 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH+ Q  IV  L+SL++S S +ET++ H+ +T Q   V++EWH QF+++
Sbjct  494  GMAKMWTNMCIHHDTQLGIVGELKSLEISTSLRETTKQHHHQTRQFCTVLEEWHVQFDRL  553

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++L+EKVSSP RPQ PPI ALLH+W D + KLPDE+A
Sbjct  554  VTHQKQYINALNSWLKLNLIPIESSLREKVSSPPRPQRPPIQALLHSWHDRLEKLPDEVA  613

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI+SF+ V+ TI+ HQ DEMKLK++C++TR+E  ++ + FEDWY K++Q+R P ++ E
Sbjct  614  KSAIFSFAEVIKTILLHQEDEMKLKEKCEETRREFIRKKQGFEDWYQKHLQKRGPTEEAE  673

Query  403  QDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
                      ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  LPE+F A+
Sbjct  674  GGDDTTTSARDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIRLPEIFRAL  733

Query  232  SEFSRACSIMYQTLESI--THPLNREST  155
            S+++ AC+  Y+ L  I  +H  N  +T
Sbjct  734  SDYAHACADSYEKLRIISQSHKSNGGAT  761



>ref|XP_006394813.1| hypothetical protein EUTSA_v10003682mg [Eutrema salsugineum]
 gb|ESQ32099.1| hypothetical protein EUTSA_v10003682mg [Eutrema salsugineum]
Length=770

 Score =   249 bits (636),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 192/257 (75%), Gaps = 3/257 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M   H+ Q +IV  L+SL++S   KET++ H+++T Q   V++EWH+QF+++
Sbjct  506  GMAKMWTNMCIQHDTQLKIVGELKSLEISTCHKETTKQHHQQTRQFCTVLEEWHAQFDRL  565

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D + KLPDE+A
Sbjct  566  VTHQKQYINSLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDCLEKLPDEVA  625

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP--NDD  410
            K+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FE+WY K++Q+R P    +
Sbjct  626  KSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEEWYQKHLQKRGPMEEGE  685

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
              +D    D +V ER++ +E LK+RL++EEEA+ R C+QVR KSL SL+  LPE+F A+S
Sbjct  686  GGEDASSRD-HVTERRIVVETLKKRLEDEEEAHQRHCVQVREKSLNSLKIRLPEIFRALS  744

Query  229  EFSRACSIMYQTLESIT  179
            +++ AC+  Y+ L  I+
Sbjct  745  DYAHACADSYEKLRIIS  761



>gb|EEC79170.1| hypothetical protein OsI_19854 [Oryza sativa Indica Group]
Length=665

 Score =   247 bits (630),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 176/251 (70%), Gaps = 1/251 (0%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MWE M  HHENQ + VL L+S+D+S S  ETS+HH+  T QL  +V++W + F  ++
Sbjct  403  MAKMWEDMHLHHENQLKTVLNLKSVDISDSHIETSDHHHSHTRQLRDIVEKWTTNFSDLM  462

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + + KLPD+LAK
Sbjct  463  SYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEHLTKLPDDLAK  522

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            TAI SF AV++TI+  Q +E+K K+ C+ TRKE  ++ R FEDWYHK+ QRR  + D E 
Sbjct  523  TAIVSFRAVLDTILSVQDEELKQKETCEHTRKEYMRKARAFEDWYHKHAQRRAFDVDPES  582

Query  400  -DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +G  + + V E++  +E+LK +L +E EA+ +   QVR KSL+ L+  LPELF A+++F
Sbjct  583  GEGTSQKDTVAEKRFAVESLKNKLDDEVEAHNKLSKQVREKSLSILKAHLPELFRALTDF  642

Query  223  SRACSIMYQTL  191
            S A   +Y  +
Sbjct  643  SLASFEIYSKM  653



>ref|NP_197941.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM13874.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91720.1| unknown protein [Arabidopsis thaliana]
 gb|AED93470.1| uncharacterized protein AT5G25590 [Arabidopsis thaliana]
Length=775

 Score =   249 bits (635),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/258 (51%), Positives = 191/258 (74%), Gaps = 3/258 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH+ Q  IV  L++L++S S KET++ H+ +T Q   V++EWH QF+ +
Sbjct  505  GMAKMWTNMCIHHDTQLGIVGELKALEISTSLKETTKQHHHQTRQFCTVLEEWHVQFDTL  564

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN+WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D + KLPDE+A
Sbjct  565  VTHQKQYINSLNNWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDRLEKLPDEVA  624

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +EMKLK++C++TR+E  ++ + FEDWY K++Q+R P ++ E
Sbjct  625  KSAISSFAAVIKTILLHQEEEMKLKEKCEETRREFIRKKQGFEDWYQKHLQKRGPTEEAE  684

Query  403  QDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
                      ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  LPE+F A+
Sbjct  685  GGDDATTSSRDHVTERRIAVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIRLPEIFRAL  744

Query  232  SEFSRACSIMYQTLESIT  179
            S+++ AC+  Y+ L  I+
Sbjct  745  SDYAHACADSYEKLRIIS  762



>ref|XP_010228227.1| PREDICTED: formin-like protein 5 [Brachypodium distachyon]
Length=741

 Score =   248 bits (633),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 177/256 (69%), Gaps = 4/256 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M +MW+ M GHH+ Q +I+L L+S D+S + +ETS+ H +RT QL  +VQEWH+Q++K 
Sbjct  479  GMWQMWDKMYGHHKAQLKIILELKSFDISVAARETSDQHNDRTVQLWHIVQEWHTQYDKF  538

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+Y+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D++GKLPD+ A
Sbjct  539  MTYQKQYVGSLYSWIKLNVIPIDTNLKPNSSQPVE-TTPPIKRLLHAWHDILGKLPDDAA  597

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRT--PNDD  410
            K AI++F+ VV+TI+ HQ DEMKL  + ++TRK+ E++ RQFEDW  +YM++R   P++ 
Sbjct  598  KKAIHTFAEVVHTILLHQDDEMKLSIKIQETRKDYERKKRQFEDWAQRYMEKRAGIPHEA  657

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
               DG   D  + ER++ +E L+  LK+ EE Y +QC  VR KSL+ LRT LPELF  +S
Sbjct  658  GNPDGTRAD-PLAERKVAVERLELVLKDLEEQYKKQCRVVREKSLSLLRTNLPELFRVVS  716

Query  229  EFSRACSIMYQTLESI  182
            EFS   + M + L SI
Sbjct  717  EFSLQSAAMLKGLWSI  732



>gb|EMS63249.1| hypothetical protein TRIUR3_24469 [Triticum urartu]
Length=268

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/255 (47%), Positives = 175/255 (69%), Gaps = 7/255 (3%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA MW +M  HH++Q  I+  +R+ ++   P+ET++ HY++T +L  +V+EWH QF+K++
Sbjct  1    MANMWSSMHRHHKSQFLIISGIRAFEVPPVPRETTDLHYKQTCELRDIVREWHMQFDKLM  60

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             HQK YIR LN WLKLNL+ I++NLKEKVSSP R   PPI  LL+AW D + +LP ELAK
Sbjct  61   EHQKGYIRALNAWLKLNLISIESNLKEKVSSPPRQVEPPIKNLLYAWHDQLERLPVELAK  120

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            TAI SF+ V++ IV  Q +E+ L+ RC +TR++L+++  QFEDW+ +Y +R+      E+
Sbjct  121  TAIKSFTEVISNIVLLQEEEVSLRRRCDETRRDLDRKRAQFEDWHRRYTERKA--SQGEE  178

Query  400  DGPHEDN-----NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
              P   N     +V ER++ +E ++ RLKEEE+ ++R   QVR K+L +LR  LPELF  
Sbjct  179  PNPEAANTPSLDHVNERRIAIEEVEIRLKEEEKLHLRLARQVREKTLANLRMHLPELFRN  238

Query  235  MSEFSRACSIMYQTL  191
            M++FS  C  MY +L
Sbjct  239  MADFSFFCHDMYSSL  253



>gb|AAT93897.1| unknown protein [Oryza sativa Japonica Group]
Length=847

 Score =   248 bits (634),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/251 (50%), Positives = 176/251 (70%), Gaps = 1/251 (0%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MWE M  HHENQ + VL L+S+D+S S  ETS+HH+  T QL  +V++W + F  ++
Sbjct  536  MAKMWEDMHLHHENQLKTVLNLKSVDISDSHIETSDHHHSHTRQLRDIVEKWTTNFSDLM  595

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + + KLPD+LAK
Sbjct  596  SYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEHLTKLPDDLAK  655

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            TAI SF AV++TI+  Q +E+K K+ C+ TRKE  ++ R FEDWYHK+ QRR  + D E 
Sbjct  656  TAIVSFRAVLDTILSVQDEELKQKETCEHTRKEYMRKARAFEDWYHKHAQRRAFDVDPES  715

Query  400  -DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +G  + + V E++  +E+LK +L +E EA+ +   QVR KSL+ L+  LPELF A+++F
Sbjct  716  GEGTSQKDTVAEKRFAVESLKNKLDDEVEAHNKLSKQVREKSLSILKAHLPELFRALTDF  775

Query  223  SRACSIMYQTL  191
            S A   MY  +
Sbjct  776  SLASFEMYSKM  786



>gb|EEE66795.1| hypothetical protein OsJ_23540 [Oryza sativa Japonica Group]
Length=561

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 174/258 (67%), Gaps = 4/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW+ M  HH+ Q +I+L L+SLD+S +P+ETSE H++RT QL  VV EWH+QF+K 
Sbjct  299  GMWHMWDAMYLHHKTQLKIILELKSLDISVAPRETSEQHHDRTVQLWNVVHEWHTQFDKF  358

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+Y+  L  W+KLN++PIDTNLK   S P     PPI  +LHAW +++GKLPDE A
Sbjct  359  MTYQKQYVGSLYTWIKLNVIPIDTNLKPNSSQPHE-TTPPIKRVLHAWHEILGKLPDEAA  417

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP--NDD  410
            K AI +F+ +V TI+ HQ DE+KL+ + +DTR++  K+ RQF+DW  KY+ +      +D
Sbjct  418  KKAINTFAEIVKTILVHQEDELKLRMKIEDTRRDYGKKRRQFDDWAQKYIHQTAGILPED  477

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
               DG   D  + ER+  +E L+  +KE EE Y++QC  VR KSL+ LRT LPELF  +S
Sbjct  478  RNPDGARPD-PMAERKAAMEKLELSMKELEEMYVKQCRVVREKSLSLLRTNLPELFRVVS  536

Query  229  EFSRACSIMYQTLESITH  176
            +FS   + M++ + SI H
Sbjct  537  DFSLQSAGMFKGVWSIAH  554



>ref|XP_006287097.1| hypothetical protein CARUB_v10000261mg [Capsella rubella]
 gb|EOA19995.1| hypothetical protein CARUB_v10000261mg [Capsella rubella]
Length=791

 Score =   247 bits (630),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/268 (50%), Positives = 194/268 (72%), Gaps = 5/268 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++EWH QF+++
Sbjct  521  GMAKMWTNMCIHHDTQLSIVGELKSLEISTSQKETTKQHHHQTRQFCTVLEEWHVQFDRL  580

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALL AW D + KLPDE+A
Sbjct  581  VTHQKQYINYLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLFAWHDRLEKLPDEVA  640

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+R P ++ E
Sbjct  641  KSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQKRGPTEEAE  700

Query  403  QDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
                      ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  LPE+F A+
Sbjct  701  GGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCIQVREKSLNSLKIRLPEIFRAL  760

Query  232  SEFSRACSIMYQTLESI--THPLNREST  155
            S+++ AC+  Y+ L  I  +H  N  +T
Sbjct  761  SDYAHACADSYEKLRIISQSHKANSGAT  788



>ref|XP_010421422.1| PREDICTED: DNA ligase 1-like isoform X3 [Camelina sativa]
Length=790

 Score =   246 bits (629),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 195/268 (73%), Gaps = 5/268 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++EWH QF+++
Sbjct  520  GMAKMWTNMCIHHDTQLSIVGQLKSLEISTSQKETTKQHHHQTRQFCTVLEEWHVQFDRL  579

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D + KLPDE+A
Sbjct  580  VTHQKQYINCLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDRLEKLPDEVA  639

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+R P ++ E
Sbjct  640  KSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQKRGPTEEAE  699

Query  403  QDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
                      ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  LPE+F A+
Sbjct  700  GGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIRLPEIFRAL  759

Query  232  SEFSRACSIMYQTLESI--THPLNREST  155
            S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  760  SDYAHSCADSYEKLRIISQSHKSNGGAT  787



>ref|XP_010421421.1| PREDICTED: DNA ligase 1-like isoform X2 [Camelina sativa]
Length=792

 Score =   246 bits (629),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 195/268 (73%), Gaps = 5/268 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++EWH QF+++
Sbjct  522  GMAKMWTNMCIHHDTQLSIVGQLKSLEISTSQKETTKQHHHQTRQFCTVLEEWHVQFDRL  581

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D + KLPDE+A
Sbjct  582  VTHQKQYINCLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDRLEKLPDEVA  641

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+R P ++ E
Sbjct  642  KSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQKRGPTEEAE  701

Query  403  QDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
                      ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  LPE+F A+
Sbjct  702  GGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIRLPEIFRAL  761

Query  232  SEFSRACSIMYQTLESI--THPLNREST  155
            S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  762  SDYAHSCADSYEKLRIISQSHKSNGGAT  789



>ref|XP_010421420.1| PREDICTED: DNA ligase 1-like isoform X1 [Camelina sativa]
Length=796

 Score =   246 bits (629),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 195/268 (73%), Gaps = 5/268 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++EWH QF+++
Sbjct  526  GMAKMWTNMCIHHDTQLSIVGQLKSLEISTSQKETTKQHHHQTRQFCTVLEEWHVQFDRL  585

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D + KLPDE+A
Sbjct  586  VTHQKQYINCLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDRLEKLPDEVA  645

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+R P ++ E
Sbjct  646  KSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQKRGPTEEAE  705

Query  403  QDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
                      ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  LPE+F A+
Sbjct  706  GGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIRLPEIFRAL  765

Query  232  SEFSRACSIMYQTLESI--THPLNREST  155
            S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  766  SDYAHSCADSYEKLRIISQSHKSNGGAT  793



>gb|EAZ03209.1| hypothetical protein OsI_25359 [Oryza sativa Indica Group]
Length=599

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 174/258 (67%), Gaps = 4/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW+ M  HH+ Q +I+L L+SLD+S +P+ETSE H++RT QL  VV EWH+QF+K 
Sbjct  337  GMWHMWDAMYLHHKTQLKIILELKSLDISVAPRETSEQHHDRTVQLWNVVHEWHTQFDKF  396

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+Y+  L  W+KLN++PIDTNLK   S P     PPI  +LHAW +++GKLPDE A
Sbjct  397  MTYQKQYVGSLYTWIKLNVIPIDTNLKPNSSQPHE-TTPPIKRVLHAWHEILGKLPDEAA  455

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP--NDD  410
            K AI +F+ +V TI+ HQ DE+KL+ + +DTR++  K+ RQF+DW  KY+ +      +D
Sbjct  456  KKAINTFAEIVKTILVHQEDELKLRMKIEDTRRDYGKKRRQFDDWAQKYIHQTAGILPED  515

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
               DG   D  + ER+  +E L+  +KE EE Y++QC  VR KSL+ LRT LPELF  +S
Sbjct  516  RNPDGARPD-PMAERKAAMEKLELSMKELEEMYVKQCRVVREKSLSLLRTNLPELFRVVS  574

Query  229  EFSRACSIMYQTLESITH  176
            +FS   + M++ + SI H
Sbjct  575  DFSLQSAGMFKGVWSIAH  592



>ref|XP_006826988.1| hypothetical protein AMTR_s00010p00207960 [Amborella trichopoda]
 gb|ERM94225.1| hypothetical protein AMTR_s00010p00207960 [Amborella trichopoda]
Length=693

 Score =   244 bits (623),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/259 (46%), Positives = 175/259 (68%), Gaps = 5/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             +A+MWE M  +HENQ +IV  LRSLD+S +PKETS+ H+++T QL    ++W S F+ +
Sbjct  426  GLAKMWEAMYQNHENQLKIVADLRSLDISNAPKETSKEHHKQTGQLCQAAKDWDSHFKNL  485

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  QK+YI  LN WL+LNL+PI+++LKEKVSSP R  NPPI  LLH W   +GKL DE+ 
Sbjct  486  VTLQKKYIEALNSWLRLNLIPIESSLKEKVSSPPRVVNPPIHTLLHEWHARLGKLSDEVT  545

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND-DT  407
              AI  F+AV+  I + Q +E+K+K+RC +  ++  ++ R F DW  KY+ +R P + D 
Sbjct  546  INAISGFAAVIEAIHKQQAEEIKIKERCAELEEDYNRKNRSFVDWKQKYLDKRGPEEVDG  605

Query  406  E---QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            E   + G H+D  ++E++  +E LK+R  EE E + + C QVR KSL SL+TGLP LF A
Sbjct  606  ERGGEGGTHKD-PLVEKEFVVETLKKRFDEEVELHRKICKQVREKSLGSLKTGLPPLFRA  664

Query  235  MSEFSRACSIMYQTLESIT  179
            +S+++  CS +Y+ L  +T
Sbjct  665  ISDYAHTCSEVYKELHVVT  683



>ref|XP_010454904.1| PREDICTED: ABC transporter F family member 4-like isoform X1 
[Camelina sativa]
 ref|XP_010454905.1| PREDICTED: ABC transporter F family member 4-like isoform X2 
[Camelina sativa]
Length=798

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 195/268 (73%), Gaps = 5/268 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++EWH QF+++
Sbjct  528  GMAKMWTNMCIHHDTQLTIVGQLKSLEISTSQKETTKQHHHQTRQFCTVLEEWHVQFDRL  587

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI +LLH+W D + KLPDE+A
Sbjct  588  VTHQKQYINCLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQSLLHSWHDRLEKLPDEVA  647

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+R P ++ E
Sbjct  648  KSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQKRGPTEEAE  707

Query  403  QDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
                      ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  LPE+F A+
Sbjct  708  GGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIRLPEIFRAL  767

Query  232  SEFSRACSIMYQTLESI--THPLNREST  155
            S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  768  SDYAHSCADSYEKLRIISQSHKSNGGAT  795



>ref|XP_010493822.1| PREDICTED: DNA ligase 1-like [Camelina sativa]
Length=800

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 195/268 (73%), Gaps = 5/268 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH+ Q  IV  L+SL++S S KET++ H+ +T Q   V++EWH QF+++
Sbjct  530  GMAKMWTNMCIHHDTQLSIVGQLKSLEISTSQKETTKQHHHQTRQFCTVLEEWHVQFDRL  589

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK+YI  LN WLKLNL+PI+++LKEKVSSP RPQ PPI +LLH+W D + KLPDE+A
Sbjct  590  VTHQKQYINCLNSWLKLNLIPIESSLKEKVSSPPRPQRPPIQSLLHSWHDRLEKLPDEVA  649

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+AI SF+AV+ TI+ HQ +E+KLK++C++TR+E  ++ + FEDWY K++Q+R P ++ E
Sbjct  650  KSAISSFAAVIKTILLHQEEEIKLKEKCEETRREFIRKKQGFEDWYQKHLQKRGPTEEAE  709

Query  403  QDG---PHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
                      ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  LPE+F A+
Sbjct  710  GGDDATTSSRDHVTERRIVVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIRLPEIFRAL  769

Query  232  SEFSRACSIMYQTLESI--THPLNREST  155
            S+++ +C+  Y+ L  I  +H  N  +T
Sbjct  770  SDYAHSCADSYEKLRIISQSHKSNGGAT  797



>emb|CDM83169.1| unnamed protein product [Triticum aestivum]
Length=437

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/267 (46%), Positives = 183/267 (69%), Gaps = 8/267 (3%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW +M  HH++Q  I+  +R+ ++   P+ET++ HY++T +L  +V+EWH QF+K+
Sbjct  169  GMAKMWSSMHRHHKSQFLIISGIRAFEVPPVPRETTDLHYKQTCELRDIVREWHMQFDKL  228

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YIR LN WLKLNL+ I++NLKEKVSSP R   PPI  LL+AW D + +LP ELA
Sbjct  229  MDHQKGYIRALNAWLKLNLISIESNLKEKVSSPPRQVEPPIKNLLYAWHDQLERLPVELA  288

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            KTAI SF+ V++ IV  Q +E+ L+ RC++TR++L+++  QFEDW+ +Y +R+      E
Sbjct  289  KTAIKSFTEVISNIVLLQEEEVSLRRRCEETRRDLDRKKAQFEDWHRRYTERKASQG--E  346

Query  403  QDGPHEDN-----NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
            +  P   N     +V ER++ +E ++ RLKEEE+ ++R   QVR K+L +LR  LPELF 
Sbjct  347  EANPEAANTPSLDHVNERRIAIEEVEIRLKEEEKLHLRLVRQVREKTLANLRMHLPELFR  406

Query  238  AMSEFSRACSIMYQTL-ESITHPLNRE  161
             M++FS  C  MY +L +S   P+ R+
Sbjct  407  NMADFSFFCHDMYSSLRKSAVLPMLRD  433



>dbj|BAC16409.1| putative bZIP protein [Oryza sativa Japonica Group]
 dbj|BAD31698.1| putative bZIP protein [Oryza sativa Japonica Group]
Length=737

 Score =   243 bits (619),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 174/258 (67%), Gaps = 4/258 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW+ M  HH+ Q +I+L L+SLD+S +P+ETSE H++RT QL  VV EWH+QF+K 
Sbjct  475  GMWHMWDAMYLHHKTQLKIILELKSLDISVAPRETSEQHHDRTVQLWNVVHEWHTQFDKF  534

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+Y+  L  W+KLN++PIDTNLK   S P     PPI  +LHAW +++GKLPDE A
Sbjct  535  MTYQKQYVGSLYTWIKLNVIPIDTNLKPNSSQPHE-TTPPIKRVLHAWHEILGKLPDEAA  593

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP--NDD  410
            K AI +F+ +V TI+ HQ DE+KL+ + +DTR++  K+ RQF+DW  KY+ +      +D
Sbjct  594  KKAINTFAEIVKTILVHQEDELKLRMKIEDTRRDYGKKRRQFDDWAQKYIHQTAGILPED  653

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
               DG   D  + ER+  +E L+  +KE EE Y++QC  VR KSL+ LRT LPELF  +S
Sbjct  654  RNPDGARPD-PMAERKAAMEKLELSMKELEEMYVKQCRVVREKSLSLLRTNLPELFRVVS  712

Query  229  EFSRACSIMYQTLESITH  176
            +FS   + M++ + SI H
Sbjct  713  DFSLQSAGMFKGVWSIAH  730



>gb|EMT10854.1| hypothetical protein F775_26145 [Aegilops tauschii]
Length=628

 Score =   240 bits (612),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 170/250 (68%), Gaps = 0/250 (0%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            +A+MWE M  HH NQ + VL L+S+D+S S  ETS HH+  T QL  +V +W++ F  ++
Sbjct  365  LAKMWEDMHMHHANQLKTVLDLKSVDISDSSIETSAHHHSHTRQLHDIVDKWNTNFSDLM  424

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + + KLPD+LA+
Sbjct  425  SYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEQLAKLPDDLAR  484

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
             AI SF AV+ TI+  Q +E+K K+ C+   KE  ++ R FE+WYHK+ QRRT +D    
Sbjct  485  HAIVSFRAVLETILGVQDEELKKKEACEQIHKEYVRKARAFEEWYHKHGQRRTFDDPESG  544

Query  400  DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  221
            +G  + + + E++  +E+LK +L  E EA+ +   QVR KSL+ LR  LPELF A+++FS
Sbjct  545  EGTSQKDAISEKRFAVESLKSKLDNEVEAHNKLSKQVREKSLSILRAHLPELFRALTDFS  604

Query  220  RACSIMYQTL  191
             A + M+  L
Sbjct  605  HATADMHSKL  614



>dbj|BAJ96409.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=791

 Score =   242 bits (617),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 169/249 (68%), Gaps = 0/249 (0%)
 Frame = -2

Query  937  ARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMII  758
            A+MWE M  HH NQ + VL L+S+D+S S  ETS HH+  T QL  +V +W++ F  ++ 
Sbjct  529  AKMWEDMHMHHANQLKTVLDLKSVDISDSSIETSAHHHSHTRQLHDIVDKWNTNFSDLMS  588

Query  757  HQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKT  578
            +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + + KLPD+LA+ 
Sbjct  589  YQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEQLAKLPDDLARH  648

Query  577  AIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQD  398
            AI SF AV+ TI+  Q +E+K K+ C+   KE  ++ R FE+WYHK+ QRRT +D    D
Sbjct  649  AIVSFRAVLETILGVQDEELKKKEVCEQIHKEYVRKARAFEEWYHKHGQRRTFDDPESGD  708

Query  397  GPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSR  218
            G  + + + ER+  +E+LK +L  E EA+ +   QVR KSL+ LR  LPELF A+++FS 
Sbjct  709  GTSQKDAISERRFAVESLKSKLDNEVEAHNKLSKQVREKSLSILRAHLPELFRALTDFSH  768

Query  217  ACSIMYQTL  191
            A + M+  L
Sbjct  769  ATADMHSKL  777



>ref|XP_002457866.1| hypothetical protein SORBIDRAFT_03g017350 [Sorghum bicolor]
 gb|EES02986.1| hypothetical protein SORBIDRAFT_03g017350 [Sorghum bicolor]
Length=264

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/253 (48%), Positives = 173/253 (68%), Gaps = 3/253 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MW +M  HH +Q  I+  +R  ++   P+ET++ HY +T +L  +V+EWH+QFEK++
Sbjct  1    MAKMWSSMHRHHRSQFLIISGIRGFEIPSVPRETTDSHYIQTCELRDIVKEWHTQFEKLM  60

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             +QK YIR LN WLKLNL+PI++N+KEKVSSP R  +PPI  LLHAW D + +LP ELAK
Sbjct  61   DNQKAYIRALNAWLKLNLIPIESNIKEKVSSPPRLVDPPIKHLLHAWHDELERLPIELAK  120

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP-NDDTE  404
            TAI +F+ V++ IV  Q +E+ L+ RC +TR++L ++   FEDW+ KY++RR    +DT 
Sbjct  121  TAIKTFAEVMSNIVHLQEEEVNLRRRCDETRRDLTRKRAHFEDWHQKYLERRAAFGEDTN  180

Query  403  QDGPHEDN--NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
             D     N   V +R+  +E L+ RL+EEE  ++R   QVR KSL +LRT LPELF  M+
Sbjct  181  PDAAETQNIDPVEDRKRNIEELEVRLREEEGHHLRHARQVREKSLANLRTHLPELFRNMA  240

Query  229  EFSRACSIMYQTL  191
            +F+  C  MY  L
Sbjct  241  DFAYFCHDMYNNL  253



>gb|EMS61963.1| hypothetical protein TRIUR3_31953 [Triticum urartu]
Length=695

 Score =   238 bits (608),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 170/250 (68%), Gaps = 0/250 (0%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            +A+MWE M  HH NQ + VL L+S+D+S S  ETS HH+  T QL  +V +W++ F  ++
Sbjct  381  LAKMWEDMHMHHANQLKTVLDLKSVDISDSSIETSAHHHSHTRQLHDIVDKWNTNFSDLM  440

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + + KLPD+LA+
Sbjct  441  SYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEQLAKLPDDLAR  500

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
             AI SF AV+ TI+  Q +E+K K+ C+   KE  ++ R FE+WYHK+ QRRT +D    
Sbjct  501  HAIVSFRAVLETILGVQDEELKKKEACEQIHKEYVRKARAFEEWYHKHGQRRTFDDPESG  560

Query  400  DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  221
            +G  + + + E++  +E+LK +L  E EA+ +   QVR KSL+ LR  LPELF A+++FS
Sbjct  561  EGTSQKDAISEKRFAVESLKSKLDSEVEAHNKLSKQVREKSLSILRAHLPELFRALTDFS  620

Query  220  RACSIMYQTL  191
             A + M+  L
Sbjct  621  HATAEMHSKL  630



>ref|XP_010254134.1| PREDICTED: uncharacterized protein LOC104595215 [Nelumbo nucifera]
Length=710

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 176/254 (69%), Gaps = 3/254 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH  Q +I + L++LD+SQ+PKETS  H E   QL  VVQEW++Q +K+
Sbjct  447  GMAKMWELMHVHHRTQMEIAVDLKNLDISQAPKETSIQHSECIKQLWNVVQEWNTQLQKL  506

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+YIR LN+WLKLNL+PI+++LKEKVSSP +   PPI  LL AW + + K+ D +A
Sbjct  507  MANQKDYIRALNNWLKLNLIPIESSLKEKVSSPLKVSRPPIHHLLQAWNEHLEKVTDGVA  566

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            ++AI +F+A + TI+  Q +E+KLKD+C++  KEL +R R  +    KY+++RTP D  E
Sbjct  567  RSAITAFAAGIETIILQQDEEIKLKDKCEEISKELARRERILDASRRKYLEKRTPPD--E  624

Query  403  QDGPHEDNNVIE-RQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
             D  + D N +E +QL +  L++RL++E E Y + C QVR KS  +L+  LPEL  AMS 
Sbjct  625  MDPDNVDKNPLEDKQLMVATLRKRLEDELEQYQKHCRQVREKSFVNLKMHLPELCRAMSV  684

Query  226  FSRACSIMYQTLES  185
            FS AC+ MY+ L S
Sbjct  685  FSLACTNMYKDLRS  698



>ref|XP_010033880.1| PREDICTED: uncharacterized protein LOC104423116 [Eucalyptus grandis]
 gb|KCW53731.1| hypothetical protein EUGRSUZ_J02988 [Eucalyptus grandis]
Length=726

 Score =   238 bits (606),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 179/263 (68%), Gaps = 9/263 (3%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW+ MK  HENQ + V  L  L++ ++ KETSEHH++RT QL  VV +W+ QF  +
Sbjct  466  GMAKMWDAMKVCHENQYKTVRNLAYLEIDRAAKETSEHHHDRTLQLLKVVGDWNEQFRNV  525

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+YI+ L +WLK+N++PI+++L+EKVSSP R +NP I  L+HAW + + KLPDELA
Sbjct  526  MDNQKKYIKALKNWLKVNVIPIESSLREKVSSPPRDENPLIQKLVHAWDETLQKLPDELA  585

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            +T ++SF  V+ TI+  Q DE+  K RC++ R+EL ++ R  ++    Y+ RRTP DD  
Sbjct  586  RTEMHSFHEVLATILSIQEDEIGFKHRCEEFRRELNRKERSLKE----YIARRTPPDDM-  640

Query  403  QDGPHED---NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
             D  H+    N + E+++ +E LK+ L EEE+A+ R C+QVR K+L S +  LPE+F A+
Sbjct  641  -DPAHDGRYINVITEKEVAVETLKKMLAEEEDAHQRMCLQVREKTLVSFKNRLPEVFRAL  699

Query  232  SEFSRACSIMYQTLESITHPLNR  164
            S F+RA S MY  L S + P  R
Sbjct  700  STFARASSQMYGNLRSSSQPQKR  722



>ref|XP_003568507.1| PREDICTED: ras and Rab interactor 3 [Brachypodium distachyon]
Length=779

 Score =   238 bits (606),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 177/257 (69%), Gaps = 2/257 (1%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MW+ M  HH +Q + VL L+S+D+S S  ETS HH+  T QL  +V++W++ F  ++
Sbjct  519  MAKMWKDMHMHHGDQLKTVLDLKSVDISDSNIETSRHHHSHTRQLRDIVEKWNTNFSDLM  578

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             +QKEY+  L  WLKLNL+PI+++L+EKV+SP R Q PPI ALL AW + + KLPD+LA+
Sbjct  579  SYQKEYVNALYSWLKLNLIPIESSLREKVASPPRMQQPPIKALLQAWNEHLAKLPDDLAR  638

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
             AI SF AV++TI+  Q +E+K K+ C+   KE  ++ R FEDWYHK+ QR++ + D E 
Sbjct  639  HAIVSFRAVLDTILSVQDEELKQKENCEQIHKEYARKVRAFEDWYHKHAQRKSFDVDPES  698

Query  400  -DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +G  + + + ER+  +E+LK RL +E E + +   QVR KSL+ L+  LPELF A+++F
Sbjct  699  GEGTGQKDVISERRFAVESLKSRLDDEIEVHNKLSKQVREKSLSILKAHLPELFRALTDF  758

Query  223  SRACSIMYQTLE-SITH  176
            S AC  M+  L+  +TH
Sbjct  759  SHACFEMHSKLKIDVTH  775



>emb|CDM82883.1| unnamed protein product [Triticum aestivum]
Length=797

 Score =   238 bits (606),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/267 (46%), Positives = 183/267 (69%), Gaps = 8/267 (3%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW +M  HH++Q  I+  +R+ ++   P+ET++ HY++T +L  +V+EWH QF+K+
Sbjct  529  GMAKMWSSMHRHHKSQFLIISGIRAFEVPPVPRETTDLHYKQTCELRDIVREWHMQFDKL  588

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YIR LN WLKLNL+ I++NLKEKVSSP R   PPI  LL+AW D + +LP ELA
Sbjct  589  MDHQKGYIRALNAWLKLNLISIESNLKEKVSSPPRQVEPPIKNLLYAWHDQLERLPVELA  648

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            KTAI SF+ V++ IV  Q +E+ L+ RC++TR++L+++  QFEDW+ +Y +R+      E
Sbjct  649  KTAIKSFTEVISNIVLLQEEEVSLRRRCEETRRDLDRKKAQFEDWHRRYTERKA--SQGE  706

Query  403  QDGPHEDN-----NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
            +  P   N     +V ER++ +E ++ RLKEEE+ ++R   QVR K+L +LR  LPELF 
Sbjct  707  EANPEAANTPSLDHVNERRIAIEEVEIRLKEEEKLHLRLVRQVREKTLANLRMHLPELFR  766

Query  238  AMSEFSRACSIMYQTL-ESITHPLNRE  161
             M++FS  C  MY +L +S   P+ R+
Sbjct  767  NMADFSFFCHDMYSSLRKSAVLPMLRD  793



>ref|XP_002439756.1| hypothetical protein SORBIDRAFT_09g019490 [Sorghum bicolor]
 gb|EES18186.1| hypothetical protein SORBIDRAFT_09g019490 [Sorghum bicolor]
Length=812

 Score =   235 bits (599),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 171/251 (68%), Gaps = 1/251 (0%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MWE M  HH NQ + VL L+ +D+S +  ETS++H+  T QL  +V +W + F  ++
Sbjct  550  MAKMWEDMHMHHANQLETVLNLKLVDISDARIETSDYHHSHTRQLRYIVDKWITNFTDLM  609

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PPI A L AW + + KLPD+LAK
Sbjct  610  NYQKEYINTLYSWLKLNLIPIESSLKEKVTSPPRMQQPPIKAFLQAWNEHLTKLPDDLAK  669

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            TAI +F AV++TI+  Q +E+K K+ C+ TR+E  ++ R FEDWYHK+ QR+  + D E 
Sbjct  670  TAIVTFRAVLDTILGVQDEELKQKETCEQTRREYMRKARAFEDWYHKHSQRKASDVDPES  729

Query  400  -DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +G    + V E++  +E+LK RL +E E++ +   QVR KSL+ L+  LPELF A+++F
Sbjct  730  GEGIGHKDAVTEKKFAVESLKSRLDDEIESHNKLSKQVREKSLSILKAHLPELFRALTDF  789

Query  223  SRACSIMYQTL  191
            S A   MY  L
Sbjct  790  SSASFDMYSKL  800



>dbj|BAJ94711.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=804

 Score =   234 bits (596),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 174/256 (68%), Gaps = 7/256 (3%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW +M   H++Q  I+  +R+ ++   P+ET++ HY++T +L  +V+EWH QFEK+
Sbjct  536  GMANMWSSMHRQHKSQFLIISGIRAFEVPPVPRETTDLHYKQTCELRDIVREWHMQFEKL  595

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YIR LN WLKLNL+ I++NLKEKVSSP R   PPI  LL+AW D + +LP ELA
Sbjct  596  MDHQKGYIRALNAWLKLNLISIESNLKEKVSSPPRQVEPPIKNLLYAWHDQLERLPVELA  655

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            KTAI SF+ V++ IV  Q +E+ L+ RC++TR++L+++  QFEDW+ +Y +R+      E
Sbjct  656  KTAIKSFTEVISNIVLLQEEEVSLRRRCEETRRDLDRKRAQFEDWHRRYTERKA--SQGE  713

Query  403  QDGPHEDN-----NVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
            +  P   N     +V ER++ +E ++ RLKEEE  ++R   QVR K+L +LR  LPELF 
Sbjct  714  EANPEAANTSSLDHVNERRIAIEEVEIRLKEEERLHLRLARQVREKTLANLRMHLPELFR  773

Query  238  AMSEFSRACSIMYQTL  191
             M++FS  C  MY +L
Sbjct  774  NMTDFSFFCHDMYSSL  789



>ref|XP_010249763.1| PREDICTED: uncharacterized protein LOC104592230 isoform X2 [Nelumbo 
nucifera]
Length=670

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 180/254 (71%), Gaps = 1/254 (0%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MWE M  +H  Q ++ + L+ +D+SQ  KETS  HYERT QL  VVQEW +Q +K+I
Sbjct  413  MAQMWEAMHVNHARQMRLAVDLKDIDISQETKETSRQHYERTRQLFHVVQEWQAQLQKVI  472

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             HQKEYI+ L+ WLKLNL+PI+++LKEKVS P +    PI  LL AW + +GKLPD +A+
Sbjct  473  THQKEYIQALSSWLKLNLIPIESSLKEKVSCPPKVPCTPIQPLLQAWGEQLGKLPDGVAR  532

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            +A+ +F+A +  I+  Q+DEMKLK++ ++T KELE+R +   +   KYM+RRTP D+ + 
Sbjct  533  SAVGTFAASIEAIMVQQMDEMKLKEKWEETSKELERREKHLMEARQKYMERRTPPDEMDP  592

Query  400  DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  221
            D    D    ++Q  +++L++RL+EE+E + +   QVR KSL +L+  LPEL  AMS+FS
Sbjct  593  DNADRD-PFEDKQFIVDSLRKRLEEEKEEHQKNYRQVREKSLVNLKIHLPELCRAMSDFS  651

Query  220  RACSIMYQTLESIT  179
            R CS++Y+ L+SI+
Sbjct  652  RDCSMLYKELKSIS  665



>ref|NP_001168451.1| uncharacterized protein LOC100382224 [Zea mays]
 gb|ACN28274.1| unknown [Zea mays]
Length=677

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 170/251 (68%), Gaps = 1/251 (0%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MWE MK HH NQ +IVL L+S+D+  S  ETS++H+  T QL  +V +W + F   +
Sbjct  415  MAKMWEDMKIHHANQLKIVLNLKSVDIPDSNIETSDYHHSHTRQLRDIVDKWITNFTDFM  474

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
              QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PPI A L+AW + + KLPD+LAK
Sbjct  475  NCQKEYINALYGWLKLNLIPIESSLKEKVASPPRMQQPPIKAFLYAWHEHLAKLPDDLAK  534

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            TAI +F AV++TI+  Q +E+K K+ C+ TR+E  ++ R FEDW HK+ Q R  + D + 
Sbjct  535  TAIVTFRAVLDTILGVQDEELKQKEICEQTRREYIRKARAFEDWCHKHPQPRAIDVDPDS  594

Query  400  -DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +G    + V E++  +E+LK +L +E E++ +   QVR KSL+ L+  LPELF A+++F
Sbjct  595  GEGTGHKDVVTEKRFAVESLKSKLDDEIESHNKLSKQVREKSLSILKAHLPELFRALTDF  654

Query  223  SRACSIMYQTL  191
            S A   MY  L
Sbjct  655  SDASFEMYSKL  665



>ref|XP_010249762.1| PREDICTED: uncharacterized protein LOC104592230 isoform X1 [Nelumbo 
nucifera]
Length=703

 Score =   229 bits (585),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/255 (48%), Positives = 180/255 (71%), Gaps = 1/255 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  +H  Q ++ + L+ +D+SQ  KETS  HYERT QL  VVQEW +Q +K+
Sbjct  445  GMAQMWEAMHVNHARQMRLAVDLKDIDISQETKETSRQHYERTRQLFHVVQEWQAQLQKV  504

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I HQKEYI+ L+ WLKLNL+PI+++LKEKVS P +    PI  LL AW + +GKLPD +A
Sbjct  505  ITHQKEYIQALSSWLKLNLIPIESSLKEKVSCPPKVPCTPIQPLLQAWGEQLGKLPDGVA  564

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            ++A+ +F+A +  I+  Q+DEMKLK++ ++T KELE+R +   +   KYM+RRTP D+ +
Sbjct  565  RSAVGTFAASIEAIMVQQMDEMKLKEKWEETSKELERREKHLMEARQKYMERRTPPDEMD  624

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             D    D    ++Q  +++L++RL+EE+E + +   QVR KSL +L+  LPEL  AMS+F
Sbjct  625  PDNADRD-PFEDKQFIVDSLRKRLEEEKEEHQKNYRQVREKSLVNLKIHLPELCRAMSDF  683

Query  223  SRACSIMYQTLESIT  179
            SR CS++Y+ L+SI+
Sbjct  684  SRDCSMLYKELKSIS  698



>ref|NP_001169630.1| hypothetical protein [Zea mays]
 gb|ACN34343.1| unknown [Zea mays]
 tpg|DAA54627.1| TPA: hypothetical protein ZEAMMB73_367183 [Zea mays]
Length=783

 Score =   230 bits (586),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 175/251 (70%), Gaps = 7/251 (3%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW +M  HH +Q  I+  +R  ++   P+ET++ HY +T +L  +V+EWH+QFEK+
Sbjct  529  GMAKMWSSMYRHHRSQFLIISGIRGFEIPPIPRETTDSHYIQTCELRDIVREWHTQFEKL  588

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK YIR LN WLKLNL+PI++N+KEKVSSP R  +PPI  LLHAW D + +LP ELA
Sbjct  589  MDNQKAYIRALNAWLKLNLIPIESNIKEKVSSPPRLVDPPIKHLLHAWHDELERLPIELA  648

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            KTAI +F+ V++TIV  Q +E+ L+ RC +TR++L ++  QFEDW+ KY++R+T   +T+
Sbjct  649  KTAIKTFAEVISTIVHLQEEEVNLRRRCDETRRDLNRKKAQFEDWHQKYLERQTA--ETQ  706

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
               P ED     R+  +E L+ RL+EEE  ++R   QVR KSL +LRT LPELF  MS+F
Sbjct  707  NIDPVED-----RKRTIEELEIRLREEEGHHLRHARQVREKSLANLRTHLPELFRNMSDF  761

Query  223  SRACSIMYQTL  191
            +  C  MY  L
Sbjct  762  AYFCKDMYNNL  772



>ref|XP_010667640.1| PREDICTED: uncharacterized protein LOC104884645 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=650

 Score =   228 bits (580),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 146/197 (74%), Gaps = 4/197 (2%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MWE +  HH+NQ QI   L+SLD+  +P+ETS+ HY  T QL  VVQ+W  +FE ++
Sbjct  443  MAQMWEDICIHHDNQLQIATELKSLDVILTPRETSKPHYHCTLQLSNVVQQWQDRFETLV  502

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
              QK Y+R LN WLKLNL+PI++NLKEK+SSP R  +PPI ALLHAW D + KLPDE+ +
Sbjct  503  HQQKHYVRSLNSWLKLNLIPIESNLKEKISSPPRAHHPPIQALLHAWHDALEKLPDEVTR  562

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP---NDD  410
            TAI SF A++ TI+ HQ +EM+LK++C++TRKE  ++ + FEDWYHKYMQR+ P   + +
Sbjct  563  TAISSFGAMIKTIILHQDEEMRLKEKCEETRKEFLRKNQAFEDWYHKYMQRKGPEAMDSE  622

Query  409  TEQDGPHEDNNVIERQL  359
              +DGP +D  V ERQ+
Sbjct  623  RGEDGPGKD-PVSERQV  638



>gb|AFW82165.1| hypothetical protein ZEAMMB73_214762 [Zea mays]
Length=775

 Score =   229 bits (585),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 170/251 (68%), Gaps = 1/251 (0%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MA+MWE MK HH NQ +IVL L+S+D+  S  ETS++H+  T QL  +V +W + F   +
Sbjct  513  MAKMWEDMKIHHANQLKIVLNLKSVDIPDSNIETSDYHHSHTRQLRDIVDKWITNFTDFM  572

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
              QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PPI A L+AW + + KLPD+LAK
Sbjct  573  NCQKEYINALYGWLKLNLIPIESSLKEKVASPPRMQQPPIKAFLYAWHEHLAKLPDDLAK  632

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
            TAI +F AV++TI+  Q +E+K K+ C+ TR+E  ++ R FEDW HK+ Q R  + D + 
Sbjct  633  TAIVTFRAVLDTILGVQDEELKQKEICEQTRREYIRKARAFEDWCHKHPQPRAIDVDPDS  692

Query  400  -DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             +G    + V E++  +E+LK +L +E E++ +   QVR KSL+ L+  LPELF A+++F
Sbjct  693  GEGTGHKDVVTEKRFAVESLKSKLDDEIESHNKLSKQVREKSLSILKAHLPELFRALTDF  752

Query  223  SRACSIMYQTL  191
            S A   MY  L
Sbjct  753  SDASFEMYSKL  763



>emb|CBI20923.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 138/171 (81%), Gaps = 0/171 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M   H +Q ++V  L+S+D+SQ+PKETS+HH+ERT QL   +Q WHSQFEK+
Sbjct  227  GMAKMWNDMCMQHNSQLKMVTDLKSIDISQAPKETSKHHHERTIQLWNEIQGWHSQFEKL  286

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + H+K+YI+ LN WLKLNL+PI+++LKEK+SSP RPQ+PPI ALLH+W D + KLP ELA
Sbjct  287  VTHEKQYIQALNSWLKLNLIPIESSLKEKISSPPRPQHPPIQALLHSWHDSLEKLPHELA  346

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ  431
            K+AI SF+AV+ TI+ HQ +EMKLK++C++T+KE  ++ + F+DWY KYMQ
Sbjct  347  KSAISSFAAVIKTIILHQEEEMKLKEKCEETQKEYSRKHQAFQDWYQKYMQ  397



>ref|NP_001172370.1| Os01g0500550 [Oryza sativa Japonica Group]
 dbj|BAD73247.1| bZIP protein-like [Oryza sativa Japonica Group]
 gb|EEE54643.1| hypothetical protein OsJ_01915 [Oryza sativa Japonica Group]
 dbj|BAH91100.1| Os01g0500550 [Oryza sativa Japonica Group]
Length=752

 Score =   228 bits (582),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 169/255 (66%), Gaps = 4/255 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW +M  HH+ Q  I+  +R+ +    P+ET++ HY++T  L  +V+EWH QFEK+
Sbjct  485  GMANMWSSMHHHHKWQLVIISGIRNFEAPPVPRETTDQHYKQTCDLRDIVREWHMQFEKL  544

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YIR LN WLKLNL+PI++NLKEKVSSP R   PPI  LL+AW D + +LP ELA
Sbjct  545  MDHQKGYIRALNAWLKLNLIPIESNLKEKVSSPPRLVEPPIKDLLYAWHDQLERLPIELA  604

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN----  416
            KTAI SF+ V++ IV  Q +E+ L+ RC++TR++L ++  QFE+W+ +YM+R+       
Sbjct  605  KTAIKSFAEVISNIVLLQEEEVNLRRRCEETRRDLNRKKAQFEEWHQRYMERKASQGEDA  664

Query  415  DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            +++E       + V +R+  +E ++ RL+EE   + R   QVR KSL +LR  LPELF  
Sbjct  665  NNSEVAEAVNSDPVADRKTAIEEVEIRLREEMGHHNRIARQVREKSLANLRMHLPELFRN  724

Query  235  MSEFSRACSIMYQTL  191
            M++F+  C  MY  L
Sbjct  725  MTDFAGFCYEMYSNL  739



>gb|EEC70709.1| hypothetical protein OsI_02082 [Oryza sativa Indica Group]
Length=797

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 169/255 (66%), Gaps = 4/255 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW +M  HH+ Q  I+  +R+ +    P+ET++ HY++T  L  +V+EWH QFEK+
Sbjct  530  GMANMWSSMHHHHKWQLVIISGIRNFEAPPVPRETTDQHYKQTCDLRDIVREWHMQFEKL  589

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YIR LN WLKLNL+PI++NLKEKVSSP R   PPI  LL+AW D + +LP ELA
Sbjct  590  MDHQKGYIRALNAWLKLNLIPIESNLKEKVSSPPRLVEPPIKDLLYAWHDQLERLPIELA  649

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN----  416
            KTAI SF+ V++ IV  Q +E+ L+ RC++TR++L ++  QFE+W+ +YM+R+       
Sbjct  650  KTAIKSFAEVISNIVLLQEEEVNLRRRCEETRRDLNRKKAQFEEWHQRYMERKASQGEDA  709

Query  415  DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
            +++E       + V +R+  +E ++ RL+EE   + R   QVR KSL +LR  LPELF  
Sbjct  710  NNSEVAEAVNSDPVADRKTAIEEVEIRLREEMGHHNRIARQVREKSLANLRMHLPELFRN  769

Query  235  MSEFSRACSIMYQTL  191
            M++F+  C  MY  L
Sbjct  770  MTDFAGFCYEMYSNL  784



>gb|EPS58005.1| hypothetical protein M569_16812 [Genlisea aurea]
Length=282

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/273 (42%), Positives = 175/273 (64%), Gaps = 15/273 (5%)
 Frame = -2

Query  940  MARMWETMKGHHENQCQIVLALRSLDMSQSPK-------ETSEHHYERTYQLGVVVQEWH  782
            MA+MW +M  H+++Q + V  L+SLD+S S         ETS  H+ERT QL + V++W+
Sbjct  1    MAKMWRSMCQHNDDQLKAVSGLKSLDVSGSVDSGSGAAIETSREHHERTKQLCIAVEQWN  60

Query  781  SQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPP------ILALLHAW  620
            SQFEKM+ +Q++Y+  LN WLKLNL+PI++ L+EK S+      P       I  LL +W
Sbjct  61   SQFEKMVTNQRQYVNSLNGWLKLNLIPIESTLREKASAAAASSPPRNPTPPPIQPLLLSW  120

Query  619  QDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHK  440
             D + KLPD++AK++I+SF  V+ +I  HQ +EMKL+++   TR+E  ++ + FE+WY +
Sbjct  121  HDHLEKLPDDVAKSSIFSFKEVIKSIALHQEEEMKLREKRDGTRREYLRKKQGFEEWYQR  180

Query  439  YMQRRTPNDDTEQDGPH--EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSL  266
            ++QRRTP      DG      +  +ER++ +E LK+RL EE + + + C+ VR KSL SL
Sbjct  181  HVQRRTPPPRGADDGAETASKDPAVERRIAVEMLKKRLDEETDEHRKHCVHVREKSLASL  240

Query  265  RTGLPELFHAMSEFSRACSIMYQTLESITHPLN  167
            +  LPELF A+S++S AC   Y++L  +    N
Sbjct  241  KIRLPELFRALSDYSHACFDAYESLRMVIQSQN  273



>ref|XP_004506851.1| PREDICTED: uncharacterized protein LOC101489547 [Cicer arietinum]
Length=568

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/264 (47%), Positives = 168/264 (64%), Gaps = 11/264 (4%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW  M  HHE Q  I+  LRS D SQ P ETSEHH++RTYQL +V+QEW SQF+K 
Sbjct  303  GMATMWGIMHSHHEKQLNIMKLLRSSD-SQFPLETSEHHHDRTYQLLLVMQEWESQFQKS  361

Query  763  IIHQKEYIRGLNDWLKLNLVPI-DTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDEL  587
            I +QK +I+ L  WLKLNL  + D+++KE +SSP+   + PI  LLHAW D + KLPDE 
Sbjct  362  INNQKGFIKALYTWLKLNLTLLNDSDIKENISSPK---SCPIQILLHAWNDRLEKLPDEF  418

Query  586  AKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR-----T  422
            A+ AI +F A V+++ Q Q +E+ LK +C + RKE  +++ QF+ W  KY +R+      
Sbjct  419  ARIAIANFVAAVDSLYQRQQEELVLKRKCDEIRKEYTRKSTQFDQWESKYSKRKRLDEFD  478

Query  421  PNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELF  242
            PN  TE D    D  + E++  L  L++RL EE++A+ R C+ VR KSL  L+  L ELF
Sbjct  479  PN-RTEGDCNEADEVLKEKKRLLIELEKRLDEEKDAFERHCLHVRQKSLRCLKNDLLELF  537

Query  241  HAMSEFSRACSIMYQTLESITHPL  170
              M++FS  CS MY  L  + H L
Sbjct  538  RTMTDFSLECSKMYSELSYVVHKL  561



>ref|XP_003567735.1| PREDICTED: uncharacterized protein LOC100824905 [Brachypodium 
distachyon]
Length=796

 Score =   223 bits (569),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 125/256 (49%), Positives = 177/256 (69%), Gaps = 7/256 (3%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA MW +M  +H++Q  I+L +R+ ++   P+ET++ H+++T +L  +V+EWH QFEK+
Sbjct  533  GMANMWGSMHRYHKSQLLIILGIRAFEVPPVPRETTDVHHKQTCELRDIVREWHMQFEKL  592

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQK YIR LN WLKLNL+PI++NLKEKVSSP R   PPI  LLHAW D + KLP ELA
Sbjct  593  MDHQKGYIRALNAWLKLNLIPIESNLKEKVSSPPRQVEPPIKNLLHAWHDQLEKLPIELA  652

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRT-----P  419
            KTAI SF+ V++ IV  Q +E+ L+ RC DTR++L ++  QF++W+ KYM+R+      P
Sbjct  653  KTAIKSFAEVISNIVVLQEEEINLRRRCDDTRRDLVRKKAQFQEWHLKYMERKASLGEEP  712

Query  418  NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
            N +T +  P  D  V ER++ +E ++ RLKEEE  + R   QVR K+L +LR  LPELF 
Sbjct  713  NPETAET-PTVD-PVNERKIAIEEVEIRLKEEEGHHHRLARQVREKTLANLRMHLPELFR  770

Query  238  AMSEFSRACSIMYQTL  191
             M++FS  C  MY +L
Sbjct  771  NMADFSFFCHDMYSSL  786



>ref|XP_008652191.1| PREDICTED: uncharacterized protein LOC103632124 [Zea mays]
 tpg|DAA60030.1| TPA: hypothetical protein ZEAMMB73_463294 [Zea mays]
Length=742

 Score =   221 bits (564),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/255 (45%), Positives = 161/255 (63%), Gaps = 3/255 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
              A MW+ M   H+ Q +I+  L++ D+S + +ETSE H+ERT QL  VVQEWH QF++ 
Sbjct  483  GFAHMWDVMYARHKAQLKIITELKASDISVATRETSEQHHERTLQLWNVVQEWHVQFDRF  542

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QKEYI  L +W+KLN++PIDTN+K   S P     PPI  LLHAW D++ KLPD   
Sbjct  543  MTYQKEYIGSLYNWIKLNVIPIDTNIKPNSSQPHE-ATPPIKRLLHAWHDILEKLPDNET  601

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K AI++F+ VVNTI+ HQ DE+KL+ +  D R++LEK+ +QF+ W  K   R     D  
Sbjct  602  KKAIHTFAEVVNTILVHQDDELKLRLKIDDIRRDLEKKRKQFDSWAQKNWDRGASIPDG-  660

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             D P   +   ER+  ++ ++  LK+ E+ Y  QC  VR KSL  LR+ LPELF A+SEF
Sbjct  661  -DNPGRVDPAAERKAVVDRVENALKDLEDNYRTQCKVVRDKSLNLLRSNLPELFRAVSEF  719

Query  223  SRACSIMYQTLESIT  179
            S   +  ++ L SI 
Sbjct  720  SLQSAGYFKGLWSIA  734



>ref|XP_004968820.1| PREDICTED: uncharacterized protein LOC101757982 [Setaria italica]
Length=791

 Score =   221 bits (563),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 170/264 (64%), Gaps = 3/264 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW  M  HH +Q  I+  +R  ++     E ++ HY +T +L  +V+EWH QFEK+
Sbjct  527  GMAKMWSAMHRHHRSQFMIISGIRGFEIPPVTSERTDLHYNQTCELRDIVREWHMQFEKL  586

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK YIR LN WLKLNL+PI++N+KEKVSSP R  +PPI  LLHAW D + +LP ELA
Sbjct  587  MNNQKAYIRALNAWLKLNLIPIESNIKEKVSSPPRLVDPPIKNLLHAWHDELERLPIELA  646

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTP---ND  413
            KTAI +F+ V++ IV  Q +E+ L+ RC +TR++L ++  QFEDW+ KY +RR     N 
Sbjct  647  KTAIKTFAEVISNIVHLQEEEVNLRRRCDETRRDLTRKRAQFEDWHQKYTERRAALGENG  706

Query  412  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            + E       + V +R+  +E L+ RL+EEE  ++RQ  QVR KSL +LRT LPELF  M
Sbjct  707  NPEAAEVQNIDPVEDRKRVIEELEIRLREEEGHHLRQARQVREKSLANLRTHLPELFRNM  766

Query  232  SEFSRACSIMYQTLESITHPLNRE  161
            ++FS  C  MY  L     P   E
Sbjct  767  ADFSYFCHDMYNNLRKAAAPAKDE  790



>ref|XP_004955806.1| PREDICTED: uncharacterized protein LOC101763037 [Setaria italica]
Length=735

 Score =   219 bits (557),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/255 (44%), Positives = 164/255 (64%), Gaps = 3/255 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             ++ MW+ M  HH+ Q +I+  L+S D+  + +ETSE H+ERT QL  +VQEWH+QF+K 
Sbjct  476  GLSHMWDIMYAHHKAQLRIITELKSSDIMVAARETSEQHHERTVQLWSIVQEWHAQFDKF  535

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QKEY+  L  W+KLN++PID +LK   S P     PPI  LLHAW D++ KLPD  A
Sbjct  536  MTYQKEYVGSLYSWIKLNVIPIDADLKPNSSQPHE-TTPPIKRLLHAWHDILEKLPDNDA  594

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K AI++F+ VV+TI+  Q DE+KL+ + ++TR++LEK+ RQF+DW  K   R     D  
Sbjct  595  KKAIHTFAEVVHTILVQQEDELKLRIKIEETRRDLEKKRRQFDDWAQKNWDRGASIPDG-  653

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
             + P   +   ER+  ++ ++  LK+ E+ Y  QC  VR KSL  LR+ LPELF A+S+F
Sbjct  654  -NNPGRADPAGERKAVVDRVENALKDLEDQYKTQCKVVRDKSLNLLRSNLPELFRAVSDF  712

Query  223  SRACSIMYQTLESIT  179
            S   +  ++ L SI 
Sbjct  713  SLQSAGYFKGLWSIA  727



>ref|XP_006644200.1| PREDICTED: uncharacterized protein LOC102708565 [Oryza brachyantha]
Length=760

 Score =   219 bits (557),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/254 (46%), Positives = 169/254 (67%), Gaps = 3/254 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW +M  HH+ Q  I+  +R+ ++   P+ET++ H+++T  L  +V+EWH QFEK+
Sbjct  494  GMAKMWSSMHQHHKWQLVILSGIRNFEVPPVPRETTDQHHKQTSDLRDIVREWHMQFEKL  553

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK YIR LN WLKLNL+PI++NLKEKVSSP R   PPI  LL+AW D + +LP ELA
Sbjct  554  MDYQKGYIRALNAWLKLNLIPIESNLKEKVSSPPRQVEPPIKDLLYAWHDQLERLPIELA  613

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            KTAI SF+ V++ IV  Q +E+ L+ RC+DTR++L ++  QFE+W+ +YM+R+    +  
Sbjct  614  KTAIKSFAEVISNIVLLQEEEINLRRRCEDTRRDLNRKKAQFEEWHQRYMERKASQGEDA  673

Query  403  QDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
                 E  N   V ER+  +E ++ RL+EE   + R   QVR KSL +LR  LPELF  M
Sbjct  674  NSEVAEAVNSDPVAERKTSIEEIEIRLREEMGHHSRIASQVREKSLANLRMHLPELFRNM  733

Query  232  SEFSRACSIMYQTL  191
            ++FS  C  MY  L
Sbjct  734  TDFSGFCHEMYSNL  747



>ref|XP_002461680.1| hypothetical protein SORBIDRAFT_02g006420 [Sorghum bicolor]
 gb|EER98201.1| hypothetical protein SORBIDRAFT_02g006420 [Sorghum bicolor]
Length=761

 Score =   217 bits (553),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 112/255 (44%), Positives = 162/255 (64%), Gaps = 2/255 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             ++ MW+ M   H+ Q +I+  L++ D+S S +ETSE H ERT QL  +VQEWH QF++ 
Sbjct  501  GLSHMWDVMYTQHKAQLRIITELKASDISVSTRETSEQHNERTVQLWNIVQEWHVQFDRF  560

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QKEY+  L  W+KLN++PIDTNLK   S P     PPI  LLHAW D++ KLP +  
Sbjct  561  MAYQKEYVGSLYSWIKLNVIPIDTNLKPNSSQPHE-TTPPIKRLLHAWHDILEKLPVDAT  619

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K AI++F+ VV+TI+ HQ +E+KL+ + ++TR++ EK+ RQF+DW  K   R     D +
Sbjct  620  KRAIHTFAEVVHTILVHQDEELKLRMKIEETRRDFEKKRRQFDDWAQKNWDRGASIPDGD  679

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
               P  D    ER+  ++ L+  LK+ E++Y  QC  VR KSL  LR+ LPELF  +SEF
Sbjct  680  NPAPRAD-PAAERKAVVDKLENALKDLEDSYKTQCKVVRDKSLNLLRSNLPELFRVVSEF  738

Query  223  SRACSIMYQTLESIT  179
            S   +  ++ L SI 
Sbjct  739  SLQSAGYFKGLWSIA  753



>ref|XP_009398982.1| PREDICTED: uncharacterized protein LOC103983491 [Musa acuminata 
subsp. malaccensis]
Length=729

 Score =   217 bits (552),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 108/259 (42%), Positives = 169/259 (65%), Gaps = 5/259 (2%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWETM+ HH +Q +I+  +R LD+  +P+ETS+ H+ RT QL  +V EW SQF+K+
Sbjct  462  GMAKMWETMRFHHGSQLKIIKEIRGLDIPLAPRETSKQHHNRTVQLWKMVGEWDSQFDKL  521

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + +QK+YI+ LN WL LN+VPI+ + ++  SSP    +P I  LLHAW D +  LP + A
Sbjct  522  MSNQKDYIKALNRWLNLNVVPIERSSRKDASSPPEQADPLIKILLHAWHDQLENLPVDRA  581

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            K+++ +FS  V  I+  Q++E+ LK +  D  ++ E++  +F+ W+HKY +R T     E
Sbjct  582  KSSLSTFSGAVQAIMLCQVEELNLKLKWDDAHRDCERKKHEFDVWHHKYTERITATSSDE  641

Query  403  QD-----GPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
             +     G  + + V E++  ++  + +L+  EE+Y +QC  VR KSLTSL+T LPELF 
Sbjct  642  VNPETVEGATQQDLVSEKKAVVDNAESKLRVSEESYRKQCKMVRDKSLTSLKTHLPELFR  701

Query  238  AMSEFSRACSIMYQTLESI  182
            AM +F+ +C+ MY+ L SI
Sbjct  702  AMLDFASSCAEMYKRLSSI  720



>ref|XP_003604444.1| hypothetical protein MTR_4g012430 [Medicago truncatula]
Length=523

 Score =   192 bits (489),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 158/231 (68%), Gaps = 12/231 (5%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW TM  HH+ Q  I+  L+SLD SQ P ETSEHH++RTYQL  V+QE  SQFEK+
Sbjct  300  GMAKMWRTMHSHHKKQLSIMKLLKSLD-SQFPTETSEHHHDRTYQLLNVMQELESQFEKL  358

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I +QK +I+ L  WLKLNL  I+++  +K+SSP      P+  LLHAW D + KLPDE A
Sbjct  359  IKNQKGFIKALYSWLKLNLTLIESDTTKKISSP------PLQILLHAWNDHLEKLPDEHA  412

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            + A+  F+AVV+++ QHQ  E+ LK +C++ RKE  +++R+F+ W  KY +++  ++  +
Sbjct  413  RIALSHFAAVVDSLYQHQEQELVLKRKCEEIRKEYTRKSRRFDQWECKYKKKKGLDEFDQ  472

Query  403  QDGPHEDNN----VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  263
              G  + N+     +E+++ +E L++RL EE++A+ +QC+ VR KSL+ L+
Sbjct  473  NRGEDDINDPPEVAMEKRVLVE-LEKRLDEEKDAFEKQCLHVRQKSLSCLK  522



>ref|XP_010479739.1| PREDICTED: uncharacterized protein LOC104758551, partial [Camelina 
sativa]
Length=687

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
            +M +MWE M  HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEWH+QF +M
Sbjct  529  AMGKMWEMMHLHHQRQAEISKVLRSLDVSQTVKETNDHHHERTIQLLAVVQEWHTQFCRM  588

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            + HQKEYI+ L  W+KLNL+PI++ LKEKVSSP R  NP I  LL  W D + K+PDE+A
Sbjct  589  VDHQKEYIKALAGWIKLNLIPIESTLKEKVSSPPRVPNPAIQKLLTVWYDRLDKIPDEMA  648

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKR  470
            +TAI +F+AV++TI+Q Q DE+ L+++C++TRKEL ++
Sbjct  649  RTAIINFAAVISTIMQQQEDEINLRNKCEETRKELGRK  686



>gb|ABR18011.1| unknown [Picea sitchensis]
Length=724

 Score =   189 bits (480),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 156/270 (58%), Gaps = 16/270 (6%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M +MW++M   H  Q +IV  LR  D S +P ET++ H++RTYQL  V  EWH+Q EK+
Sbjct  446  GMEKMWKSMYDCHRRQEEIVKDLR-FDNSNAPDETTKQHHDRTYQLYNVANEWHAQSEKL  504

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
             IHQK+YI  LN+WL+LNL+PI++NLKEKVSSP +   PPI  LL  W   + +LP  +A
Sbjct  505  FIHQKQYIGALNNWLRLNLIPIESNLKEKVSSPPKAFVPPIHELLQVWHSTLDQLPYAVA  564

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWY----------HKYM  434
               + SF+A++N I   Q +E+K K   +D + ELE++ + F +W            +  
Sbjct  565  LQGLKSFAAIINRIFTQQQEELKKKKNYEDAQAELERKRKAFNEWALRNPPENKGSEESA  624

Query  433  QRRTPNDDTEQDGP--HEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTS  269
              +T N  +E++     E NN    +ER+  L  L++R+ EE   +   C   R  SL S
Sbjct  625  GGQTENRSSEENAGVQTEINNKDPSMERRHALILLEKRVHEEGVKHKNSCKLTRDLSLKS  684

Query  268  LRTGLPELFHAMSEFSRACSIMYQTLESIT  179
            L TGLP LF A+   SR C   Y+ L +IT
Sbjct  685  LETGLPALFQALVGLSRNCFETYKELHTIT  714



>gb|AES86641.2| BZIP protein [Medicago truncatula]
Length=512

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 150/220 (68%), Gaps = 12/220 (5%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MW TM  HH+ Q  I+  L+SLD SQ P ETSEHH++RTYQL  V+QE  SQFEK+
Sbjct  300  GMAKMWRTMHSHHKKQLSIMKLLKSLD-SQFPTETSEHHHDRTYQLLNVMQELESQFEKL  358

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I +QK +I+ L  WLKLNL  I+++  +K+SSP      P+  LLHAW D + KLPDE A
Sbjct  359  IKNQKGFIKALYSWLKLNLTLIESDTTKKISSP------PLQILLHAWNDHLEKLPDEHA  412

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
            + A+  F+AVV+++ QHQ  E+ LK +C++ RKE  +++R+F+ W  KY +++  ++  +
Sbjct  413  RIALSHFAAVVDSLYQHQEQELVLKRKCEEIRKEYTRKSRRFDQWECKYKKKKGLDEFDQ  472

Query  403  QDGPHEDNN----VIERQLQLEALKQRLKEEEEAYMRQCM  296
              G  + N+     +E+++ +E L++RL EE++A+ +QC+
Sbjct  473  NRGEDDINDPPEVAMEKRVLVE-LEKRLDEEKDAFEKQCL  511



>ref|XP_008352156.1| PREDICTED: uncharacterized protein LOC103415623 [Malus domestica]
Length=414

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             MA+MWE M  HH +Q +IV  L+SLD+  +P ET++HH++RT QL  V+QEWH  FEK+
Sbjct  217  GMAKMWENMCTHHGSQLKIVTDLKSLDIXHTPMETTKHHHDRTVQLWNVLQEWHXHFEKL  276

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
              HQK+YI+ LN WLKLNL+PI+++LK+K+SSP R Q PPI ALLH+W D + KL DELA
Sbjct  277  XXHQKQYIQALNSWLKLNLIPIESSLKZKISSPPRVQRPPIQALLHSWHDSLEKLSDELA  336

Query  583  KTAIYSFSAVVNTIV  539
            K AI SF+AV+ TI+
Sbjct  337  KCAISSFAAVIKTII  351


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  319  EAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSI  206
            +A+ R C+QVR KSL SL+T LPE+F  M++++ ACSI
Sbjct  361  KAHQRHCIQVRDKSLGSLKTRLPEIFRTMTDYANACSI  398



>ref|XP_009786427.1| PREDICTED: uncharacterized protein LOC104234548 isoform X2 [Nicotiana 
sylvestris]
Length=631

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = -2

Query  547  TIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIE  368
            T+  +  +EMKLKDRC+DTR+EL K+TRQ+EDWYHKYMQRRTP D+ + D  HED+ V++
Sbjct  500  TMRGYHKEEMKLKDRCEDTRRELNKKTRQYEDWYHKYMQRRTPPDEMDPDQAHEDSLVVD  559

Query  367  RQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE  188
            RQLQLEAL+++L++EEEAY RQC+QVR KSLTSLR+ LPELF AMS+FS AC+ MY+ L 
Sbjct  560  RQLQLEALRKKLEDEEEAYQRQCLQVRDKSLTSLRSRLPELFEAMSDFSLACADMYRDLR  619

Query  187  SITHPLNR  164
            SI    NR
Sbjct  620  SIAKHRNR  627



>ref|XP_009628246.1| PREDICTED: uncharacterized protein LOC104118644 isoform X2 [Nicotiana 
tomentosiformis]
Length=614

 Score =   166 bits (420),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -2

Query  547  TIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIE  368
            T+  +  +EMKLKDRC+DTR+EL K+TRQ+EDWY ++MQRRTP D+ + D  H D+ V++
Sbjct  483  TMRGYHKEEMKLKDRCEDTRRELNKKTRQYEDWYQRHMQRRTPPDEMDPDQAHVDSLVVD  542

Query  367  RQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE  188
            RQLQLEAL+++L++EEEAY RQC+QVR KSLTSLR+ LPELF AMSEFS AC+ MY+ L 
Sbjct  543  RQLQLEALRKKLEDEEEAYQRQCLQVRDKSLTSLRSRLPELFGAMSEFSLACADMYRDLR  602

Query  187  SITHPLNR  164
            SI+   NR
Sbjct  603  SISKHRNR  610



>gb|ABK95129.1| unknown [Populus trichocarpa]
Length=126

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 86/116 (74%), Gaps = 2/116 (2%)
 Frame = -2

Query  520  MKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNN--VIERQLQLEA  347
            MKLK++C++TR+E  ++ + FE+WY KYMQRRTP D+T+ D   + N   V ERQ  +E+
Sbjct  1    MKLKEKCEETRREFMRKNQAFEEWYQKYMQRRTPTDETDADRGEDANPNPVSERQFVVES  60

Query  346  LKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESIT  179
            LK+RL+EE EA+ + C+QVR KS+ SL+  LPELF AMS+++ ACS  Y+ L SIT
Sbjct  61   LKKRLEEEIEAHGKHCLQVREKSVGSLKIRLPELFRAMSDYAHACSDAYEKLRSIT  116



>ref|XP_007134473.1| hypothetical protein PHAVU_010G050100g [Phaseolus vulgaris]
 gb|ESW06467.1| hypothetical protein PHAVU_010G050100g [Phaseolus vulgaris]
Length=810

 Score =   133 bits (334),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 146/260 (56%), Gaps = 16/260 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPK--ETSEHHYERTYQLGVVVQEWHSQFEKMII  758
            MW++M  +HE Q  IV  +R L ++QS K   TSE H + T  L   V  WHS F ++I 
Sbjct  549  MWKSMHQYHEIQSNIVQQVRGL-VNQSSKGHSTSESHKQATRDLESAVSAWHSSFCRLIK  607

Query  757  HQKEYIRGLNDWLKLNLVPIDT-NLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
             Q+++I  L+ WLKLNL+P++  N+K   ++     +  + +    W+  + ++PD +A 
Sbjct  608  FQRDFILSLHGWLKLNLIPVNKDNIKSTSNNNSESSH--VFSFCDEWKLALDRVPDTVAS  665

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKY-MQRRTPN  416
             AI SF  VV+ I   Q +E+K+K R +   KELEK++         +Y+ Y M   TP 
Sbjct  666  EAIKSFINVVHVISVKQSEELKIKKRTESASKELEKKSSSLRSIERKFYNSYSMVGITPP  725

Query  415  DDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELF  242
            +    +G   D  + + E++L+LE+ ++R+++E   + +     R  +L +L+TGLP +F
Sbjct  726  ESGPGNGQGLDARDPLAEKKLELESYQRRVEDEIVRHSKAVEVTRAMTLNNLQTGLPGVF  785

Query  241  HAMSEFSRACSIMYQTLESI  182
             AMS FS   S+  + LES+
Sbjct  786  QAMSSFS---SLFTEALESV  802



>ref|XP_009391172.1| PREDICTED: ras and EF-hand domain-containing protein homolog 
[Musa acuminata subsp. malaccensis]
Length=861

 Score =   133 bits (335),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/261 (31%), Positives = 137/261 (52%), Gaps = 10/261 (4%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             +  MW +M   H+ Q  IV  L+ L+ + +   TS  H +   QL + V+ W+S F  +
Sbjct  394  GLMSMWRSMYECHQVQTHIVQQLKYLNCALNSHPTSNIHRQAALQLELEVENWYSAFCSL  453

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  Q+EY+  L  WL+L+L     +     S  Q  QNP I +L   WQ  + ++PD++A
Sbjct  454  VNSQREYVHALTGWLRLSLFQCHHD-----SLAQSRQNPEIYSLCEEWQLALDRIPDKVA  508

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
               I SF +V++ +V  Q +E K K R +   +ELEKR  +      K+     P   TE
Sbjct  509  SEGIKSFLSVIHAVVMQQAEEQKQKKRSEVAFRELEKRAEELRSLESKF----GPYSTTE  564

Query  403  -QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSE  227
               G  + + V+E++ ++EALK + +EE+  Y +     R  +L +L+TG P +F AM+ 
Sbjct  565  GHGGMAQRSPVLEKRAKVEALKAKAEEEKSKYEKSVGVTRAMTLNNLQTGFPNVFQAMTG  624

Query  226  FSRACSIMYQTLESITHPLNR  164
            F+  C  +++++ +    L+R
Sbjct  625  FAGVCMQVFESVYNHQRSLDR  645



>gb|KHN00204.1| hypothetical protein glysoja_034735 [Glycine soja]
Length=422

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 144/259 (56%), Gaps = 19/259 (7%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPK--ETSEHHYERTYQLGVVVQEWHSQFEKMII  758
            MW++M  +HE Q  IV  +R L ++QS K   TSE H + T  L   V  WHS F ++I 
Sbjct  166  MWKSMHQYHEIQSNIVQQVRGL-VNQSSKGHSTSESHKQATRDLESAVSAWHSSFCRLIK  224

Query  757  HQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKT  578
             Q+++I  L+ WLKLNL+P++ +     +S   P    + +    W+  + ++PD +A  
Sbjct  225  FQRDFILSLHGWLKLNLIPVNND----NNSSSEPSG--VFSFCDEWKLALDRVPDTVASE  278

Query  577  AIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKY-MQRRTPND  413
            AI SF  VV+ I   Q +E+K+K R +++ KELEK++         +Y  Y M   TP +
Sbjct  279  AIKSFINVVHVISVKQSEELKIKRRTENSSKELEKKSSSLRSIERKFYSSYSMVGITPPE  338

Query  412  DTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
                +G   D  + + E++++L A ++R+++E   + +     R  +L +L+TGLP +F 
Sbjct  339  SGPGNGQGLDARDPLAEKKMELAAHQRRVEDEMVRHSKAVEVTRAMTLNNLQTGLPGVFQ  398

Query  238  AMSEFSRACSIMYQTLESI  182
            A++ FS   ++  + LES+
Sbjct  399  ALTSFS---TLFTEALESV  414



>ref|XP_010941314.1| PREDICTED: uncharacterized protein LOC105059637 [Elaeis guineensis]
Length=640

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 128/250 (51%), Gaps = 10/250 (4%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L  L+ + S   T++ H + + QL V V  W+S F  ++  Q
Sbjct  383  MWRSMYECHQVQTHIVQQLEYLNNATSTNPTTDTHRQASLQLEVEVNHWYSSFCSLVNSQ  442

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            +EYI  L  WL+L+L   D N+  K     +  +  I +L   WQ  + ++PD++A   I
Sbjct  443  REYIYALTGWLRLSLFQCDHNMLGK----SQQSSDMIYSLCEEWQLALDRIPDKVASEGI  498

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF  V++ +V  Q +E K K + +   KELEKR  +      KY          E  G 
Sbjct  499  KSFITVIHAVVVQQAEEQKQKRKSELAFKELEKRAEELRSLESKYGPYSVAEGYGEMAGR  558

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
            +    V+E++ ++EALK + +EE+  Y +     R  +L +L+TGLP +F AM+ F+  C
Sbjct  559  YP---VLEKRAKVEALKTKAEEEKSRYEKSIAVTRAMTLNNLQTGLPNVFQAMTGFASVC  615

Query  211  SIMYQTLESI  182
                Q  ES+
Sbjct  616  ---MQAFESV  622



>ref|XP_011093240.1| PREDICTED: uncharacterized protein LOC105173250 [Sesamum indicum]
Length=844

 Score =   131 bits (330),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 138/258 (53%), Gaps = 16/258 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M   HE Q  IV  +R L +     + TS+ H + T  L   V  WHS F +MI  
Sbjct  587  MWRSMNQSHEVQNDIVQQVRGLVNRMTKGQSTSDLHRQATRDLESAVSAWHSSFCRMIKF  646

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q+++IR L+ W KL L+PI++   E  +S + P    + A    W+  + ++PD +A  A
Sbjct  647  QRDFIRSLHGWFKLTLLPINS---EPTNSDREPSK--VFAFFDEWKLAVDRIPDTVASEA  701

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPNDDT  407
            I SF+ VV++I   Q +E+K+K R +   KELEK++    +    +YH Y        D 
Sbjct  702  IKSFNNVVHSISLKQTEELKIKKRTESASKELEKKSSSLRNIEKKYYHSYSMVGIGLPDN  761

Query  406  EQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
              D  H     + + E++ +L   ++R+++E   +++     R  +L +++TGLP +F A
Sbjct  762  GPDNGHVLDARDPLAEKKAELAICQRRVEDEMVKHLKAVEVTRAMTLNNIQTGLPGVFQA  821

Query  235  MSEFSRACSIMYQTLESI  182
            M+ FS   +++ + LE++
Sbjct  822  MTSFS---ALITEALETV  836



>ref|XP_004166130.1| PREDICTED: uncharacterized LOC101224117, partial [Cucumis sativus]
Length=260

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 80/265 (30%), Positives = 139/265 (52%), Gaps = 26/265 (10%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M  +H+ Q  IV  +R L + +     TSE H + T  L  +V  WHS F ++I  
Sbjct  4    MWRSMHQYHDIQNNIVQQVRGLVNQTSHGDSTSELHRQATRDLESMVTAWHSSFCRLIKF  63

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
             +++IR L+ WLKL+ +P++ +              P    L  W+  + ++PD +A  A
Sbjct  64   HRDFIRSLHGWLKLSYIPVNND-------SLTDNKEPAEIFLDQWKLALDRVPDTVASVA  116

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQF----EDWYHKYMQRRTPNDDT  407
            I SF  VVN I   Q +E+K+K R +   KE EK++       + +Y+ Y        DT
Sbjct  117  IKSFINVVNVISAKQTEEIKIKKRTESASKEFEKKSASIMHLEKKFYNSYSMVGIGLPDT  176

Query  406  EQDGPHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE  248
               GP ++ +++       E++++L A ++R++EE+  + +     R  +L +L+TGLP 
Sbjct  177  ---GPADNGHILDARDPLAEKKIELVACQRRVEEEKIKHSKAVEVTRAMTLNNLQTGLPG  233

Query  247  LFHAMSEFSRACSIMYQTLESI-TH  176
            +F A++ FS   ++  + LES+ TH
Sbjct  234  VFQALTSFS---ALFTEALESVCTH  255



>ref|XP_006576720.1| PREDICTED: uncharacterized protein LOC100792843 [Glycine max]
Length=799

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 140/258 (54%), Gaps = 17/258 (7%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW++M  +HE Q  IV  +R L + S     TSE H + T  L   V  WHS F ++I  
Sbjct  543  MWKSMHQYHEIQSNIVQQVRGLVNQSSEGHSTSESHKQATRDLESAVSAWHSSFCRLIKF  602

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q+++I  L+ WLKLNL+P++ N     S P       +L+    W+  + ++PD +A  A
Sbjct  603  QRDFILSLHGWLKLNLIPVN-NDNNSSSEPSG-----VLSFCDEWKLALDRVPDTVASEA  656

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKY-MQRRTPNDD  410
            I SF  VV+ I   Q +E+K+K R +++ KE EK++         +Y  Y M   TP + 
Sbjct  657  IKSFINVVHVISVKQSEELKIKRRTENSSKEFEKKSSSLRSIERKFYSSYSMVGITPPES  716

Query  409  TEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
               +G   D  + + E++++L A ++R+++E   + +     R  +L +L+TGLP +F A
Sbjct  717  GPGNGQGLDARDPLAEKKMELAAHQRRVEDEMVRHSKAVEVTRAMTLNNLQTGLPGVFQA  776

Query  235  MSEFSRACSIMYQTLESI  182
            ++ FS   ++  + LES+
Sbjct  777  LTSFS---TLFTEALESV  791



>gb|EYU30808.1| hypothetical protein MIMGU_mgv1a0195871mg, partial [Erythranthe 
guttata]
Length=266

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/253 (31%), Positives = 130/253 (51%), Gaps = 11/253 (4%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S   TSE H + T QL +  Q+WH  F  +I  Q
Sbjct  4    MWRSMYEFHQVQTHIVQQLKYLNFFPSTDPTSEIHRQATLQLELEAQQWHLSFCTLIKSQ  63

Query  751  KEYIRGLNDWLKLNL---VPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
            ++YI+ L  WL+L+L     ++TN    V+  +  Q+  I +    WQ  I   PD++A 
Sbjct  64   RDYIQSLTGWLRLSLFQVASVNTN-HNPVNIRKTKQDSAIYSFCEEWQLAINNSPDKVAS  122

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQ  401
              I SF  V++ IV  Q +E K K R     K+L+K+  +     +K+     P    E 
Sbjct  123  EGIKSFLTVIHAIVMQQAEEQKQKRRADSVFKDLDKKAGELRSLENKHGPYFVP----EG  178

Query  400  DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  221
             G  + + V +++ ++EAL+ + ++E+  Y +     R  ++ +L+ GLP +F AM+ F+
Sbjct  179  SGETKKDPVRDKRAKVEALRAKAEDEKAKYEKAVSVTRAMTMNNLQMGLPHVFQAMTGFA  238

Query  220  RACSIMYQTLESI  182
              C+   Q  ES+
Sbjct  239  NVCA---QAFESV  248



>ref|XP_011099873.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105178172 
[Sesamum indicum]
Length=623

 Score =   127 bits (318),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 126/251 (50%), Gaps = 9/251 (4%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             +  MW +M   H+ Q  IV  L+ L+   S   TSE H + T QL +  Q+WH  F  +
Sbjct  364  GLMSMWRSMYEFHQVQTHIVQQLKYLNCIPSTDPTSEIHRQSTLQLELEAQQWHLSFCNL  423

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  Q++YI+ L  WL+L+L  +  N   K       Q+  I +    WQ  I   PD++A
Sbjct  424  MKAQRDYIQSLTGWLRLSLFQVGNNPISKTK-----QDSAIYSFCEEWQLTINNAPDKVA  478

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
               I SF ++++ IV  Q +E K K R +   KELEK+  +      K+     P    E
Sbjct  479  SEGIKSFLSMIHAIVVQQAEEQKQKRRSESVFKELEKKAGELRSLESKHGPYSMP----E  534

Query  403  QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEF  224
              G    + V E++ ++EAL+ R ++E+  Y +     R  ++ +L+ GLP +F AM+ F
Sbjct  535  ASGETNKDPVREKRAKVEALRARAEDEKAKYEKSISVTRAMTMNNLQMGLPHVFQAMTGF  594

Query  223  SRACSIMYQTL  191
            +  C+  + ++
Sbjct  595  ANVCTQAFDSV  605



>ref|XP_010113322.1| hypothetical protein L484_026653 [Morus notabilis]
 gb|EXC35329.1| hypothetical protein L484_026653 [Morus notabilis]
Length=658

 Score =   127 bits (318),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 133/258 (52%), Gaps = 9/258 (3%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L++  S + TSE H + T QL + VQ+WH  F  M+  Q
Sbjct  403  MWRSMYECHQVQKHIVQQLKYLNVIPSTEPTSEIHRQTTLQLELEVQQWHLSFCNMVKAQ  462

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L   + N   + S     Q   I +L   W   + ++PD++A   I
Sbjct  463  QDYIQSLTGWLRLSLFQFNRNPLARTS-----QESKIYSLCEEWHLAVDRIPDKVASEGI  517

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF  V++ IV  Q +E K K + +   K+LEK+  +      KY     P   +E  G 
Sbjct  518  KSFLTVIHAIVVQQAEEQKQKKKSESVFKDLEKKMLELRSLESKY----GPYSMSESSGI  573

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
               N V E++ ++E LK + +EE+  + +     R  +L +L+ GLP +F  M  FS  C
Sbjct  574  TGRNPVAEKRAKVEMLKAKAEEEKTKHEKSVSVTRAMTLNNLQMGLPHVFEGMVGFSSVC  633

Query  211  SIMYQTLESITHPLNRES  158
               ++++ + T   ++E+
Sbjct  634  MHAFESVYNHTKSADQEA  651



>ref|XP_004492935.1| PREDICTED: uncharacterized protein LOC101510124 [Cicer arietinum]
Length=859

 Score =   127 bits (320),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 85/266 (32%), Positives = 134/266 (50%), Gaps = 18/266 (7%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEK  767
             M  MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V  WHS F +
Sbjct  597  GMMYMWRSMHQYHEVQSNIVQQVRGLVNRSSGSDSTSELHRQATRDLESAVSAWHSSFCR  656

Query  766  MIIHQKEYIRGLNDWLKLNLVPIDT-NLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDE  590
            +I  Q+++I  L+ W KL+L+P+D  N+      P              W+  + ++PD 
Sbjct  657  LIKFQRDFILSLHGWFKLSLIPVDNDNINNHSREPS-----DAYVFFDDWKLALDRVPDT  711

Query  589  LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRT  422
            +A  AI SF  VV+ I   Q DE+K+K R ++  KELEK+     +    +Y  Y     
Sbjct  712  VASEAIKSFINVVHVISCKQADELKIKKRTENASKELEKKASSVRNIERKFYSSYSLVGI  771

Query  421  PNDDTEQD---GPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  251
               DT  D   G    + + E++L+L   ++R+++E   + +     R  +L +L+TGLP
Sbjct  772  GLPDTAPDNGQGLDARDPLAEKKLELATCQRRVEDEMLRHSKAVEATRAMTLNNLQTGLP  831

Query  250  ELFHAMSEFSRACSIMYQTLESI-TH  176
             +F A++ FS   S+  + LES+ TH
Sbjct  832  GVFQALTSFS---SLFAEALESVCTH  854



>ref|XP_010935104.1| PREDICTED: uncharacterized protein LOC105055091 [Elaeis guineensis]
Length=565

 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 82/251 (33%), Positives = 128/251 (51%), Gaps = 13/251 (5%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L  L+ + S   T+  H + + QL + V  W+S F  ++  Q
Sbjct  309  MWRSMYECHQVQTHIVQQLDYLNNASSNNPTTNIHRQASLQLELEVDHWYSAFCNLVKSQ  368

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            +EYI  L  WL+L+L   D NL       +  Q+  I +L   WQ  + ++PD++A   I
Sbjct  369  REYIHALTGWLRLSLFQCDHNLL-----GETQQSSDIYSLCEEWQLALDRIPDKVASEGI  423

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF  V++ +V  Q +E K K + +   KELEKR  +      KY     P   TE  G 
Sbjct  424  KSFLTVIHAVVLQQAEEQKQKRKSEMVFKELEKRAEELRALESKY----GPYCVTEGYGV  479

Query  391  H-EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRA  215
                + V+E++ ++EALK + +EE+  Y +     R  +L +L+TG P +F AM+ F+  
Sbjct  480  MVRASPVMEKRAKVEALKMKAEEEKSKYEKSVAVTRAMTLNNLQTGFPNVFQAMTGFAGV  539

Query  214  CSIMYQTLESI  182
            C    Q  ES+
Sbjct  540  C---MQAFESV  547



>ref|XP_007139641.1| hypothetical protein PHAVU_008G046800g [Phaseolus vulgaris]
 gb|ESW11635.1| hypothetical protein PHAVU_008G046800g [Phaseolus vulgaris]
Length=818

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/257 (32%), Positives = 134/257 (52%), Gaps = 15/257 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW+ M  +HE Q  +V  +R L + S     TSE H + T  L   V  WHS F ++I  
Sbjct  562  MWKAMHNYHEIQSNVVQQVRGLVNRSSRGDSTSELHRQATRDLEAAVSAWHSSFCRLIKF  621

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q+E+I  L+ W KL+L+PI+    + +++ +   N         W+  + ++PD +A  A
Sbjct  622  QREFIFSLHGWFKLSLLPIN---NDNINNSR--DNSDTYHFFDEWKLALDRVPDTVASEA  676

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPNDDT  407
            I SF  VV+ I   Q +E+K+K R + T KELEK+     +    +Y  Y        DT
Sbjct  677  IKSFINVVHVISAKQTEELKIKKRTETTSKELEKKASSLRNLERKYYSSYSMVGISLPDT  736

Query  406  EQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
              DG   D  + + E++L L   ++R+++E   + +     R  +L +L+TGLP +F A+
Sbjct  737  APDGQGLDARDPLAEKKLDLATCQRRVEDEMLRHSKAVELTRAMTLNNLQTGLPGVFQAL  796

Query  232  SEFSRACSIMYQTLESI  182
            + FS   S+  + LES+
Sbjct  797  TSFS---SLFTEALESV  810



>ref|XP_007204230.1| hypothetical protein PRUPE_ppa002657mg [Prunus persica]
 gb|EMJ05429.1| hypothetical protein PRUPE_ppa002657mg [Prunus persica]
Length=647

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/257 (32%), Positives = 128/257 (50%), Gaps = 9/257 (4%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + VQ+WH  F  ++  Q
Sbjct  392  MWRSMYECHQVQKHIVQQLKYLNTIPSTEPTSEIHRQATLQLELQVQQWHQSFCNLVKAQ  451

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
             +YI+ L  WL+L+L     +   K S   R     I  L   W   + ++PD++A   I
Sbjct  452  LDYIQSLTGWLRLSLFQFRRHPISKTSQESR-----IYMLCEEWHHAVDRIPDKVASEGI  506

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF  VV+ IV  Q +E K K + + T KELEK+         KY     P+  +     
Sbjct  507  KSFLTVVHAIVVQQAEEYKQKKKSESTFKELEKKATVLRSLESKYGPYSMPDSASTST--  564

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
               N V+E++ ++E L+ + +EE+  + +     RV +L +L+ G P +F AM  FS  C
Sbjct  565  --KNPVVEKRAKVEVLRAKAEEEKSKHEKSVSVTRVMTLNNLQMGFPHVFEAMVGFSSVC  622

Query  211  SIMYQTLESITHPLNRE  161
               +++L +     N+E
Sbjct  623  MQAFESLYNQAKSANQE  639



>gb|KJB22870.1| hypothetical protein B456_004G070400 [Gossypium raimondii]
Length=820

 Score =   125 bits (315),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 133/258 (52%), Gaps = 16/258 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V  WHS F ++I  
Sbjct  563  MWGSMHQYHEVQSNIVQQVRGLINRSVKGDSTSELHRQATRDLESAVTAWHSSFCRLIKF  622

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q+++I  L+ W KL+L+P+  +  +  + P       + A    W+  + ++PD +A   
Sbjct  623  QRDFICSLHGWFKLSLLPLSNDNVDGNADPS-----GVYAFCDEWKLALERVPDTVASEG  677

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKY-MQRRTPNDD  410
            I SF  VV  I   Q +E+K+K R ++  KELEK+     +    +YH Y M    P D 
Sbjct  678  IKSFINVVRVISAKQTEELKIKKRTENASKELEKKASSLRNIERKFYHSYSMVGIGPPDS  737

Query  409  TEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
                GP  D  + + E++ +L A ++R+++E   + +     R  +L +L+TGLP +F A
Sbjct  738  GSDHGPVLDARDPLSEKKSELAACQRRVEDEMMRHAKAVEVTRAMTLNNLQTGLPGVFRA  797

Query  235  MSEFSRACSIMYQTLESI  182
            ++ FS    +  + L+S+
Sbjct  798  LTSFS---GVFTEALDSV  812



>ref|NP_171713.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAD95352.1| bZIP-like protein [Arabidopsis thaliana]
 gb|AEE27385.1| uncharacterized protein AT1G02110 [Arabidopsis thaliana]
Length=703

 Score =   125 bits (314),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 83/261 (32%), Positives = 138/261 (53%), Gaps = 17/261 (7%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW++M  +HE Q  IV  +R L + ++  + TSE H + T  L   V  WHS F ++I  
Sbjct  454  MWKSMHEYHEIQNNIVQQVRGLINQTERGESTSEVHRQVTRDLESAVSLWHSSFCRIIKF  513

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q+E+I  L+ W KL+LVP+     +K       Q P   AL   W+  + ++PD +A  A
Sbjct  514  QREFICSLHAWFKLSLVPLSNGDPKK-------QRPDSFALCEEWKQSLERVPDTVASEA  566

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDG  395
            I SF  VV+ I   Q +E+K+K R +   KELEK+         KY Q  +    T   G
Sbjct  567  IKSFVNVVHVISIKQAEEVKMKKRTESAGKELEKKASSLRSIERKYYQAYS----TVGIG  622

Query  394  PHED-----NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            P  +     + + E++ +L A ++++++E   +++     R  +L +L+TGLP +F A++
Sbjct  623  PGPEVLDSRDPLSEKKCELAACQRQVEDEVMRHVKAVEVTRAMTLNNLQTGLPNVFQALT  682

Query  229  EFSRACSIMYQTLESITHPLN  167
             FS   +   QT+ S ++ +N
Sbjct  683  SFSSLFTESLQTVCSRSYSIN  703



>gb|KHN40553.1| hypothetical protein glysoja_001051 [Glycine soja]
Length=259

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 133/261 (51%), Gaps = 23/261 (9%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V  WHS F ++I  
Sbjct  3    MWRSMHHYHEIQSNIVQQVRGLVNRSSRGDSTSELHRQATRDLESAVSAWHSSFCRLIKF  62

Query  754  QKEYIRGLNDWLKLNLVPI---DTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            Q+++I  L+ W KL+LVP+   + N +E   + Q             W+  + ++PD +A
Sbjct  63   QRDFILSLHGWFKLSLVPVHNDNINSRETSDTYQ---------FFDEWKLALDRVPDTVA  113

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
              AI SF  VV+ I   Q++E+K+K R +   KELEK+     +   K+    +    + 
Sbjct  114  SEAIKSFINVVHVISSKQVEELKIKKRTETASKELEKKASSLRNLERKFYSSYSMVGISL  173

Query  403  QDGPHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPEL  245
             D   ++  V+       E++L+L   ++R+++E   + +     R  +L +L+TGLP +
Sbjct  174  PDSAPDNGQVLDARDPLAEKKLELATCQRRVEDEMLRHSKAVEVTRAMTLNNLQTGLPGV  233

Query  244  FHAMSEFSRACSIMYQTLESI  182
            F A++ FS   S+  + LES+
Sbjct  234  FQALTSFS---SLFTEALESV  251



>ref|XP_008459782.1| PREDICTED: uncharacterized protein LOC103498813 [Cucumis melo]
Length=813

 Score =   125 bits (315),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 139/263 (53%), Gaps = 27/263 (10%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M  +H+ Q  IV  +R L + +     TSE H + T  L  +V  WHS F ++I  
Sbjct  557  MWRSMHQYHDIQNNIVQQVRGLVNQTSHGDSTSELHRQATRDLESMVTAWHSSFCRLIKF  616

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNP-PILALLHAWQDLIGKLPDELAKT  578
             +++IR L+ WLKL+ +P++ +          P N  P    L  W+  + ++PD +A  
Sbjct  617  HRDFIRSLHGWLKLSYIPVNND--------GLPDNKEPAEIFLDQWKLALDRVPDTVASV  668

Query  577  AIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQF----EDWYHKYMQRRTPNDD  410
            AI SF  VVN I   Q +E+K+K R +   KE EK++       + +Y+ Y        D
Sbjct  669  AIKSFINVVNVISAKQTEEIKIKKRTESASKEFEKKSASIMNLEKKFYNSYSMVGIGLPD  728

Query  409  TEQDGPHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  251
            T   GP ++ +++       E++++L A ++R++EE+  + +     R  +L +L+TGLP
Sbjct  729  T---GPADNGHILDARDPLAEKKIELVACQRRVEEEKIKHSKAVEVTRAMTLNNLQTGLP  785

Query  250  ELFHAMSEFSRACSIMYQTLESI  182
             +F A++ FS   ++  + LES+
Sbjct  786  GVFQALTSFS---ALFTEALESV  805



>ref|XP_010919721.1| PREDICTED: uncharacterized protein LOC105043738 [Elaeis guineensis]
Length=759

 Score =   125 bits (314),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 136/263 (52%), Gaps = 22/263 (8%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M   HE Q  IV  +R L + S + + TS+ H   T  L   V  WHS F ++I +
Sbjct  498  MWRSMHQFHEVQNHIVQQVRGLVNRSSAGEPTSDLHRLATRDLEAAVSAWHSSFNRLIKY  557

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPI----LALLHAWQDLIGKLPDEL  587
            Q++YIR L  WL+L L  + ++      +PQ+  + PI     A    W+  + +LPD +
Sbjct  558  QRDYIRALYSWLRLTLYQVSSD------NPQKDHSSPISLELTAFCDEWKQALDRLPDTV  611

Query  586  AKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRT-----  422
            A  AI SF  V++ I   Q +E+K+K R +   KELEK++        KY Q  +     
Sbjct  612  ASEAIKSFMNVIHVIYTKQAEELKIKKRTEALSKELEKKSASLRSIEKKYYQSYSMVGIG  671

Query  421  -PNDDTEQDGPHEDNN--VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  251
             P    +  G   D+   + E++ ++ A ++R+++E   + +     R  +L +++TGLP
Sbjct  672  LPGGGRDNGGQVFDSRDPLAEKKSEIAACRRRVEDEMMRHAKAVEVTRSMTLNNIQTGLP  731

Query  250  ELFHAMSEFSRACSIMYQTLESI  182
             +F AM+ FS   ++  + LE++
Sbjct  732  GVFQAMTGFS---NLFVEALEAV  751



>ref|XP_010679893.1| PREDICTED: uncharacterized protein LOC104895159 [Beta vulgaris 
subsp. vulgaris]
Length=673

 Score =   124 bits (312),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/259 (31%), Positives = 134/259 (52%), Gaps = 12/259 (5%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL V +Q+WH  F  ++  Q
Sbjct  416  MWRSMYECHQVQMHIVDQLKFLNTIPSTEPTSEIHRQSTLQLEVELQQWHQSFCNLVKAQ  475

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSP--QRPQNPPILALLHAWQDLIGKLPDELAKT  578
            ++YIR L  WL+L+L   + N       P  +  Q+  I +L   WQ  I  +PD++A  
Sbjct  476  RDYIRSLTGWLRLSLFQFNKN-------PLMRSMQDSTIYSLCEQWQLEIDNVPDKVASE  528

Query  577  AIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQD  398
             I S   V++ IV  Q +E+K K R +   K+LEKR  +      KY     P   + + 
Sbjct  529  GIKSLWTVIHAIVVQQAEELKQKKRSEVANKQLEKRAVELRSLEVKYGPYSKPEISSSRK  588

Query  397  GPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSR  218
            G    + V E++ +++ LK + +EE+  + +     R  +L +++ GLP +F AM+ FS 
Sbjct  589  G---GDPVGEKRAKVDMLKVKAEEEKAKHEKSVSATRAMTLNNMQMGLPHVFQAMTGFSS  645

Query  217  ACSIMYQTLESITHPLNRE  161
             C   ++ + + T  +++E
Sbjct  646  VCKQAFEKVYNETKNMDQE  664



>ref|XP_006464424.1| PREDICTED: uncharacterized protein LOC102627291 [Citrus sinensis]
Length=769

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 127/245 (52%), Gaps = 13/245 (5%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW+ M  +HE Q  IV  +R L + +   + TS+ H + T  L   +  WHS F ++I  
Sbjct  512  MWKAMHQYHEVQNNIVQQVRGLVNQAAKGESTSDMHRQATRNLESAITAWHSSFCRLIKF  571

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q++++R L+ W KL L+P+     + +S  + P    +      W+  + ++PD +A  A
Sbjct  572  QRDFVRSLHGWFKLTLIPVSN---DNMSGKREPSE--VYGFFDEWKLALERVPDTVASEA  626

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPNDDT  407
            I SF  VV+ I   Q +E+K+K R +   KELEK+     +    +YH Y        D 
Sbjct  627  IKSFINVVHVISVKQTEELKIKKRTETASKELEKKASSLRNIERKFYHSYSMVGIGLPDP  686

Query  406  EQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
              D  H     + + E++L+L A ++R+++E   + R     R  +L +L+TGLP +F A
Sbjct  687  GPDNGHVLDARDPLAEKKLELAACQRRVEDELLRHSRAVEVTRANTLNNLQTGLPGVFQA  746

Query  235  MSEFS  221
            ++ FS
Sbjct  747  LTSFS  751



>ref|XP_010089322.1| hypothetical protein L484_021854 [Morus notabilis]
 gb|EXB37647.1| hypothetical protein L484_021854 [Morus notabilis]
Length=851

 Score =   125 bits (314),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/258 (31%), Positives = 134/258 (52%), Gaps = 14/258 (5%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M  +HE Q  IV  +R L + S   + TSE H + T  L   V  WHS F ++I  
Sbjct  592  MWRSMHQYHEIQNNIVQQVRGLVNQSTKGESTSELHRQATRDLESAVSAWHSSFCRLIKF  651

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q++++R L+ W KL L+P+D +     S+ +R     + A    W+  + ++PD +A  A
Sbjct  652  QRDFVRSLHGWFKLTLLPVDNDNVNMNSNRERSD---VYAFCDEWKLALERVPDTVASEA  708

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDG  395
            I SF  VV+ I   Q +E+K+K R +   KELEK+         K+ Q  +       D 
Sbjct  709  IKSFINVVHVISFKQSEELKVKKRTESASKELEKKASSIRTLERKFYQSYSMVGIGLPDA  768

Query  394  PHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
              ++  V+       E++ +L A ++R+++E   + +     R  +L +L+TGLP +F A
Sbjct  769  GPDNGQVLDARDPLAEKKTELAACQRRVEDEMMRHAKAVEVTRAMTLNNLQTGLPGVFQA  828

Query  235  MSEFSRACSIMYQTLESI  182
            ++ FS   S+  + LES+
Sbjct  829  LTSFS---SLFTEALESV  843



>gb|KDO85511.1| hypothetical protein CISIN_1g040600mg [Citrus sinensis]
Length=754

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 127/245 (52%), Gaps = 13/245 (5%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW+ M  +HE Q  IV  +R L + +   + TS+ H + T  L   +  WHS F ++I  
Sbjct  497  MWKAMHQYHEVQNNIVQQVRGLVNQAAKGESTSDMHRQATRNLESAITAWHSSFCRLIKF  556

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q++++R L+ W KL L+P+     + +S  + P    +      W+  + ++PD +A  A
Sbjct  557  QRDFVRSLHGWFKLTLIPVSN---DNMSGKREPSE--VYGFFDEWKLALERVPDTVASEA  611

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPNDDT  407
            I SF  VV+ I   Q +E+K+K R +   KELEK+     +    +YH Y        D 
Sbjct  612  IKSFINVVHVISVKQTEELKIKKRTETASKELEKKASSLRNIERKFYHSYSMVGIGLPDP  671

Query  406  EQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
              D  H     + + E++L+L A ++R+++E   + R     R  +L +L+TGLP +F A
Sbjct  672  GPDNGHVLDARDPLAEKKLELAACQRRVEDELLRHSRAVEVTRANTLNNLQTGLPGVFQA  731

Query  235  MSEFS  221
            ++ FS
Sbjct  732  LTSFS  736



>ref|XP_006445430.1| hypothetical protein CICLE_v10018930mg [Citrus clementina]
 gb|ESR58670.1| hypothetical protein CICLE_v10018930mg [Citrus clementina]
Length=785

 Score =   125 bits (313),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 127/245 (52%), Gaps = 13/245 (5%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW+ M  +HE Q  IV  +R L + +   + TS+ H + T  L   +  WHS F ++I  
Sbjct  528  MWKAMHQYHEVQNNIVQQVRGLVNQAAKGESTSDMHRQATRNLESAITAWHSSFCRLIKF  587

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q++++R L+ W KL L+P+     + +S  + P    +      W+  + ++PD +A  A
Sbjct  588  QRDFVRSLHGWFKLTLIPVSN---DNMSGKREPSE--VYGFFDEWKLALERVPDTVASEA  642

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPNDDT  407
            I SF  VV+ I   Q +E+K+K R +   KELEK+     +    +YH Y        D 
Sbjct  643  IKSFINVVHVISVKQTEELKIKKRTETASKELEKKASSLRNIERKFYHSYSMVGIGLPDP  702

Query  406  EQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
              D  H     + + E++L+L A ++R+++E   + R     R  +L +L+TGLP +F A
Sbjct  703  GPDNGHVLDARDPLAEKKLELAACQRRVEDELLRHSRAVEVTRANTLNNLQTGLPGVFQA  762

Query  235  MSEFS  221
            ++ FS
Sbjct  763  LTSFS  767



>ref|XP_006306896.1| hypothetical protein CARUB_v10008455mg, partial [Capsella rubella]
 gb|EOA39794.1| hypothetical protein CARUB_v10008455mg, partial [Capsella rubella]
Length=711

 Score =   124 bits (312),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 83/261 (32%), Positives = 137/261 (52%), Gaps = 17/261 (7%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW++M  +HE Q  IV  +R L + ++  + TSE H + T  L   V  WHS F ++I  
Sbjct  461  MWKSMHEYHEIQSNIVQQVRGLINQTEKGESTSEVHRQVTRDLESAVSLWHSSFCRIIKF  520

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q+E+I  L+ W KL+LV +     +K       Q P   AL   W+  + ++PD +A  A
Sbjct  521  QREFICSLHAWFKLSLVSLSNEDPKK-------QRPDSFALCEEWKQSLERVPDTVASEA  573

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDG  395
            I SF  VV+ I   Q +E+K+K R +   KELEK+         KY Q  +    T   G
Sbjct  574  IKSFVNVVHVISIKQAEEVKMKKRTESAGKELEKKASSLRSIERKYYQAYS----TVGIG  629

Query  394  PHED-----NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            P  +     + + E++ +L A +++++EE   +++     R  +L +L+TGLP +F A++
Sbjct  630  PGPEVLDARDPLSEKKCELAACQRQVEEEVMRHVKAVEVTRAMTLNNLQTGLPNVFQALT  689

Query  229  EFSRACSIMYQTLESITHPLN  167
             FS   +   QT+ S ++ +N
Sbjct  690  SFSSLFTECLQTVCSSSYSIN  710



>gb|KEH23438.1| BZIP transcription factor bZIP80 [Medicago truncatula]
Length=843

 Score =   124 bits (312),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/261 (30%), Positives = 133/261 (51%), Gaps = 16/261 (6%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW +M  +HE Q  IV  +R L      + TSE H + T  L   V  WHS F ++
Sbjct  584  GMMYMWRSMHQYHEVQSNIVQQVRGLVNRSGGESTSELHRQATRDLESAVSAWHSSFCRL  643

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            I  Q+++I  L+ W KL+L+P+D +      +  R ++         W+  + ++PD +A
Sbjct  644  IKFQRDFILSLHGWFKLSLMPVDND------NVNRMEHSDAYMFFDDWKLALDRVPDTVA  697

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPN  416
              AI SF  VV+ I   Q +E+K+K R ++  KELE++     +    +Y  Y       
Sbjct  698  SEAIKSFINVVHVISSKQAEELKIKKRTENASKELERKASSVRNLERKFYSSYSMVGIGI  757

Query  415  DDTEQD---GPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPEL  245
             DT  D   G    + + E++++L   ++R+++E   + +     R  +L +L+TGLP +
Sbjct  758  PDTGPDNGQGLDARDPLAEKKMELATCQRRVEDEMTKHSKAVEVTRAMTLNNLQTGLPGV  817

Query  244  FHAMSEFSRACSIMYQTLESI  182
            F A++ FS   S+  + L+S+
Sbjct  818  FQALTSFS---SLFTEALDSV  835



>ref|XP_006466986.1| PREDICTED: uncharacterized protein LOC102630487 [Citrus sinensis]
Length=615

 Score =   123 bits (309),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 129/257 (50%), Gaps = 21/257 (8%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW +M   H+ Q  IV  L+ +++  S + TSE H + T QL + VQ+W   F  +
Sbjct  359  GMMCMWRSMYESHQVQTHIVQQLKYINIMPSSEPTSEIHRQATLQLELQVQQWLQSFSSL  418

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  Q++Y++ L  WL+L+L    T+   + +     Q   I +L   WQ  + ++PD++A
Sbjct  419  VKAQQDYVQSLTGWLRLSLFQFSTSPLSRTT-----QESGIYSLCEEWQQAVERIPDKVA  473

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHKYMQRRTPND  413
               I SF AVV+ IV  Q DE K K + + + KE EK+    R  E  Y  +  R +   
Sbjct  474  SEGIKSFLAVVHAIVVQQSDEHKQKKKAESSFKEYEKKAAELRSLESKYGPFSMRESFGK  533

Query  412  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            D           V E+++++E L+ + +EE+  + +     R  +L +L+ G P +F AM
Sbjct  534  DP----------VGEKRVKVEMLRTKAEEEKTKHEKSVSVTRAMTLNNLQMGFPHVFQAM  583

Query  232  SEFSRACSIMYQTLESI  182
              FS  C    Q  ES+
Sbjct  584  VGFSSVC---MQAFESV  597



>ref|XP_006837374.1| hypothetical protein AMTR_s00111p00120840 [Amborella trichopoda]
 gb|ERN00228.1| hypothetical protein AMTR_s00111p00120840 [Amborella trichopoda]
Length=910

 Score =   124 bits (312),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 133/262 (51%), Gaps = 11/262 (4%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             + +MW+ M   HE Q +IV  +R L+       TS+ H   T  L   V  WHS F ++
Sbjct  593  GLMQMWQAMNRCHEAQNRIVQQVRGLENPPVGTSTSDIHRRATLHLEAAVSSWHSSFSRL  652

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPP-----ILALLHAWQDLIGKL  599
              + ++Y+R L+ WL+L +   +  L    S  Q   + P     + +L   W+ +  ++
Sbjct  653  TRYHRDYVRALHSWLRLTIAHPELTLAPPSSPAQILDSAPNEASQMYSLCDEWKQVAERV  712

Query  598  PDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKY-M  434
            PD +A  AI  F+ VV++I   Q +E+K   R +   KELEK+     +    +Y+ Y +
Sbjct  713  PDTVASEAIKGFAIVVHSIAMRQAEELKCNKRAETAEKELEKKASNLRNIARKFYNSYSL  772

Query  433  QRRTPNDDTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG  257
                P  +++  G  +  + +IE++ +++A +++ +EE   +++     R  +L +++TG
Sbjct  773  VGVNPGGESDTGGVLDARDPLIEKKAEVDACRRKAEEERAKHVKAIQVTRAMTLNNIQTG  832

Query  256  LPELFHAMSEFSRACSIMYQTL  191
            LP +F AM  FS  C+    T+
Sbjct  833  LPGVFQAMVGFSGICTEALGTV  854



>ref|XP_008365863.1| PREDICTED: uncharacterized protein LOC103429493 [Malus domestica]
Length=733

 Score =   124 bits (311),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 73/253 (29%), Positives = 127/253 (50%), Gaps = 2/253 (1%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             + R W+ M   HE Q +I+  ++S   S   K ++  H   T QL V +Q WH+ F + 
Sbjct  453  GLMRTWKIMLESHETQHKILFEVKSFAGSAYGKFSNNSHMRATLQLLVELQNWHACFREY  512

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS--PQRPQNPPILALLHAWQDLIGKLPDE  590
            +  QK Y+  L+ WL   +VP +       SS  P     PP+L + H W   + KLPD 
Sbjct  513  VAAQKAYVETLHGWLIKFVVPEEELYSRSRSSAAPYGVNGPPLLLICHDWLSSMEKLPDT  572

Query  589  LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDD  410
            L   A+ SF+  V  ++  Q +E K K +     KEL++R R F+    ++++ +     
Sbjct  573  LVTIALRSFTKDVRALLNQQGEEQKQKRKVDSLAKELDRRIRAFQKTESRFLEPKLVEQK  632

Query  409  TEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
             E D  H+  ++ ER+ Q++  ++++  E E +     + +  +L  ++TG   +F +++
Sbjct  633  CETDIEHKTESLTERKEQIDMFRRKVDMEREKHQNYVQETQRVTLNVIQTGFCSVFESLA  692

Query  229  EFSRACSIMYQTL  191
            EFSRA   +Y  L
Sbjct  693  EFSRASQKLYGDL  705



>ref|XP_006425413.1| hypothetical protein CICLE_v10025182mg [Citrus clementina]
 gb|ESR38653.1| hypothetical protein CICLE_v10025182mg [Citrus clementina]
Length=615

 Score =   123 bits (309),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 129/257 (50%), Gaps = 21/257 (8%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             M  MW +M   H+ Q  IV  L+ +++  S + TSE H + T QL + VQ+W   F  +
Sbjct  359  GMMCMWRSMYESHQVQTHIVQQLKYINIMPSSEPTSEIHRQATLQLELQVQQWLQSFSSL  418

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            +  Q++Y++ L  WL+L+L    T+   + +     Q   I +L   WQ  + ++PD++A
Sbjct  419  VKAQQDYVQSLTGWLRLSLFQFSTSPLSRTT-----QESGIYSLCEEWQQAVERIPDKVA  473

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHKYMQRRTPND  413
               I SF AVV+ IV  Q DE K K + + + KE EK+    R  E  Y  +  R +   
Sbjct  474  SEGIKSFLAVVHAIVVQQSDEHKQKKKAESSFKEYEKKAAELRSLESKYGPFSMRESFGK  533

Query  412  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM  233
            D           V E+++++E L+ + +EE+  + +     R  +L +L+ G P +F AM
Sbjct  534  DP----------VGEKRVKVEMLRTKAEEEKTKHEKSVSVTRAMTLNNLQMGFPHVFQAM  583

Query  232  SEFSRACSIMYQTLESI  182
              FS  C    Q  ES+
Sbjct  584  VGFSSVC---MQAFESV  597



>ref|XP_010258777.1| PREDICTED: uncharacterized protein LOC104598423 [Nelumbo nucifera]
Length=771

 Score =   124 bits (311),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 86/274 (31%), Positives = 138/274 (50%), Gaps = 27/274 (10%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M   HE Q  IV  +R L ++S   + TSE H + T  L   V  WHS F ++I +
Sbjct  493  MWRSMNQFHEVQSHIVQQVRGLVNLSTKGESTSELHRQATRHLESAVSAWHSNFCRLIKY  552

Query  754  QKEYIRGLNDWLKLNLVPI--DTNLKEKVSSPQR--------------PQNPPILALLHA  623
            Q++YIR L+ WLKL+L+ +  D+    K +S                   +  +L L   
Sbjct  553  QRDYIRSLHGWLKLSLIHVGNDSTTGSKGASTAAQTYTTGSKDASVAVQTSSDLLPLCDE  612

Query  622  WQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED---  452
            W+  + +LPD +A  AI SF  VV+ I   Q +E+K K   +   KELEK+     +   
Sbjct  613  WKLALDRLPDTVASEAIKSFVNVVHVIAVKQTEEIKSKKWAETASKELEKKASALRNIEK  672

Query  451  -WYHKY-MQRRTPNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRV  284
             +YH Y M    P D    DG   D  + + E++L+L + ++R+++E   + +     R 
Sbjct  673  KFYHSYSMVGIGPPDGGAADGQVLDARDPLAEKKLELASCQRRVEDEMMKHAKAVEVTRA  732

Query  283  KSLTSLRTGLPELFHAMSEFSRACSIMYQTLESI  182
             +L +++TGLP +F AM+ FS    +  + LE +
Sbjct  733  MTLNNIQTGLPGVFQAMTAFS---GLFTEALEGV  763



>ref|XP_002511585.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50254.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score =   124 bits (311),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/257 (32%), Positives = 132/257 (51%), Gaps = 18/257 (7%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V  WHS F ++I  
Sbjct  552  MWRSMNQYHEVQNNIVQQVRGLVNRSTKGDSTSELHKQATRDLESAVSAWHSSFCRLIKF  611

Query  754  QKEYIRGLNDWLKLNLVPI-DTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKT  578
            Q+++IR ++ W KL L+P+ D N+   V      ++  + A    W+  + ++PD +A  
Sbjct  612  QRDFIRSVHGWFKLTLLPVSDGNVNSNV------EHSDVYAFCDEWKLTLDRVPDTVASE  665

Query  577  AIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPNDD  410
            AI SF  VV+ I   Q +E+K+K R +   KELEK+     +    +YH Y        D
Sbjct  666  AIKSFINVVHVISLKQNEELKIKKRTETASKELEKKASSLRNIERKFYHSYSMVGIGMPD  725

Query  409  TEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
            T  D        + + E++ +L A ++R+++E   + +     R  +L +L+TGLP +F 
Sbjct  726  TGADNGQVLDARDPLAEKKSELAACQRRVEDEMLRHAKAVEVTRAMTLNNLQTGLPGVFQ  785

Query  238  AMSEFSRACSIMYQTLE  188
            A++ FS   S+  + LE
Sbjct  786  ALTSFS---SLFTEALE  799



>ref|XP_004515356.1| PREDICTED: uncharacterized protein LOC101490151 [Cicer arietinum]
Length=739

 Score =   124 bits (310),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/261 (32%), Positives = 140/261 (54%), Gaps = 22/261 (8%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPK--ETSEHHYERTYQLGVVVQEWHSQFEKMII  758
            MW +M  +HE Q  IV  +R L +S+S K   TSE H + T  L + V  WHS F ++I 
Sbjct  482  MWRSMHQYHETQSNIVQQVRGL-VSRSSKGHSTSESHRQTTRDLELAVSAWHSNFCRLIK  540

Query  757  HQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKT  578
             Q+++I  L+ W KLNL+P++ N K     P         +    W+  + ++PD +A  
Sbjct  541  FQRDFILSLHGWFKLNLIPVNNNDKNNNIEPSD-----AFSFCDEWKLALDRVPDTVASE  595

Query  577  AIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQ-----RR  425
            AI SF  VV+ I   Q +E+K+K +  +  KELEK+T   ++    +Y+ Y         
Sbjct  596  AIKSFINVVHVISVKQSEELKIKKKTDNAYKELEKKTSSIKNIEKKFYNSYSMVGIGVPH  655

Query  424  TPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPEL  245
            + ND+ +  G    + + E++L+L   + R+++E+  + +     R  +L +L+TGLP +
Sbjct  656  SVNDNGQ--GLDARDPLAEKKLELSICQLRVEDEKMKHSKAIEVTRAMTLNNLQTGLPGV  713

Query  244  FHAMSEFSRACSIMYQTLESI  182
            F A++ FS   S+  + LES+
Sbjct  714  FQALTSFS---SLFIEALESV  731



>ref|XP_011089387.1| PREDICTED: uncharacterized protein LOC105170351 [Sesamum indicum]
Length=828

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/263 (29%), Positives = 137/263 (52%), Gaps = 22/263 (8%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M   HE Q  IV  +R L + +   + TS+ H + T  L   V  WHS F ++I  
Sbjct  572  MWRSMNQFHEVQNDIVQQVRGLVNHTNKGESTSDLHRQATRDLESAVSAWHSSFCRLIKF  631

Query  754  QKEYIRGLNDWLKLNLVPID---TNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            Q++++R L+ W KL L+P++   TN   ++S         +      W+  + ++PD +A
Sbjct  632  QRDFVRSLHGWFKLTLIPVNSEPTNGNRELSE--------VFTFCDEWKLALDRIPDTVA  683

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPN  416
              AI SF  VV++I   Q++E+K+K R +   KELEK+     +    +YH Y       
Sbjct  684  SEAIKSFINVVHSISLKQIEELKIKKRTETASKELEKKASSLRNIEKKYYHSYSMVGIGL  743

Query  415  DDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPEL  245
             DT  D  H     + + +++ +L   ++R+++E   + +     R  +L +++TGLP +
Sbjct  744  PDTGPDNGHALDARDPLADKKAELATCQRRVEDEMLKHAKAVEVTRAMTLNNIQTGLPGV  803

Query  244  FHAMSEFSRACSIMYQTLESITH  176
            F AM+ FS   +++ + LE++ +
Sbjct  804  FQAMTSFS---ALITEALETVCY  823



>gb|KDP28858.1| hypothetical protein JCGZ_14629 [Jatropha curcas]
Length=810

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 131/256 (51%), Gaps = 15/256 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M  +HE Q  IV  ++ L ++S     TSE H + T  L   V  WHS F  +I  
Sbjct  552  MWRSMHQYHEVQNNIVQQVKGLVNLSAKGDSTSELHRQATRDLESAVSAWHSSFCHLIKF  611

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q+++IR ++ W KL L+P+  N    VS     ++  + A    W+  + ++PD +A  A
Sbjct  612  QRDFIRSVHGWFKLTLLPVSNNDNVNVSV----EHSDVYAFCDEWKLALDRVPDTVASEA  667

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPNDDT  407
            I SF  +V+ I   Q +E+K+K R +   KELEK+     +    +YH Y        DT
Sbjct  668  IKSFINIVHAISGKQTEELKIKKRTESASKELEKKASSLRNIERKFYHSYSMVGIGLPDT  727

Query  406  EQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
              D  H     + + E++ +L + ++++++E   + +     R  +L  L+TGLP +F A
Sbjct  728  GPDNGHALDARDPLAEKKSELASCQRKVEDEMLRHAKAVEVTRAMTLNHLQTGLPGVFQA  787

Query  235  MSEFSRACSIMYQTLE  188
            ++ FS   S+  + LE
Sbjct  788  LTSFS---SLFMEALE  800



>gb|KGN46505.1| hypothetical protein Csa_6G104620 [Cucumis sativus]
Length=815

 Score =   124 bits (310),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 140/266 (53%), Gaps = 33/266 (12%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M  +H+ Q  IV  +R L + +     TSE H + T  L  +V  WHS F ++I  
Sbjct  559  MWRSMHQYHDIQNNIVQQVRGLVNQTSHGDSTSELHRQATRDLESMVTAWHSSFCRLIKF  618

Query  754  QKEYIRGLNDWLKLNLVPID----TNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDEL  587
             +++IR L+ WLKL+ +P++    T+ KE           P    L  W+  + ++PD +
Sbjct  619  HRDFIRSLHGWLKLSYIPVNNDSLTDNKE-----------PAEIFLDQWKLALDRVPDTV  667

Query  586  AKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQF----EDWYHKYMQRRTP  419
            A  AI SF  VVN I   Q +E+K+K R +   KE EK++       + +Y+ Y      
Sbjct  668  ASVAIKSFINVVNVISAKQTEEIKIKKRTESASKEFEKKSASIMHLEKKFYNSYSMVGIG  727

Query  418  NDDTEQDGPHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT  260
              DT   GP ++ +++       E++++L A ++R++EE+  + +     R  +L +L+T
Sbjct  728  LPDT---GPADNGHILDARDPLAEKKIELVACQRRVEEEKIKHSKAVEVTRAMTLNNLQT  784

Query  259  GLPELFHAMSEFSRACSIMYQTLESI  182
            GLP +F A++ FS   ++  + LES+
Sbjct  785  GLPGVFQALTSFS---ALFTEALESV  807



>ref|NP_001190052.1| protein ALTERED PHOSPHATE STARVATION RESPONSE 1 [Arabidopsis 
thaliana]
 gb|AEE78775.1| uncharacterized protein AT3G51290 [Arabidopsis thaliana]
Length=798

 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/250 (32%), Positives = 122/250 (49%), Gaps = 15/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + VQ+WH  F  ++  Q
Sbjct  387  MWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEVQQWHHSFCNLVKAQ  446

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   + S   +     I +    W   I ++PD++A   I
Sbjct  447  RDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAIDRIPDKVASEGI  501

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF   V+ IV  Q DE K K R +   K+ EK++        KY     P         
Sbjct  502  KSFLTAVHGIVAQQADEHKQKKRTESMLKDFEKKSASLRALESKYSPYSVPES-------  554

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N VIE+++++E LK + +EE+  + +     R  +L +L+ G P +F AM  FS  C
Sbjct  555  RKKNPVIEKRVKVEMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC  614

Query  211  SIMYQTLESI  182
                Q  ES+
Sbjct  615  ---MQAFESV  621



>emb|CDP09433.1| unnamed protein product [Coffea canephora]
Length=813

 Score =   124 bits (310),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/264 (31%), Positives = 138/264 (52%), Gaps = 23/264 (9%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW++M  +HE Q  IV  ++ L + +   + TS+ H + T  L   V  WHS F +++  
Sbjct  556  MWKSMNQYHEVQYDIVQQVQGLVNRTTQGESTSDLHKQATRDLESAVSAWHSSFCRLMKF  615

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQN---PPILALLHAWQDLIGKLPDELA  584
            Q+E+IR L++W KL  +P        VSS Q   N     + A    W+  + ++PD +A
Sbjct  616  QREFIRSLHEWFKLTFLP--------VSSEQTNGNREHSEVFAFCDEWKLALDRIPDTVA  667

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPN  416
              A+ SF  VVN+I   Q +E+K+K R +   +ELEK+     +    +Y+ Y       
Sbjct  668  SEAVKSFINVVNSISLKQREELKIKGRAESVSRELEKKASSLRNIEKKYYNSYSMVGIGL  727

Query  415  DDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPEL  245
             DT  D  H     + + E++L+L A ++R+ +E   + +     R  +L +++TGLP +
Sbjct  728  PDTGPDNGHALDARDPLAEKKLELAACQRRVADEMLKHSKAVEVTRSHTLNNIQTGLPGV  787

Query  244  FHAMSEFSRACSIMYQTLESI-TH  176
            F AM+ FS   +++   LE++ TH
Sbjct  788  FQAMTSFS---AMIAGALEAVCTH  808



>ref|XP_011008835.1| PREDICTED: uncharacterized protein LOC105114109 [Populus euphratica]
Length=637

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 126/250 (50%), Gaps = 14/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + V +WH  F  ++  Q
Sbjct  381  MWRSMYELHQVQTHIVQQLKYLNTIPSTEPTSEIHRQSTLQLELEVHQWHQSFCNVVKAQ  440

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   + S   R     I +L   W   + ++PD++A   I
Sbjct  441  RDYIQSLTGWLRLSLFQFSKNPISRTSQESR-----IYSLCEEWHHAVDRIPDKVASEGI  495

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHKYMQRRTPNDDTEQ  401
             SF AV++ IV  Q +E K K + +   KE EK+    R  E  Y  Y    TP+   ++
Sbjct  496  KSFLAVIHAIVVQQAEEHKQKKKSESAFKEFEKKAAELRSLESKYGPYSMPETPSTTRKK  555

Query  400  DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  221
            D       V+E++ ++E  + + +EE+  + +     R  ++ +L+ G P +F AM  FS
Sbjct  556  D------PVMEKRAKVEISRAKAEEEKSKHEKSISVTRSMTMNNLQMGFPHVFQAMVGFS  609

Query  220  RACSIMYQTL  191
              C   +++L
Sbjct  610  SVCMNAFESL  619



>ref|XP_010426683.1| PREDICTED: uncharacterized protein LOC104711671 isoform X2 [Camelina 
sativa]
Length=643

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 122/250 (49%), Gaps = 15/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+WH  F  ++  Q
Sbjct  390  MWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQWHHSFCNLVKAQ  449

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   K S   +     I +    W   I ++PD++A   I
Sbjct  450  RDYIQSLTGWLRLSLFQFSKNPLVKSSYESK-----IYSFCEEWHLAIDRIPDKVASEGI  504

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF   V+ IV  Q DE K K R +   K+ EK++        KY     P         
Sbjct  505  KSFLTAVHGIVAQQADEHKQKKRTEAMLKDFEKKSAALRALESKYSPYSVPES-------  557

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N V+E+++++E LK + +EE+  + +     R  +L +L+ G P +F AM  FS  C
Sbjct  558  RKTNPVVEKRVKVEMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC  617

Query  211  SIMYQTLESI  182
                Q  ES+
Sbjct  618  ---MQAFESV  624



>ref|XP_010426682.1| PREDICTED: uncharacterized protein LOC104711671 isoform X1 [Camelina 
sativa]
Length=668

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 122/250 (49%), Gaps = 15/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+WH  F  ++  Q
Sbjct  415  MWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQWHHSFCNLVKAQ  474

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   K S   +     I +    W   I ++PD++A   I
Sbjct  475  RDYIQSLTGWLRLSLFQFSKNPLVKSSYESK-----IYSFCEEWHLAIDRIPDKVASEGI  529

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF   V+ IV  Q DE K K R +   K+ EK++        KY     P         
Sbjct  530  KSFLTAVHGIVAQQADEHKQKKRTEAMLKDFEKKSAALRALESKYSPYSVPES-------  582

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N V+E+++++E LK + +EE+  + +     R  +L +L+ G P +F AM  FS  C
Sbjct  583  RKTNPVVEKRVKVEMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC  642

Query  211  SIMYQTLESI  182
                Q  ES+
Sbjct  643  ---MQAFESV  649



>ref|XP_010503820.1| PREDICTED: uncharacterized protein LOC104780964 [Camelina sativa]
Length=644

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 122/250 (49%), Gaps = 15/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+WH  F  ++  Q
Sbjct  391  MWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQWHHSFCNLVKAQ  450

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   + S   +     I +    W   I ++PD++A   I
Sbjct  451  RDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAIDRIPDKVASEGI  505

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF   V+ IV  Q DE K K R +   K+ EK++        KY     P         
Sbjct  506  KSFLTAVHGIVAQQADEHKQKKRTEAMLKDFEKKSAALRALESKYSPYSVPES-------  558

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N VIE+++++E LK + +EE+  + +     R  +L +L+ G P +F AM  FS  C
Sbjct  559  RKTNPVIEKRVKVEMLKAKAEEEKSKHEKSVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC  618

Query  211  SIMYQTLESI  182
                Q  ES+
Sbjct  619  ---MQAFESV  625



>ref|XP_010515532.1| PREDICTED: uncharacterized protein LOC104791366 [Camelina sativa]
Length=643

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 122/250 (49%), Gaps = 15/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+WH  F  ++  Q
Sbjct  390  MWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQWHHSFCNLVKAQ  449

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   + S   +     I +    W   I ++PD++A   I
Sbjct  450  RDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAIDRIPDKVASEGI  504

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF   V+ IV  Q DE K K R +   K+ EK++        KY     P         
Sbjct  505  KSFLTAVHGIVAQQADEHKQKKRTEAMLKDFEKKSAALRALESKYSPYSVPES-------  557

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N VIE+++++E LK + +EE+  + +     R  +L +L+ G P +F AM  FS  C
Sbjct  558  RKTNPVIEKRVKVEMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC  617

Query  211  SIMYQTLESI  182
                Q  ES+
Sbjct  618  ---MQAFESV  624



>ref|XP_002529641.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32728.1| conserved hypothetical protein [Ricinus communis]
Length=637

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 122/240 (51%), Gaps = 8/240 (3%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + VQ+WH  F  +I  Q
Sbjct  381  MWRSMYEAHQVQTHIVQQLKYLNTIPSTEPTSEIHRQSTLQLELEVQQWHQSFCNLIKAQ  440

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   + S   R     I +L   W   I ++PD++A   I
Sbjct  441  RDYIQSLTGWLRLSLFQFSNNPLSRTSQESR-----IYSLCEEWHHAIDRIPDKVASEGI  495

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF  V++ IV  Q +E K K + + T KE EK+  +      KY     P  DT  +  
Sbjct  496  KSFLTVIHAIVVQQAEEHKQKKKSELTFKEFEKKVSELRSLETKYGPYSMP--DTSGNTR  553

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             +D  V E++ ++E L+ + +EE+  + +     R  ++ +L+ G P +F A+  FS  C
Sbjct  554  IKD-PVTEKRAKVEILRSKAEEEKSKHEKSVSITRAMTINNLQMGFPHVFQAIVGFSSVC  612



>gb|EPS68751.1| hypothetical protein M569_06016 [Genlisea aurea]
Length=816

 Score =   123 bits (308),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/265 (29%), Positives = 138/265 (52%), Gaps = 16/265 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL---DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI  761
            MW +M   HE+Q  IV  +R L     ++  + TS+ H   T  L   V EWHS F ++I
Sbjct  550  MWRSMNRFHESQNDIVQQVRGLVNGHANRGGESTSDLHRRATSYLESAVSEWHSSFCRLI  609

Query  760  IHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRP-QNPPILALLHAWQDLIGKLPDELA  584
              Q+++IR L+ W KL ++P+++     ++S  R  Q   +   +  W+  + ++PD +A
Sbjct  610  KFQRDFIRSLHGWFKLTVLPVNSEQMMTMNSNGREVQLGEVFGFIDEWKLALDRVPDTVA  669

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRT------  422
              AI SF  VV++I   Q +E+K++ R +   KELE++         KY    +      
Sbjct  670  SEAIKSFINVVHSISAKQAEELKIRKRTESVSKELERKASSLRSIEKKYYLSYSTVGIGL  729

Query  421  PNDDTEQDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  251
            P+   + DG H     + + E++ +L   ++R++EE   + +     R  +L +L+TGLP
Sbjct  730  PDPGPDHDGGHALDARDPLAEKKAELATCQRRVEEEMVRHSKAVEVTRAMTLNNLQTGLP  789

Query  250  ELFHAMSEFSRACSIMYQTLESITH  176
             +F AM+ FS    ++ + L+++ +
Sbjct  790  GVFQAMTGFS---GLITEALQAVCN  811



>emb|CDX73734.1| BnaC08g22690D [Brassica napus]
Length=640

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/250 (31%), Positives = 120/250 (48%), Gaps = 15/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T+QL + +Q+WH  F  ++  Q
Sbjct  387  MWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTFQLELEIQQWHHSFCNLVKAQ  446

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   + S   +     I +    W   I ++PD++A   I
Sbjct  447  RDYIQSLTGWLRLSLFQFSKNPLARSSYESK-----IYSFCEEWHLAIDRIPDKVASEGI  501

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF   V+ IV  Q +E K K R     K+ EK+         KY     P         
Sbjct  502  NSFLTAVHGIVAQQAEEHKQKKRSDSMLKDFEKKAASLRGLESKYSPYSVPEG-------  554

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N VIE++ ++E LK + +EE+  + +     R  +L +L+ G P +F AM  FS  C
Sbjct  555  RKKNPVIEKRAKVEFLKGKAEEEKSKHEKAVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC  614

Query  211  SIMYQTLESI  182
                Q  ES+
Sbjct  615  ---MQAFESV  621



>ref|XP_009383946.1| PREDICTED: uncharacterized protein LOC103971612 [Musa acuminata 
subsp. malaccensis]
Length=772

 Score =   122 bits (307),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 138/267 (52%), Gaps = 22/267 (8%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEK  767
            ++  MW  M   HE Q  IV  +R L + + + + TS+ H   T  L   V  WHS F +
Sbjct  508  ALLNMWRQMNKFHEIQNHIVQQVRGLVNRASTGESTSDLHRLATRDLEAAVSAWHSSFNR  567

Query  766  MIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHA----WQDLIGKL  599
            +I +Q++Y+  L  WLKL L+ + ++      +PQ+  + P+   L A    W+  + +L
Sbjct  568  LIKYQRDYVHALYGWLKLTLLQVSSD------NPQKDHSSPVAVELTAFCDEWKQALDRL  621

Query  598  PDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRT-  422
            PD +A  A+ SF  V++ I   Q++E+K+K R +   KELEK++    +   KY Q  + 
Sbjct  622  PDTVASEAVKSFMNVIHVIYTKQVEELKIKKRAETYSKELEKKSTALRNTEKKYYQSYSM  681

Query  421  -----PNDDTEQDGPHEDNN--VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR  263
                 P    + DG   D    + E++ ++ A ++++++E   + +     R  +L +++
Sbjct  682  VGLALPGGGHDNDGQVFDTRDPLAEKKSEIAACRRKVEDEMMRHAKAVEVTRSMTLNNIQ  741

Query  262  TGLPELFHAMSEFSRACSIMYQTLESI  182
            TGLP +F A++ FS    +  + LE +
Sbjct  742  TGLPGVFQALTGFS---GMFVEALEGV  765



>ref|XP_006856770.1| hypothetical protein AMTR_s00055p00070380 [Amborella trichopoda]
 gb|ERN18237.1| hypothetical protein AMTR_s00055p00070380 [Amborella trichopoda]
Length=665

 Score =   122 bits (306),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/263 (32%), Positives = 132/263 (50%), Gaps = 30/263 (11%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMS--QSPKETSEHHYERTYQLGVVVQEWHSQFE  770
             + +MW ++   H+ Q  IV  L+ L  S   SP+ TS  H + T QL V VQ+WHS F 
Sbjct  401  GLMQMWRSIYECHQVQTHIVEQLKYLHASPSTSPQPTSPSHRQATLQLEVQVQKWHSSFC  460

Query  769  KMIIHQKEYIRGLNDWLKLNLVPIDT--NLKEKVSSPQRPQNPPILALLHAWQDLIGKLP  596
             ++   ++YI  L+ W+ L L   D    L +K+      Q+PPI +L   WQ  + +LP
Sbjct  461  TLVQTHRDYIHSLSSWVGLTLSSSDPRHTLHQKLH-----QDPPIRSLCEEWQLALDRLP  515

Query  595  DELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPN  416
            D +A   I SF AVV  I   Q +E + K R +   K LEK+         KY       
Sbjct  516  DRVASEGIKSFLAVVQAISLQQGEEHRQKKRLESASKALEKKVCALRALECKY-------  568

Query  415  DDTEQDGPHEDNN-----VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  251
                  GP++ +      V E++ + EAL+ R++EE++ Y +     R  ++ +L+TG P
Sbjct  569  ------GPYDAHGLGLERVAEKRAKAEALRCRMEEEKDKYDKCVRVTRAMTVNNLQTGFP  622

Query  250  ELFHAMSEFSRACSIMYQTLESI  182
             +F A++ FS  C    Q LE++
Sbjct  623  NVFQAVTGFSGVC---MQALEAV  642



>ref|XP_009379364.1| PREDICTED: uncharacterized protein LOC103967785 [Pyrus x bretschneideri]
 ref|XP_009379365.1| PREDICTED: uncharacterized protein LOC103967785 [Pyrus x bretschneideri]
Length=649

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/247 (32%), Positives = 123/247 (50%), Gaps = 9/247 (4%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  LR L+   S + TSE H +   QL + VQ+WH  F  ++  Q
Sbjct  394  MWRSMYECHQVQKHIVQQLRYLNTIPSTEPTSEIHRQAALQLELQVQQWHLSFCSLVKAQ  453

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     +   K S   R     I  L   W   I ++PD++A   I
Sbjct  454  RDYIQSLTGWLRLSLFQFRRHPIAKTSQESR-----IYTLCEEWHHAIDRIPDKVASEGI  508

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF  VV+ IV  Q +E K K + + T KELEK+         +Y     P+      G 
Sbjct  509  KSFLTVVHAIVVQQAEEYKQKRKSESTFKELEKKATVLRSLESRYGPYSMPDS----SGN  564

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N V E++ ++E L+ + +EE+  + +     R  ++++L+ G P +F AM  FS  C
Sbjct  565  AKKNPVAEKRAKIEVLRAKAEEEKSKHEKLVNVTRTVTISNLQMGFPHVFEAMVGFSSVC  624

Query  211  SIMYQTL  191
               ++ L
Sbjct  625  MQAFEQL  631



>ref|XP_009115808.1| PREDICTED: uncharacterized protein LOC103841050 [Brassica rapa]
Length=639

 Score =   121 bits (304),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/250 (31%), Positives = 120/250 (48%), Gaps = 15/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T+QL + +Q+WH  F  ++  Q
Sbjct  386  MWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTFQLELEIQQWHHSFCNLVKAQ  445

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   + S   +     I +    W   I ++PD++A   I
Sbjct  446  RDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAIDRIPDKVASEGI  500

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF   V+ IV  Q +E K K R     K+ EK+         KY     P         
Sbjct  501  NSFLTAVHGIVAQQAEEHKQKKRSDSMLKDFEKKAASLRGLESKYSPYSVPEG-------  553

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N VIE++ ++E LK + +EE+  + +     R  +L +L+ G P +F AM  FS  C
Sbjct  554  RKKNPVIEKRAKVEFLKGKAEEEKSKHEKAVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC  613

Query  211  SIMYQTLESI  182
                Q  ES+
Sbjct  614  ---MQAFESV  620



>ref|XP_008352431.1| PREDICTED: uncharacterized protein LOC103415926 [Malus domestica]
Length=642

 Score =   121 bits (304),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 125/257 (49%), Gaps = 9/257 (4%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + VQ+WH  F  ++  Q
Sbjct  387  MWRSMYECHQVQKHIVQQLKYLNTIPSTEPTSEIHRQATLQLELQVQQWHLSFCSLVKAQ  446

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
             +YI+ L  WL+L+L     +   K S   R     I  L   W   I ++PD++A   I
Sbjct  447  CDYIQSLTGWLRLSLFQFRRHPIAKTSQESR-----IYTLCEEWHHAIDRIPDKVASEGI  501

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF  VV+ IV  Q DE K K + + T KELEK+         KY     P+  +     
Sbjct  502  KSFLTVVHAIVVQQADEYKQKRKSESTFKELEKKATALRSLESKYGPYSMPDSSSNA---  558

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N V E++ ++E ++ + +EE+  + +     R  ++ +L+ G P +F AM  FS  C
Sbjct  559  -KKNPVAEKRAKVEVIRAKAEEEKSKHEKLVSVTRTMTINNLQMGFPHVFEAMVGFSSVC  617

Query  211  SIMYQTLESITHPLNRE  161
               ++ L +     N E
Sbjct  618  MQAFEQLYNQAKSANEE  634



>ref|XP_007052313.1| BZIP domain class transcription factor [Theobroma cacao]
 gb|EOX96470.1| BZIP domain class transcription factor [Theobroma cacao]
Length=823

 Score =   122 bits (306),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 126/245 (51%), Gaps = 13/245 (5%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V  WHS F ++I  
Sbjct  566  MWGSMHQYHEVQNNIVQQVRGLINRSGKGDSTSELHRQATRDLESAVSAWHSSFCRLIKF  625

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q+++I  L+ W KL L+P+     + V   + P +  + A    W+  + ++PD +A  A
Sbjct  626  QRDFIHSLHGWFKLTLLPVSN---DNVDGNREPSD--VFAFCDEWKLALDRVPDTVASEA  680

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPNDDT  407
            I SF  VVN I   Q +E+K+K R +   KELEK+     +    +YH Y        D+
Sbjct  681  IKSFINVVNVISVKQTEELKIKKRTETVSKELEKKASSLRNIERKFYHSYSMVGIGLPDS  740

Query  406  EQD-GPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHA  236
              D G   D  + + E++ +L   ++R+++E   + +     R  +L +L+TGLP +F A
Sbjct  741  GPDHGQVLDARDPLAEKKSELAGCQRRVEDEMLRHAKAVEVTRAMTLNNLQTGLPGVFQA  800

Query  235  MSEFS  221
            M+ FS
Sbjct  801  MTSFS  805



>ref|XP_006380598.1| proline-rich family protein [Populus trichocarpa]
 gb|ERP58395.1| proline-rich family protein [Populus trichocarpa]
Length=654

 Score =   121 bits (304),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 125/250 (50%), Gaps = 14/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + V +WH  F  ++  Q
Sbjct  398  MWRSMYELHQVQTHIVQQLKYLNTIPSTEPTSEIHRQSTLQLELEVHQWHQSFCNVVKAQ  457

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   + S   R     I +L   W   + ++PD++A   I
Sbjct  458  RDYIQSLTGWLRLSLFQFSKNPISRTSQESR-----IYSLCEEWHHAVDRIPDKVASEGI  512

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHKYMQRRTPNDDTEQ  401
             SF AV++ IV  Q +E K K + +   KE EK+    R  E  Y  Y    TP+   ++
Sbjct  513  KSFLAVIHAIVVQQAEEHKQKKKSESAFKEFEKKAAELRSLESKYGPYSMPETPSTTRKK  572

Query  400  DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS  221
            D       V+E++ + E  + + +EE+  + +     R  ++ +L+ G P +F AM  FS
Sbjct  573  D------PVMEKRAKAEISRAKAEEEKSKHEKSISVTRSMTMNNLQMGFPHVFQAMVGFS  626

Query  220  RACSIMYQTL  191
              C   +++L
Sbjct  627  SVCMNAFESL  636



>gb|ABI34654.1| bZIP transcription factor bZIP80 [Glycine max]
Length=426

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/261 (30%), Positives = 133/261 (51%), Gaps = 23/261 (9%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M  +HE Q  IV  +R L + S     TSE H + T  L   V  WH+ F ++I  
Sbjct  170  MWRSMHHYHEIQSNIVQQVRGLVNRSSRGDSTSELHRQATRDLESAVSAWHNSFCRLIKF  229

Query  754  QKEYIRGLNDWLKLNLVPI---DTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELA  584
            Q+E+I  L+ W KL+LVP+   + N +E   + Q             W+  + ++PD +A
Sbjct  230  QREFILSLHGWFKLSLVPVHNDNINGRETSETYQ---------FFDEWKLALDRVPDTVA  280

Query  583  KTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTE  404
              AI SF  VV+ I   Q++E+K+K R +   KELEK+     +   K+    +    + 
Sbjct  281  SEAIKSFINVVHVISSKQVEELKIKKRTETASKELEKKASSLRNLERKFYSSYSMVGISL  340

Query  403  QDGPHEDNNVI-------ERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPEL  245
             D   ++  V+       E++++L   ++R+++E   + +     R  +L +L+TGLP +
Sbjct  341  PDSAPDNGQVLDARDPLAEKKIELATCQRRVEDEMLRHSKAVEVTRAMTLNNLQTGLPGV  400

Query  244  FHAMSEFSRACSIMYQTLESI  182
            F A++ FS   S+  + LES+
Sbjct  401  FQALTSFS---SLFAEALESV  418



>gb|KFK42583.1| hypothetical protein AALP_AA1G014300 [Arabis alpina]
Length=715

 Score =   121 bits (304),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 83/261 (32%), Positives = 137/261 (52%), Gaps = 17/261 (7%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW++M  +HE Q  IV  +R L + ++  + TSE H + T  L   V  WHS F ++I  
Sbjct  466  MWKSMHEYHEIQNNIVQQVRGLINQTERGESTSEVHRQVTRDLESAVSLWHSSFCRIIKF  525

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q+E+I  L+ W KL+LVP+     +K       Q     AL   W+  + ++PD +A  A
Sbjct  526  QREFISSLHAWFKLSLVPLSNEDPKK-------QRSDSFALCEEWKLSLERVPDTVASEA  578

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDG  395
            I SF  VV+ I   Q +E+K+K R +   KELEK+         KY Q  +    T   G
Sbjct  579  IKSFVNVVHVISIKQGEEVKMKKRTESAGKELEKKASSLRSIERKYYQAYS----TVGIG  634

Query  394  PHED-----NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            P  +     + + E++ +L A ++++++E   +++     R  +L +L+TGLP LF A++
Sbjct  635  PGPETLDARDPLSEKKSELAACQRQVEDEVMRHVKAVEVTRAMTLNNLQTGLPNLFQALT  694

Query  229  EFSRACSIMYQTLESITHPLN  167
             FS   +   QT+ S ++ +N
Sbjct  695  SFSSLFTDSLQTICSRSYSIN  715



>ref|XP_006290733.1| hypothetical protein CARUB_v10016827mg [Capsella rubella]
 gb|EOA23631.1| hypothetical protein CARUB_v10016827mg [Capsella rubella]
Length=640

 Score =   121 bits (303),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/250 (31%), Positives = 122/250 (49%), Gaps = 15/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+WH  F  ++  Q
Sbjct  387  MWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQWHHSFCNLVKAQ  446

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   + S   +     I +    W   I ++PD++A   I
Sbjct  447  RDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAIDRIPDKVASEGI  501

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF   V+ IV  Q DE K K R +   K+ EK++        KY     P         
Sbjct  502  KSFLTAVHGIVAQQADEHKQKKRTEAMLKDFEKKSASLRALESKYSPYSVPES-------  554

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N VIE++++++ LK + +EE+  + +     R  +L +L+ G P +F AM  FS  C
Sbjct  555  RKTNPVIEKRVKVDMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC  614

Query  211  SIMYQTLESI  182
                Q  ES+
Sbjct  615  ---MQAFESV  621



>gb|KEH17841.1| BZIP transcription factor bZIP80, putative [Medicago truncatula]
Length=723

 Score =   121 bits (304),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 138/261 (53%), Gaps = 17/261 (7%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M  +HE Q  IV  +R L + S     TSE H + T  L   +  WHS F ++I  
Sbjct  461  MWRSMHQYHEMQSNIVQQVRGLVNRSTKGHSTSESHKQATRDLESALSAWHSSFIRIIKF  520

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ-RPQNPPILALLHAWQDLIGKLPDELAKT  578
            Q+++I  L+ W KLNL+P++ +      S +  P +   L+    W+  + ++PD +A  
Sbjct  521  QRDFILSLHGWFKLNLIPVNNDNNNSSISNKMEPSDA--LSFCDGWKLALDRVPDTVASE  578

Query  577  AIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT-------RQFEDWYHKYMQRRTP  419
            AI SF  VV+ I   Q  E+K+K +     KEL K++       ++F + Y      + P
Sbjct  579  AIKSFINVVHVISVKQCQELKIKRKTDTAYKELVKKSSSLKNIEKKFYNSYSMVGIGKIP  638

Query  418  N--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPEL  245
            N  +D  Q G    + + E++L+LEA ++R+ +E+  + +     R  +L +L+TGLP +
Sbjct  639  NSVEDIGQ-GLDARDPLAEKKLELEACQRRVDDEKLKHSKAIEVTRAMTLNNLQTGLPGM  697

Query  244  FHAMSEFSRACSIMYQTLESI  182
            F A++ FS   S+  + LES+
Sbjct  698  FQALTSFS---SLFIEALESV  715



>ref|XP_008813601.1| PREDICTED: uncharacterized protein LOC103724193 [Phoenix dactylifera]
Length=760

 Score =   121 bits (304),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 78/263 (30%), Positives = 134/263 (51%), Gaps = 22/263 (8%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW +M   HE Q  IV  +  L + S + + TS+ H   T  L   V  WHS F +++ +
Sbjct  499  MWRSMHQFHEVQNHIVQQVHGLVNRSSAGEPTSDLHRLATRDLEAAVSAWHSSFNRLVKY  558

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPI----LALLHAWQDLIGKLPDEL  587
            Q++Y+R L  WL+L L  + ++      +PQ+  + PI     A    W+  + +LPD +
Sbjct  559  QRDYVRALYSWLRLTLYQVSSD------NPQKDHSSPISLELTAFCDEWKQALDRLPDTV  612

Query  586  AKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRT-----  422
            A  AI SF  V++ I   Q +E+K+K R +   KELEK++        KY Q  +     
Sbjct  613  ASEAIKSFMNVIHVIYTKQAEELKIKKRAEAFSKELEKKSASLRSIEKKYYQSYSMVGMA  672

Query  421  -PNDDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP  251
             P    + DG   D  + + E++ ++ A ++++++E   + +     R  +L +++TGLP
Sbjct  673  LPGSGHDNDGQVFDTRDPLAEKKSEIAACRRKVEDEMMRHAKAVEVTRSMTLNNIQTGLP  732

Query  250  ELFHAMSEFSRACSIMYQTLESI  182
             +F AM+ FS    +  Q LE +
Sbjct  733  GVFQAMTGFS---DLFVQNLEVV  752



>gb|KFK34370.1| hypothetical protein AALP_AA5G136500 [Arabis alpina]
Length=628

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 77/250 (31%), Positives = 120/250 (48%), Gaps = 15/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+WH  F  ++  Q
Sbjct  375  MWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQWHHSFCNLVKAQ  434

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            +EYI+ L  WL+L+L     N   + S   +     I +    W   + ++PD++A   I
Sbjct  435  REYIQALTGWLRLSLFQFSNNPLVRSSYESK-----IYSFCEEWHLAVDRIPDKVASEGI  489

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF   V+ IV  Q DE K K + +   K  EK++        KY     P         
Sbjct  490  KSFLTAVHGIVAQQADEHKQKKKSESMLKGFEKKSAALRALESKYSPYSVPES-------  542

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N VIE++ ++E LK + +EE+  + +     R  +L +L+ G P +F AM  FS  C
Sbjct  543  RKKNPVIEKRAKVEMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC  602

Query  211  SIMYQTLESI  182
                Q  ES+
Sbjct  603  ---MQAFESV  609



>ref|XP_011032057.1| PREDICTED: uncharacterized protein LOC105131006 [Populus euphratica]
Length=790

 Score =   121 bits (304),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 81/258 (31%), Positives = 136/258 (53%), Gaps = 19/258 (7%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPK--ETSEHHYERTYQLGVVVQEWHSQFEKMII  758
            MW +M  +HE Q  IV  +R L ++QS K   TSE H + T  L   V  WHS F  +I 
Sbjct  532  MWRSMHQYHEVQNHIVQQVRGL-VNQSAKGDSTSELHKQATRDLESAVSAWHSSFCHLIK  590

Query  757  HQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKT  578
             Q+++I+ ++ W KL L+P+ +   + +++   P +  + A    W+  I ++PD +A  
Sbjct  591  FQRDFIQSIHGWFKLTLIPVSS---DNMNANMEPSD--VYAFFDEWKLAIDRVPDTVASE  645

Query  577  AIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKY--MQRRTPN  416
            AI SF  VV+ I   Q +E+K+K R     KELEK+          +YH Y  +    P+
Sbjct  646  AIKSFINVVHVISTKQTEELKIKKRTDTASKELEKKASSLRSLERKFYHSYSMVGIGLPD  705

Query  415  DDTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELF  242
                 +G   D  + + E++ +L A ++R+++E   + +     R  +L +L+TGLP +F
Sbjct  706  TGGSDNGQFLDARDPLAEKKSELVACQRRVEDEMLRHAKAVEVTRAMTLNNLQTGLPGVF  765

Query  241  HAMSEFSRACSIMYQTLE  188
             A++ FS   S+  + LE
Sbjct  766  QALTSFS---SLFMEALE  780



>ref|XP_002467482.1| hypothetical protein SORBIDRAFT_01g028920 [Sorghum bicolor]
 gb|EER94480.1| hypothetical protein SORBIDRAFT_01g028920 [Sorghum bicolor]
Length=785

 Score =   121 bits (303),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/246 (30%), Positives = 124/246 (50%), Gaps = 11/246 (4%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   HE Q +IV  +R L  +   + TS+ H   T  L   V  WHS F ++I +Q
Sbjct  524  MWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVAAWHSNFNRLIKYQ  583

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YIR L  WLKL L  +D ++ ++  +    +   + +    W+  + +LPD +A  AI
Sbjct  584  RDYIRSLYGWLKLTLCQVDNSVPQEAHASMISRE--LTSFCDEWKQALDRLPDAVASEAI  641

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR---------RTP  419
             SF  VV+ I   Q +EMK+K R +   KELEK+T        KY Q           + 
Sbjct  642  KSFVNVVHVIYTKQAEEMKIKKRTETLSKELEKKTNSLRSIEKKYYQSYSMVGLGLPGSG  701

Query  418  NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
             D  E       + + E++ ++   ++++++E   + +     R  +L +++TGLP +F 
Sbjct  702  RDGIESHAYDARDPLAEKKTEIAQCRRKVEDEMTRHAKAVEVTRSMTLNNIQTGLPGIFQ  761

Query  238  AMSEFS  221
            A++ FS
Sbjct  762  AIAGFS  767



>ref|XP_008643472.1| PREDICTED: uncharacterized protein LOC100381684 isoform X1 [Zea 
mays]
 tpg|DAA46309.1| TPA: hypothetical protein ZEAMMB73_743906 [Zea mays]
Length=779

 Score =   121 bits (303),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/247 (30%), Positives = 127/247 (51%), Gaps = 12/247 (5%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   HE Q +IV  +R L  +   + TS+ H   T  L   V  WHS F ++I +Q
Sbjct  517  MWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVAAWHSNFNRLIKYQ  576

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YIR L  WLKL L  +D+++ ++V +    +   + +    W+  + +LPD +A  AI
Sbjct  577  RDYIRSLYGWLKLTLCQVDSSVPQEVHASMISRE--LTSFCDEWKQALDRLPDAVASEAI  634

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR---------RTP  419
             SF  VV+ I   Q +EMK+K R +   KELEK+         KY Q           + 
Sbjct  635  KSFVNVVHVIYTKQAEEMKIKKRAETYSKELEKKANSLRSIEKKYYQSYSMVGLGLPGSG  694

Query  418  NDDTEQDGPHEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELF  242
             D  E    ++  + + E++ ++   ++++++E   + +     R  +L +++TGLP +F
Sbjct  695  RDGIESHAAYDARDPLAEKKTEIAQCRRKVEDEMTRHAKAVEVTRSMTLNNIQTGLPGIF  754

Query  241  HAMSEFS  221
             A++ FS
Sbjct  755  QAIAGFS  761



>ref|NP_001065395.1| Os10g0562700 [Oryza sativa Japonica Group]
 gb|AAK31266.1|AC079890_2 putative leucine zipper protein [Oryza sativa Japonica Group]
 gb|AAK01315.2| bZIP [Oryza sativa Indica Group]
 gb|AAK13058.1| bZIP protein [Oryza sativa]
 gb|AAP55028.1| bZIP, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF27232.1| Os10g0562700 [Oryza sativa Japonica Group]
 gb|EAZ16987.1| hypothetical protein OsJ_32472 [Oryza sativa Japonica Group]
 dbj|BAH01606.1| unnamed protein product [Oryza sativa Japonica Group]
Length=767

 Score =   121 bits (303),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 123/246 (50%), Gaps = 11/246 (4%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   HE Q +IV  +R L  +   + TS+ H   T  L   V  WHS F ++I +Q
Sbjct  506  MWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVSAWHSNFNRLIKYQ  565

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YIR L  WLKL L  +D+N+ ++  +    +   +      W+  + +LPD  A  AI
Sbjct  566  RDYIRALYGWLKLTLFQVDSNIPQEAYTSLISRE--LTTFCDEWKQALDRLPDASASEAI  623

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR---------RTP  419
             SF  VV+ I   Q +EMK+K R +   KELEK+T        KY Q           + 
Sbjct  624  KSFVNVVHVIYTKQAEEMKIKKRTETYSKELEKKTNSLRAIEKKYYQSYSMVGLGLPGSG  683

Query  418  NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
             D  E       + + E++ ++   ++++++E   + +     R  +L +++TGLP +F 
Sbjct  684  RDGIESHSFDARDPLAEKKTEIAQCRRKVEDEMTRHAKAVEVTRSMTLNNIQTGLPGMFQ  743

Query  238  AMSEFS  221
            A++ FS
Sbjct  744  AIAGFS  749



>ref|XP_008370338.1| PREDICTED: uncharacterized protein LOC103433829 [Malus domestica]
 ref|XP_008370339.1| PREDICTED: uncharacterized protein LOC103433829 [Malus domestica]
Length=650

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 127/257 (49%), Gaps = 9/257 (4%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H +   +L + VQ+WH  F  ++  Q
Sbjct  395  MWRSMYECHQVQKHIVQQLKYLNTIPSTEPTSEIHRQAXLELELQVQQWHLSFCSLVKAQ  454

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     +   K S   R     I  L   W   I ++PD++A   I
Sbjct  455  RDYIQSLTGWLRLSLFQFRRHPIAKTSQESR-----IYTLCEEWHHAIDRIPDKVASEGI  509

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF  VV+ IV  Q +E K K + + T KELEK+         KY     P+      G 
Sbjct  510  KSFLTVVHAIVVQQAEEYKQKRKSESTFKELEKKATVLRSLESKYGPYSMPDS----SGN  565

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N V E++ ++E L+ + +EE+  + +     R  ++++L+ G P +F AM  FS  C
Sbjct  566  TKKNPVAEKRXKIEVLRAKAEEEKSKHEKLVNVTRTVTISNLQMGFPHVFEAMVGFSSVC  625

Query  211  SIMYQTLESITHPLNRE  161
               ++ L +     N+E
Sbjct  626  MQAFEQLYNQAKSANQE  642



>ref|XP_009363473.1| PREDICTED: uncharacterized protein LOC103953463 [Pyrus x bretschneideri]
Length=657

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 126/257 (49%), Gaps = 9/257 (4%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + VQ+WH  F  ++  Q
Sbjct  402  MWRSMYECHQVQKHIVQQLKYLNTIPSTEPTSEIHRQATLQLELQVQQWHLSFCSLVKAQ  461

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     +   K S   R     I  L   W   I ++PD++A   I
Sbjct  462  RDYIQSLTGWLRLSLFQFRRHPIAKTSQESR-----IYTLCEEWHHAIDRIPDKVASEGI  516

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF  VV+ IV  Q DE K K + + T KELEK+         KY     P+  +     
Sbjct  517  KSFLTVVHAIVVQQADEYKQKRKSESTFKELEKKATALRSLESKYGPYSMPDSSSNT---  573

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + + V E++ +++ +K + +EE+  + +     R  ++ +L+ G P +F AM  FS  C
Sbjct  574  -KKSPVAEKRAKVDIIKAKAEEEKSKHEKLVSVTRTMTINNLQMGFPHVFEAMVGFSSVC  632

Query  211  SIMYQTLESITHPLNRE  161
               ++ L +     N E
Sbjct  633  MQAFEQLYNQAKSANEE  649



>gb|EAY79532.1| hypothetical protein OsI_34661 [Oryza sativa Indica Group]
Length=767

 Score =   121 bits (303),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 123/246 (50%), Gaps = 11/246 (4%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   HE Q +IV  +R L  +   + TS+ H   T  L   V  WHS F ++I +Q
Sbjct  506  MWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVSAWHSNFNRLIKYQ  565

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YIR L  WLKL L  +D+N+ ++  +    +   +      W+  + +LPD  A  AI
Sbjct  566  RDYIRALYGWLKLTLFQVDSNIPQEAYTSLISRE--LTTFCDEWKQALDRLPDASASEAI  623

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR---------RTP  419
             SF  VV+ I   Q +EMK+K R +   KELEK+T        KY Q           + 
Sbjct  624  KSFVNVVHVIYTKQAEEMKIKKRTETYSKELEKKTNSLRAIEKKYYQSYSMVGLGLPGSG  683

Query  418  NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
             D  E       + + E++ ++   ++++++E   + +     R  +L +++TGLP +F 
Sbjct  684  RDGIESHSFDARDPLAEKKTEIAQCRRKVEDEMTRHAKAVEVTRSMTLNNIQTGLPGMFQ  743

Query  238  AMSEFS  221
            A++ FS
Sbjct  744  AIAGFS  749



>ref|XP_006660902.1| PREDICTED: uncharacterized protein LOC102703332 [Oryza brachyantha]
Length=392

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/256 (30%), Positives = 122/256 (48%), Gaps = 17/256 (7%)
 Frame = -2

Query  943  SMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKM  764
             +  MW  M   H+ Q  +V  L  L+ S S   TS  H +   QL + V  W+S F  +
Sbjct  132  GLMSMWRGMYECHQVQTHMVQQLEYLNNSLSTNPTSNVHRQAALQLEIEVDRWYSAFCSL  191

Query  763  IIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRP--QNPPILALLHAWQDLIGKLPDE  590
            +  Q++Y+  L  WL+L+L        +    P     QN  I +L   WQ  I ++PD+
Sbjct  192  VKSQRDYVYSLTGWLRLSLF-------QSYHDPHSKGHQNSDIYSLCEEWQLAIDRIPDK  244

Query  589  LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHKYMQRRTP  419
            +A   I +   V++ +V  Q +E K K R +   KELEK+T   R  E  Y  Y      
Sbjct  245  VASEGIKTLLTVIHAVVVQQAEEQKQKKRSESAFKELEKKTEELRSLESKYGPYSGAEGG  304

Query  418  NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
              D  +  P     V +++ ++EAL+ R  EE+  Y +     R  +L +L+TG P +F 
Sbjct  305  FGDMSRKSP-----VSDKRAKVEALRCRADEEKSKYEKSIGVTRAMTLNNLQTGFPNVFQ  359

Query  238  AMSEFSRACSIMYQTL  191
            AM+ F+  C   ++++
Sbjct  360  AMTGFASVCMEAFESV  375



>ref|XP_009373242.1| PREDICTED: uncharacterized protein LOC103962279 [Pyrus x bretschneideri]
Length=438

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 139/259 (54%), Gaps = 17/259 (7%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPK--ETSEHHYERTYQLGVVVQEWHSQFEKMII  758
            MW +M  +HE Q  IV  +R L ++QS K   TSE H + T  L   V  WHS F ++I 
Sbjct  180  MWRSMHQYHEVQNDIVQQVRGL-VNQSAKGDSTSELHRQATRDLESAVSAWHSSFCRLIK  238

Query  757  HQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKT  578
             ++++IR ++ W KL L+P++ ++   V +    ++  + +    W+  + ++PD +A  
Sbjct  239  FKRDFIRSVHGWFKLTLLPVNNDMTFNVHN----ESSDVYSFCDEWKLALERVPDTVASE  294

Query  577  AIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKY-MQRRTPND  413
            AI SF  VV+ I   Q +E+K+K R +   +ELEK+     +    +YH Y M      D
Sbjct  295  AINSFINVVHVISLKQSEELKIKKRTETASRELEKKASSLRNIEKKFYHSYSMVGIGLPD  354

Query  412  DTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
               ++G   D  + + E++ +L   ++R+++E   + +     R  +L +L+TGLP +F 
Sbjct  355  SGPENGQVLDARDPLAEKKSELTTCQRRVEDEMMRHTKAVEVTRAMTLNNLQTGLPGVFQ  414

Query  238  AMSEFSRACSIMYQTLESI  182
            A++ FS    +  + LES+
Sbjct  415  ALTSFS---GLFTEALESV  430



>ref|XP_006403933.1| hypothetical protein EUTSA_v10010132mg [Eutrema salsugineum]
 gb|ESQ45386.1| hypothetical protein EUTSA_v10010132mg [Eutrema salsugineum]
Length=801

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/250 (31%), Positives = 121/250 (48%), Gaps = 15/250 (6%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L+ L+   S + TSE H + T QL + +Q+WH  F  ++  Q
Sbjct  390  MWRSMYESHQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLELEIQQWHYSFCNLVKAQ  449

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            ++YI+ L  WL+L+L     N   + S   +     I +    W   I ++PD++A   I
Sbjct  450  RDYIQSLTGWLRLSLFQFSKNPLVRSSYESK-----IYSFCEEWHLAIDRIPDKVASEGI  504

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF   V+ IV  Q +E K K R +   K+ EK+         KY     P         
Sbjct  505  KSFLTAVHGIVAQQAEEHKQKKRSESMLKDFEKKAAALRALESKYSPYSVPESK------  558

Query  391  HEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRAC  212
             + N VIE+++++E LK + +EE+  + +     R  +L +L+ G P +F AM  FS  C
Sbjct  559  -KKNPVIEKRVKVEMLKGKAEEEKSKHEKAVSVTRAMTLNNLQMGFPHVFQAMVGFSSVC  617

Query  211  SIMYQTLESI  182
                Q  ES+
Sbjct  618  ---MQAFESV  624



>ref|XP_008808616.1| PREDICTED: uncharacterized protein LOC103720605, partial [Phoenix 
dactylifera]
Length=552

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/251 (31%), Positives = 128/251 (51%), Gaps = 13/251 (5%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQ  752
            MW +M   H+ Q  IV  L  L+ + S   T++ H + + QL + V  W+S F  ++  Q
Sbjct  296  MWRSMYECHQVQTHIVQQLEYLNNASSTNPTTDIHRQASLQLELEVNHWYSAFCSLVKSQ  355

Query  751  KEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAI  572
            +EY+  L  WL+L+L   D N+  K       Q+  I +L   WQ  + ++PD++A   I
Sbjct  356  REYMYALTGWLRLSLFQCDHNMLGK-----SQQSSDIYSLCEEWQLALDRIPDKVASEGI  410

Query  571  YSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP  392
             SF  V++ +V  Q +E K K + +   KELEKR ++      K      P    E  G 
Sbjct  411  KSFITVIHAVVVQQAEEQKQKRKSELAFKELEKRAQELRSLESKC----GPYSAAEGHGE  466

Query  391  HEDNN-VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRA  215
                  V+E++ ++E+LK + +EE+  + +     R  +L +L+TGLP +F A++ F+  
Sbjct  467  MSRRYPVMEKRAKVESLKTKAEEEKSRHEKSVAVTRAMTLNNLQTGLPNVFQAITGFASV  526

Query  214  CSIMYQTLESI  182
            C    Q  ES+
Sbjct  527  C---MQAFESV  534



>ref|XP_010275436.1| PREDICTED: uncharacterized protein LOC104610494 [Nelumbo nucifera]
Length=756

 Score =   120 bits (302),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/246 (32%), Positives = 130/246 (53%), Gaps = 9/246 (4%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW  M   HE Q  IV  +R L + +   + TSE H + T  L   V  WHS F +++ +
Sbjct  493  MWRYMNQFHEIQYHIVQQVRGLVNQATKGESTSELHRQATRHLESTVSAWHSNFCRLVKY  552

Query  754  QKEYIRGLNDWLKLNLVPI-DTNLK-EKVSSPQRPQNPPILALLHAWQDLIGKLPDELAK  581
            Q++YIR L+ WLKL+ + + D N+   K +S     N  +      W+  + +LPD +A 
Sbjct  553  QRDYIRSLHGWLKLSYILVGDDNISGSKDASLAVQANSDLFTFCDEWKLALDRLPDTVAS  612

Query  580  TAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFED----WYHKYMQRRTPND  413
             AI SF  VV+ IV  Q +E+K+K R +   K+LEK++    +    +Y  Y        
Sbjct  613  EAIKSFVNVVHAIVVKQTEEIKIKKRTETASKDLEKKSLALRNIEKKFYLSYSMVGIAPP  672

Query  412  DTEQDGPHED--NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFH  239
            +   DG   D  + + E++L+L + ++R+++E   + +     R  +L +++TGLP +F 
Sbjct  673  EGGSDGHVLDARDPLAEKKLELASCRRRVEDEMMKHAKAIEVTRAMTLNNIQTGLPGVFQ  732

Query  238  AMSEFS  221
            AM+ FS
Sbjct  733  AMTGFS  738



>ref|XP_002892025.1| proline-rich family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68284.1| proline-rich family protein [Arabidopsis lyrata subsp. lyrata]
Length=675

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 140/261 (54%), Gaps = 17/261 (7%)
 Frame = -2

Query  931  MWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIH  755
            MW++M  +HE Q  IV  +R L + ++  + TSE H + T  L   V  WH  F ++I  
Sbjct  426  MWKSMHEYHEIQNNIVQQVRGLINHTEKGESTSEVHRQVTRDLESAVSLWHLSFCRIIKF  485

Query  754  QKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTA  575
            Q+E+I  L+ W KL+LVP+     +K    +RP++    AL   W+  + ++PD +A  A
Sbjct  486  QREFICSLHAWFKLSLVPLSNEDPKK----ERPES---FALCEEWKQSLERVPDTVASEA  538

Query  574  IYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDG  395
            I SF  VV+ I   Q +E+K+K R +   KELEK+         KY Q  +    T   G
Sbjct  539  IKSFVNVVHVISIKQAEEVKMKKRTESAGKELEKKASSLRSIERKYYQAYS----TVGIG  594

Query  394  PHED-----NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMS  230
            P  +     + + E++ +L A ++++++E   +++     R  +L +L+TGLP +F A++
Sbjct  595  PGPEVLDARDPLSEKKCELAACQRQVEDEVMRHVKAVEVTRAMTLNNLQTGLPNVFQALT  654

Query  229  EFSRACSIMYQTLESITHPLN  167
             FS   +   QT+ S ++ +N
Sbjct  655  SFSCLFTESLQTVCSRSYSIN  675



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2170253216175