BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038F12

Length=929
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU38854.1|  hypothetical protein MIMGU_mgv1a001581mg                363   1e-115   Erythranthe guttata [common monkey flower]
ref|XP_002262674.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    358   3e-113   Vitis vinifera
emb|CAN78894.1|  hypothetical protein VITISV_009566                     354   5e-112   Vitis vinifera
ref|XP_009767345.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    352   9e-111   Nicotiana sylvestris
ref|XP_009587872.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    343   1e-107   Nicotiana tomentosiformis
emb|CDP07437.1|  unnamed protein product                                343   2e-107   Coffea canephora [robusta coffee]
ref|XP_011083887.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    335   4e-105   
ref|XP_010271467.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    328   9e-102   Nelumbo nucifera [Indian lotus]
ref|NP_001265966.1|  Hop-interacting protein THI044                     322   1e-99    Solanum lycopersicum
ref|XP_006342010.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    322   2e-99    
ref|XP_010320044.1|  PREDICTED: hop-interacting protein THI044 is...    320   2e-98    Solanum lycopersicum
ref|XP_006342009.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    319   2e-98    
ref|XP_007017697.1|  Chaperone DnaJ-domain superfamily protein is...    311   2e-95    
ref|XP_007017696.1|  Chaperone DnaJ-domain superfamily protein is...    311   2e-95    
ref|XP_008221317.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    308   1e-94    Prunus mume [ume]
gb|KHG01462.1|  accumulation and replication of chloroplasts 6, c...    308   2e-94    Gossypium arboreum [tree cotton]
ref|XP_006435105.1|  hypothetical protein CICLE_v100003722mg            298   9e-94    
gb|KDO84750.1|  hypothetical protein CISIN_1g003752mg                   298   1e-93    Citrus sinensis [apfelsine]
gb|KJB58153.1|  hypothetical protein B456_009G196600                    305   3e-93    Gossypium raimondii
ref|XP_009335546.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    305   3e-93    Pyrus x bretschneideri [bai li]
ref|XP_007227000.1|  hypothetical protein PRUPE_ppa001578mg             305   5e-93    Prunus persica
ref|XP_004291818.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    302   3e-92    Fragaria vesca subsp. vesca
ref|XP_004167108.1|  PREDICTED: LOW QUALITY PROTEIN: protein ACCU...    295   5e-92    
ref|XP_002307697.1|  hypothetical protein POPTR_0005s25630g             301   7e-92    
ref|XP_006383730.1|  hypothetical protein POPTR_0005s25630g             300   1e-91    
ref|XP_010672203.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    300   4e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010095543.1|  hypothetical protein L484_016017                   298   1e-90    Morus notabilis
gb|KDO84749.1|  hypothetical protein CISIN_1g003752mg                   298   1e-90    Citrus sinensis [apfelsine]
ref|XP_008388150.1|  PREDICTED: LOW QUALITY PROTEIN: protein ACCU...    298   2e-90    
ref|XP_006473597.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    297   2e-90    Citrus sinensis [apfelsine]
gb|EPS66110.1|  hypothetical protein M569_08664                         296   1e-89    Genlisea aurea
ref|XP_011045148.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    295   2e-89    Populus euphratica
ref|XP_004152763.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    292   2e-88    
gb|KGN62655.1|  hypothetical protein Csa_2G365130                       295   2e-88    Cucumis sativus [cucumbers]
ref|XP_008444775.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    288   1e-86    Cucumis melo [Oriental melon]
ref|XP_010061021.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    288   1e-86    Eucalyptus grandis [rose gum]
ref|XP_010907356.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    280   9e-84    Elaeis guineensis
ref|XP_010907355.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    280   2e-83    Elaeis guineensis
gb|KHN39446.1|  Protein ACCUMULATION AND REPLICATION OF CHLOROPLA...    273   7e-83    Glycine soja [wild soybean]
ref|XP_009393636.1|  PREDICTED: LOW QUALITY PROTEIN: protein ACCU...    278   7e-83    
gb|KDP38591.1|  hypothetical protein JCGZ_04516                         277   7e-83    Jatropha curcas
ref|XP_004499214.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    275   7e-82    Cicer arietinum [garbanzo]
ref|XP_007160698.1|  hypothetical protein PHAVU_001G009500g             273   4e-81    Phaseolus vulgaris [French bean]
ref|XP_003545049.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    273   4e-81    Glycine max [soybeans]
ref|XP_003589356.1|  hypothetical protein MTR_1g023310                  271   1e-80    Medicago truncatula
ref|XP_003549451.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    266   2e-78    Glycine max [soybeans]
gb|KHN12665.1|  Protein ACCUMULATION AND REPLICATION OF CHLOROPLA...    265   8e-78    Glycine soja [wild soybean]
ref|XP_002510483.1|  heat shock protein binding protein, putative       261   7e-77    Ricinus communis
ref|XP_006854866.1|  hypothetical protein AMTR_s00182p00037730          258   2e-75    Amborella trichopoda
ref|XP_006403374.1|  hypothetical protein EUTSA_v10003151mg             254   5e-74    Eutrema salsugineum [saltwater cress]
ref|XP_010494186.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    251   7e-73    Camelina sativa [gold-of-pleasure]
gb|KFK32921.1|  hypothetical protein AALP_AA6G306600                    250   2e-72    Arabis alpina [alpine rockcress]
ref|XP_006280025.1|  hypothetical protein CARUB_v10025901mg             249   3e-72    
ref|XP_010535302.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    249   5e-72    Tarenaya hassleriana [spider flower]
ref|XP_006403373.1|  hypothetical protein EUTSA_v10003151mg             247   2e-71    Eutrema salsugineum [saltwater cress]
ref|XP_010535306.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    245   7e-71    Tarenaya hassleriana [spider flower]
gb|AAQ18646.1|  division protein                                        245   9e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865514.1|  hypothetical protein ARALYDRAFT_494787             244   2e-70    
gb|AAQ18645.1|  division protein                                        244   3e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280026.1|  hypothetical protein CARUB_v10025901mg             243   3e-70    Capsella rubella
ref|NP_199063.1|  protein accumulation and replication of chlorop...    242   1e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101846.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    240   5e-69    Brassica rapa
emb|CDY61131.1|  BnaCnng37370D                                          234   7e-67    Brassica napus [oilseed rape]
ref|XP_010481984.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    219   1e-66    
ref|XP_009101847.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    233   1e-66    Brassica rapa
gb|ADE75665.1|  unknown                                                 229   3e-66    Picea sitchensis
ref|XP_002453221.1|  hypothetical protein SORBIDRAFT_04g001860          229   5e-65    Sorghum bicolor [broomcorn]
dbj|BAH01566.1|  unnamed protein product                                223   4e-64    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952074.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    224   2e-63    Setaria italica
tpg|DAA01472.1|  TPA: plastid division protein precursor                223   1e-62    Oryza sativa Indica Group [Indian rice]
gb|EEC72377.1|  hypothetical protein OsI_05646                          223   1e-62    Oryza sativa Indica Group [Indian rice]
gb|EMS50085.1|  hypothetical protein TRIUR3_08207                       220   5e-62    Triticum urartu
ref|XP_003573630.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    220   9e-62    Brachypodium distachyon [annual false brome]
dbj|BAK04117.1|  predicted protein                                      213   2e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW66593.1|  hypothetical protein ZEAMMB73_835383                    214   3e-60    
ref|XP_006646807.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    212   1e-59    Oryza brachyantha
ref|NP_001148117.1|  LOC100281725                                       214   1e-59    Zea mays [maize]
dbj|BAJ84942.1|  predicted protein                                      210   3e-58    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU49256.1|  ARC6                                                    205   1e-57    Erythranthe guttata [common monkey flower]
gb|AIU49271.1|  ARC6                                                    200   1e-55    Vitis vinifera
gb|AIU49275.1|  ARC6                                                    194   1e-53    Platanus x hispanica [London plane tree]
gb|AIU49230.1|  ARC6                                                    192   9e-53    Magnolia denudata [haku-mokuren]
gb|AIU49274.1|  ARC6                                                    191   2e-52    Cinnamomum camphora
gb|AIU49268.1|  ARC6                                                    189   1e-51    Solanum lycopersicum
gb|AIU49258.1|  ARC6                                                    189   2e-51    Solanum tuberosum [potatoes]
gb|AIU49245.1|  ARC6                                                    186   2e-50    Buxus sinica
gb|AIU49238.1|  ARC6                                                    186   3e-50    Gossypium raimondii
gb|AIU49226.1|  ARC6                                                    182   3e-49    Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU49236.1|  ARC6                                                    179   4e-48    Sarcandra glabra
gb|AIU49235.1|  ARC6                                                    179   8e-48    Acorus calamus [flagroot]
ref|XP_001775455.1|  predicted protein                                  180   1e-47    
gb|KDO84752.1|  hypothetical protein CISIN_1g003752mg                   180   1e-47    Citrus sinensis [apfelsine]
ref|XP_006473598.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    179   2e-47    Citrus sinensis [apfelsine]
gb|KDO84751.1|  hypothetical protein CISIN_1g003752mg                   179   2e-47    Citrus sinensis [apfelsine]
ref|XP_006473599.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    178   4e-47    Citrus sinensis [apfelsine]
gb|AIU49255.1|  ARC6                                                    176   9e-47    Manihot esculenta [manioc]
gb|AIU49265.1|  ARC6                                                    176   1e-46    Dioscorea oppositifolia
gb|AIU49263.1|  ARC6                                                    164   1e-46    Artemisia annua [sweet Annie]
gb|AIU49277.1|  ARC6                                                    175   1e-46    Houttuynia cordata [chameleon-plant]
gb|AIU49247.1|  ARC6                                                    175   1e-46    Chloranthus japonicus
gb|AIU49249.1|  ARC6                                                    175   2e-46    Chimonanthus praecox [wintersweet]
gb|AIU49259.1|  ARC6                                                    174   4e-46    Populus trichocarpa [western balsam poplar]
gb|AIU49280.1|  ARC6                                                    174   6e-46    Trachycarpus fortunei
gb|AIU49244.1|  ARC6                                                    174   7e-46    Illicium henryi
gb|AIU49250.1|  ARC6                                                    172   1e-45    Pandanus utilis
ref|XP_001778770.1|  predicted protein                                  174   2e-45    
gb|AIU49231.1|  ARC6                                                    172   2e-45    Musa acuminata [banana]
gb|AIU49234.1|  ARC6                                                    172   2e-45    Theobroma cacao [chocolate]
gb|AIU49254.1|  ARC6                                                    171   4e-45    Canna indica [canna]
gb|AIU49242.1|  ARC6                                                    169   3e-44    Eucalyptus grandis [rose gum]
gb|AIU49260.1|  ARC6                                                    169   4e-44    Prunus persica
gb|AIU49237.1|  ARC6                                                    166   2e-43    Citrus clementina [clementine]
gb|AIU49279.1|  ARC6                                                    166   4e-43    Alisma plantago-aquatica
gb|AIU49272.1|  ARC6                                                    166   5e-43    Lactuca sativa [cultivated lettuce]
gb|AIU49248.1|  ARC6                                                    165   6e-43    Ceratophyllum demersum [hornwort]
gb|AIU49241.1|  ARC6                                                    165   8e-43    Citrus sinensis [apfelsine]
gb|AIU49251.1|  ARC6                                                    165   8e-43    Asparagus officinalis
gb|AIU49246.1|  ARC6                                                    164   2e-42    Iris japonica
gb|AIU49262.1|  ARC6                                                    163   3e-42    Phaseolus vulgaris [French bean]
gb|AIU49229.1|  ARC6                                                    163   4e-42    Lilium brownii [Hong Kong lily]
gb|KCW67921.1|  hypothetical protein EUGRSUZ_F01622                     163   1e-41    Eucalyptus grandis [rose gum]
ref|XP_002970022.1|  hypothetical protein SELMODRAFT_92361              162   1e-41    
gb|AIU49239.1|  ARC6                                                    162   1e-41    Carica papaya [mamon]
gb|AIU49266.1|  ARC6                                                    161   2e-41    Yucca filamentosa [Adam's-needle]
ref|XP_002993317.1|  hypothetical protein SELMODRAFT_136906             161   3e-41    
gb|AIU49243.1|  ARC6                                                    157   7e-40    Glycine max [soybeans]
gb|AIU49228.1|  ARC6                                                    156   9e-40    Arabidopsis thaliana [mouse-ear cress]
gb|AIU49264.1|  ARC6                                                    156   2e-39    Ricinus communis
gb|AIU49253.1|  ARC6                                                    155   2e-39    Medicago truncatula
ref|XP_006596571.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    156   2e-39    Glycine max [soybeans]
gb|AIU49227.1|  ARC6                                                    155   4e-39    Arabidopsis lyrata [lyrate rockcress]
gb|AIU49240.1|  ARC6                                                    153   2e-38    Capsella rubella
gb|AIU49276.1|  ARC6                                                    151   6e-38    Ginkgo biloba [ginkgo]
gb|AIU49261.1|  ARC6                                                    150   1e-37    Panicum virgatum
gb|AIU49278.1|  ARC6                                                    150   2e-37    Zea mays [maize]
gb|AIU49269.1|  ARC6                                                    150   2e-37    Sorghum bicolor [broomcorn]
gb|AIU49233.1|  ARC6                                                    149   5e-37    Brachypodium distachyon [annual false brome]
ref|XP_006601329.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    150   5e-37    Glycine max [soybeans]
ref|XP_006601331.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    150   5e-37    Glycine max [soybeans]
ref|XP_006601330.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    149   7e-37    
gb|AIU49270.1|  ARC6                                                    147   2e-36    Schrenkiella parvula
gb|AIU49267.1|  ARC6                                                    146   4e-36    Setaria italica
ref|XP_007017698.1|  Chaperone DnaJ-domain superfamily protein is...    135   6e-32    
ref|XP_008777706.1|  PREDICTED: protein ACCUMULATION AND REPLICAT...    129   1e-29    Phoenix dactylifera
gb|KDO84753.1|  hypothetical protein CISIN_1g003752mg                   123   1e-27    Citrus sinensis [apfelsine]
gb|KJB58154.1|  hypothetical protein B456_009G196600                    120   1e-26    Gossypium raimondii
ref|XP_002506694.1|  predicted protein                                  103   5e-22    Micromonas commoda
ref|XP_001421185.1|  predicted protein                                  104   3e-21    Ostreococcus lucimarinus CCE9901
ref|XP_003078537.1|  plastid division protein precurso (ISS)          95.9    1e-18    
ref|XP_007509799.1|  predicted protein                                96.3    2e-18    Bathycoccus prasinos
emb|CEF97403.1|  Domain of unknown function DUF4101                   95.9    2e-18    Ostreococcus tauri
emb|CDJ26504.1|  unnamed protein product                              90.1    2e-16    Triticum aestivum [Canadian hard winter wheat]
gb|EMT18208.1|  hypothetical protein F775_01957                       89.7    2e-16    
tpg|DAA35367.1|  TPA: LOW QUALITY PROTEIN: hypothetical protein Z...  85.9    6e-16    
dbj|BAK04719.1|  predicted protein                                    87.0    6e-16    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001132647.1|  uncharacterized protein LOC100194122             85.9    6e-16    
tpg|DAA35365.1|  TPA: hypothetical protein ZEAMMB73_883312            86.3    3e-15    
ref|XP_002448767.1|  hypothetical protein SORBIDRAFT_06g032820        85.9    4e-15    Sorghum bicolor [broomcorn]
ref|XP_010240606.1|  PREDICTED: plastid division protein CDP1, ch...  84.0    2e-14    Brachypodium distachyon [annual false brome]
ref|XP_005649950.1|  hypothetical protein COCSUDRAFT_61625            82.8    4e-14    Coccomyxa subellipsoidea C-169
ref|XP_006653024.1|  PREDICTED: plastid division protein CDP1, ch...  81.6    9e-14    
emb|CAJ86106.1|  H0103C06.10                                          80.5    2e-13    Oryza sativa [red rice]
emb|CDO98565.1|  unnamed protein product                              80.5    2e-13    Coffea canephora [robusta coffee]
gb|EEC78247.1|  hypothetical protein OsI_17910                        80.5    2e-13    Oryza sativa Indica Group [Indian rice]
gb|EEE61900.1|  hypothetical protein OsJ_16611                        80.5    3e-13    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004960082.1|  PREDICTED: LOW QUALITY PROTEIN: plastid divi...  79.7    4e-13    
emb|CBG76281.1|  OO_Ba0005L10-OO_Ba0081K17.32                         79.0    6e-13    Oryza officinalis
emb|CDX92306.1|  BnaA05g21010D                                        79.0    7e-13    
ref|XP_004235403.1|  PREDICTED: plastid division protein CDP1, ch...  77.4    2e-12    Solanum lycopersicum
ref|XP_011072068.1|  PREDICTED: plastid division protein CDP1, ch...  77.0    3e-12    Sesamum indicum [beniseed]
ref|XP_006441426.1|  hypothetical protein CICLE_v10018888mg           76.6    5e-12    
ref|XP_006493425.1|  PREDICTED: plastid division protein CDP1, ch...  76.3    5e-12    Citrus sinensis [apfelsine]
gb|KDO46155.1|  hypothetical protein CISIN_1g0034421mg                75.5    7e-12    Citrus sinensis [apfelsine]
ref|XP_010275977.1|  PREDICTED: plastid division protein CDP1, ch...  74.7    2e-11    Nelumbo nucifera [Indian lotus]
ref|XP_006847842.1|  hypothetical protein AMTR_s00029p00059460        74.3    2e-11    
ref|XP_011047754.1|  PREDICTED: plastid division protein CDP1, ch...  74.3    3e-11    Populus euphratica
ref|XP_011047753.1|  PREDICTED: plastid division protein CDP1, ch...  74.3    3e-11    Populus euphratica
ref|XP_010666542.1|  PREDICTED: plastid division protein CDP1, ch...  73.9    3e-11    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010666543.1|  PREDICTED: plastid division protein CDP1, ch...  73.9    4e-11    Beta vulgaris subsp. vulgaris [field beet]
gb|EYU22294.1|  hypothetical protein MIMGU_mgv1a001394mg              73.6    4e-11    Erythranthe guttata [common monkey flower]
ref|XP_006353937.1|  PREDICTED: plastid division protein CDP1, ch...  73.2    5e-11    Solanum tuberosum [potatoes]
ref|XP_009792114.1|  PREDICTED: plastid division protein CDP1, ch...  73.2    6e-11    Nicotiana sylvestris
ref|XP_009590614.1|  PREDICTED: plastid division protein CDP1, ch...  73.2    6e-11    Nicotiana tomentosiformis
ref|XP_009792113.1|  PREDICTED: plastid division protein CDP1, ch...  73.2    6e-11    Nicotiana sylvestris
gb|KDP45812.1|  hypothetical protein JCGZ_17419                       73.2    6e-11    Jatropha curcas
ref|XP_009590613.1|  PREDICTED: plastid division protein CDP1, ch...  72.8    7e-11    Nicotiana tomentosiformis
ref|XP_004164805.1|  PREDICTED: plastid division protein CDP1, ch...  72.8    8e-11    
ref|WP_015116621.1|  DnaJ-class molecular chaperone with C-termin...  72.8    8e-11    Rivularia sp. PCC 7116
ref|XP_004138549.1|  PREDICTED: plastid division protein CDP1, ch...  72.4    1e-10    Cucumis sativus [cucumbers]
ref|XP_008803150.1|  PREDICTED: plastid division protein CDP1, ch...  72.4    1e-10    Phoenix dactylifera
gb|KFK39238.1|  hypothetical protein AALP_AA3G218300                  72.4    1e-10    Arabis alpina [alpine rockcress]
ref|XP_010935548.1|  PREDICTED: plastid division protein CDP1, ch...  72.0    1e-10    
ref|XP_010935546.1|  PREDICTED: plastid division protein CDP1, ch...  72.0    1e-10    
ref|XP_010935544.1|  PREDICTED: plastid division protein CDP1, ch...  72.0    1e-10    Elaeis guineensis
ref|XP_010935547.1|  PREDICTED: plastid division protein CDP1, ch...  72.0    2e-10    Elaeis guineensis
ref|XP_010935545.1|  PREDICTED: plastid division protein CDP1, ch...  71.6    2e-10    
ref|XP_008463100.1|  PREDICTED: plastid division protein CDP1, ch...  71.6    2e-10    Cucumis melo [Oriental melon]
ref|XP_010069516.1|  PREDICTED: plastid division protein CDP1, ch...  71.2    3e-10    Eucalyptus grandis [rose gum]
ref|XP_010069515.1|  PREDICTED: plastid division protein CDP1, ch...  71.2    3e-10    Eucalyptus grandis [rose gum]
ref|XP_006386191.1|  hypothetical protein POPTR_0002s02900g           70.5    3e-10    
ref|XP_010940349.1|  PREDICTED: plastid division protein CDP1, ch...  70.9    3e-10    Elaeis guineensis
ref|XP_008375062.1|  PREDICTED: plastid division protein CDP1, ch...  70.9    4e-10    Malus domestica [apple tree]
ref|XP_006374279.1|  hypothetical protein POPTR_0015s05630g           70.5    4e-10    
ref|XP_009401118.1|  PREDICTED: plastid division protein CDP1, ch...  70.5    4e-10    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN24502.1|  Plastid division protein CDP1, chloroplastic          70.5    4e-10    Glycine soja [wild soybean]
ref|XP_006376689.1|  hypothetical protein POPTR_0012s033001g          70.1    5e-10    
ref|XP_005850325.1|  hypothetical protein CHLNCDRAFT_50630            70.1    5e-10    Chlorella variabilis
ref|WP_036533714.1|  hypothetical protein                             68.6    5e-10    
ref|WP_015144712.1|  DnaJ-class molecular chaperone with C-termin...  70.1    6e-10    Pleurocapsa minor
gb|KCW57895.1|  hypothetical protein EUGRSUZ_H00644                   69.7    8e-10    Eucalyptus grandis [rose gum]
ref|XP_009355926.1|  PREDICTED: plastid division protein CDP1, ch...  69.7    8e-10    Pyrus x bretschneideri [bai li]
ref|WP_026097405.1|  hypothetical protein                             69.3    1e-09    Geitlerinema sp. PCC 7105
gb|KGN45850.1|  hypothetical protein Csa_6G014700                     68.9    1e-09    Cucumis sativus [cucumbers]
ref|XP_003549173.1|  PREDICTED: plastid division protein CDP1, ch...  68.9    1e-09    Glycine max [soybeans]
ref|XP_007210360.1|  hypothetical protein PRUPE_ppa001548mg           68.6    2e-09    
ref|XP_008240341.1|  PREDICTED: plastid division protein CDP1, ch...  68.2    3e-09    Prunus mume [ume]
ref|XP_003533291.1|  PREDICTED: plastid division protein CDP1, ch...  67.8    3e-09    Glycine max [soybeans]
ref|XP_009392238.1|  PREDICTED: plastid division protein CDP1, ch...  67.4    5e-09    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392236.1|  PREDICTED: plastid division protein CDP1, ch...  67.0    6e-09    Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_011143470.1|  hypothetical protein                             66.6    8e-09    Gloeobacter violaceus
ref|WP_015147268.1|  DnaJ-class molecular chaperone with C-termin...  66.2    1e-08    Oscillatoria acuminata
ref|XP_002514511.1|  conserved hypothetical protein                   64.7    4e-08    
ref|XP_008811229.1|  PREDICTED: plastid division protein CDP1, ch...  64.7    4e-08    Phoenix dactylifera
ref|XP_009145823.1|  PREDICTED: plastid division protein CDP1, ch...  64.3    4e-08    Brassica rapa
emb|CDX99260.1|  BnaC05g33750D                                        64.3    4e-08    
emb|CBI35272.3|  unnamed protein product                              64.3    4e-08    Vitis vinifera
ref|XP_002269313.2|  PREDICTED: plastid division protein CDP1, ch...  64.3    5e-08    Vitis vinifera
gb|EPS72583.1|  hypothetical protein M569_02168                       64.3    5e-08    Genlisea aurea
ref|XP_010663916.1|  PREDICTED: plastid division protein CDP1, ch...  64.3    5e-08    Vitis vinifera
ref|XP_006296994.1|  hypothetical protein CARUB_v10012988mg           63.9    7e-08    Capsella rubella
ref|XP_010940348.1|  PREDICTED: plastid division protein CDP1, ch...  63.9    7e-08    
gb|KHG12616.1|  Plastid division CDP1, chloroplastic -like protein    63.9    7e-08    Gossypium arboreum [tree cotton]
ref|WP_015172812.1|  heat shock protein DnaJ domain-containing pr...  63.2    1e-07    Geitlerinema sp. PCC 7407
ref|XP_005851700.1|  hypothetical protein CHLNCDRAFT_132987           62.8    2e-07    Chlorella variabilis
ref|XP_010546464.1|  PREDICTED: plastid division protein CDP1, ch...  61.2    5e-07    Tarenaya hassleriana [spider flower]
ref|XP_010546465.1|  PREDICTED: plastid division protein CDP1, ch...  61.2    5e-07    Tarenaya hassleriana [spider flower]
gb|KJB46137.1|  hypothetical protein B456_007G350000                  61.2    6e-07    Gossypium raimondii
gb|AFK45889.1|  unknown                                               57.8    9e-07    Lotus japonicus
gb|AAL66980.1|  unknown protein                                       60.5    1e-06    Arabidopsis thaliana [mouse-ear cress]
ref|NP_188549.2|  plastid division protein CDP1                       60.5    1e-06    Arabidopsis thaliana [mouse-ear cress]
gb|AGY57578.1|  DNA polymerase III subunits gamma and tau             59.7    2e-06    Gloeobacter kilaueensis JS1
ref|XP_007152546.1|  hypothetical protein PHAVU_004G139200g           59.7    2e-06    Phaseolus vulgaris [French bean]
ref|WP_016873793.1|  hypothetical protein                             59.7    2e-06    Chlorogloeopsis fritschii
ref|XP_006406529.1|  hypothetical protein EUTSA_v10020089mg           59.3    2e-06    Eutrema salsugineum [saltwater cress]
ref|XP_007029351.1|  ARC6-like protein isoform 2                      58.9    2e-06    
ref|XP_007029350.1|  ARC6-like protein isoform 1                      59.3    2e-06    
ref|XP_010466049.1|  PREDICTED: plastid division protein CDP1, ch...  58.9    3e-06    Camelina sativa [gold-of-pleasure]
ref|XP_006406528.1|  hypothetical protein EUTSA_v10020089mg           58.9    3e-06    
ref|XP_010487843.1|  PREDICTED: plastid division protein CDP1, ch...  58.9    3e-06    Camelina sativa [gold-of-pleasure]
ref|XP_002318349.1|  cell division family protein                     58.9    3e-06    
ref|WP_017717189.1|  hypothetical protein                             58.5    4e-06    Oscillatoria sp. PCC 10802
ref|XP_011003676.1|  PREDICTED: plastid division protein CDP1, ch...  58.5    4e-06    Populus euphratica
ref|XP_011003677.1|  PREDICTED: plastid division protein CDP1, ch...  58.5    4e-06    Populus euphratica
ref|XP_010507485.1|  PREDICTED: plastid division protein CDP1, ch...  58.5    4e-06    Camelina sativa [gold-of-pleasure]
gb|AES76369.2|  plastid division protein CDP1                         58.2    5e-06    Medicago truncatula
ref|XP_011003680.1|  PREDICTED: plastid division protein CDP1, ch...  58.2    5e-06    Populus euphratica
ref|XP_003620151.1|  hypothetical protein MTR_6g077830                58.2    5e-06    
ref|XP_004515279.1|  PREDICTED: plastid division protein CDP1, ch...  58.2    5e-06    Cicer arietinum [garbanzo]
ref|XP_011003678.1|  PREDICTED: plastid division protein CDP1, ch...  58.2    5e-06    Populus euphratica
ref|NP_001045726.2|  Os02g0122400                                     57.4    6e-06    
ref|XP_004301221.2|  PREDICTED: plastid division protein CDP1, ch...  57.8    6e-06    Fragaria vesca subsp. vesca
ref|WP_015784385.1|  molecular chaperone DnaJ                         57.4    8e-06    Cyanothece sp. PCC 8802
ref|WP_036480294.1|  hypothetical protein                             57.4    1e-05    Myxosarcina sp. GI1
ref|WP_012596484.1|  molecular chaperone DnaJ                         57.4    1e-05    Cyanothece sp. PCC 8801
ref|WP_006511601.1|  DnaJ-class molecular chaperone with C-termin...  57.0    1e-05    Xenococcus sp. PCC 7305
ref|XP_010099723.1|  hypothetical protein L484_025156                 56.2    2e-05    
ref|XP_011402294.1|  Protein ACCUMULATION AND REPLICATION OF CHLO...  56.2    2e-05    Auxenochlorella protothecoides
ref|WP_012267063.1|  molecular chaperone DnaJ                         55.5    3e-05    Microcystis aeruginosa
ref|XP_002883164.1|  hypothetical protein ARALYDRAFT_318673           55.5    4e-05    
tpg|DAA35366.1|  TPA: hypothetical protein ZEAMMB73_883312            55.5    4e-05    
ref|XP_008393503.1|  PREDICTED: plastid division protein CDP1, ch...  55.1    5e-05    Malus domestica [apple tree]
ref|WP_002761053.1|  molecular chaperone DnaJ                         55.1    5e-05    Microcystis aeruginosa
ref|WP_012411828.1|  molecular chaperone DnaJ                         55.1    6e-05    Nostoc punctiforme
dbj|GAL93143.1|  cell division protein ZipN/Ftn2/Arc6, specific f...  54.7    6e-05    Microcystis aeruginosa NIES-44
ref|WP_039752682.1|  molecular chaperone DnaJ                         54.7    6e-05    
ref|XP_005648611.1|  hypothetical protein COCSUDRAFT_65723            54.3    8e-05    Coccomyxa subellipsoidea C-169
ref|WP_012597992.1|  molecular chaperone DnaJ                         53.9    1e-04    Cyanothece sp. PCC 7424
ref|WP_002754240.1|  molecular chaperone DnaJ                         53.5    1e-04    Microcystis aeruginosa
ref|WP_023064082.1|  dnaJ domain protein                              53.5    1e-04    Lyngbya aestuarii
ref|WP_004161336.1|  molecular chaperone DnaJ                         53.5    1e-04    
ref|WP_026720628.1|  molecular chaperone DnaJ                         53.5    2e-04    
ref|WP_010472857.1|  molecular chaperone DnaJ                         53.1    2e-04    
ref|WP_002767801.1|  molecular chaperone DnaJ                         53.1    2e-04    
ref|WP_016515469.1|  DnaJ domain protein                              52.8    2e-04    
ref|WP_044106014.1|  hypothetical protein                             52.8    3e-04    
ref|WP_029635770.1|  molecular chaperone DnaJ [                       52.8    3e-04    
dbj|BAB02958.1|  unnamed protein product                              52.4    3e-04    
gb|ELS44827.1|  dnaJ domain protein                                   52.4    4e-04    
ref|WP_036403326.1|  molecular chaperone DnaJ                         52.4    4e-04    
ref|WP_019505817.1|  hypothetical protein                             52.0    4e-04    
ref|WP_017319819.1|  hypothetical protein                             52.0    5e-04    
ref|XP_011398086.1|  hypothetical protein F751_6150                   51.6    5e-04    
ref|WP_024970393.1|  molecular chaperone DnaJ                         52.0    5e-04    
ref|WP_006102761.1|  molecular chaperone DnaJ                         52.0    5e-04    
ref|WP_009756661.1|  molecular chaperone DnaJ                         51.6    6e-04    
ref|WP_016871253.1|  molecular chaperone DnaJ                         51.6    6e-04    
ref|WP_004160335.1|  Genome sequencing data, contig C328              51.6    6e-04    
ref|WP_034937925.1|  hypothetical protein                             51.6    6e-04    
gb|ELR96504.1|  DnaJ-class molecular chaperone with C-terminal Zn...  51.6    7e-04    
ref|WP_024125683.1|  cell division protein ZipN                       51.6    7e-04    
ref|WP_009787236.1|  molecular chaperone DnaJ                         51.2    8e-04    
ref|WP_002791575.1|  molecular chaperone DnaJ                         51.2    9e-04    
ref|WP_002777145.1|  molecular chaperone DnaJ                         51.2    9e-04    
ref|WP_015160491.1|  DnaJ-class molecular chaperone with C-termin...  51.2    9e-04    
ref|WP_042790316.1|  molecular chaperone DnaJ                         51.2    9e-04    
gb|ELP57227.1|  hypothetical protein O53_1840                         51.2    0.001    
ref|WP_012161917.1|  molecular chaperone DnaJ                         50.8    0.001    



>gb|EYU38854.1| hypothetical protein MIMGU_mgv1a001581mg [Erythranthe guttata]
Length=790

 Score =   363 bits (933),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 217/310 (70%), Positives = 246/310 (79%), Gaps = 13/310 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEGVG SP+AAAAAIA+IGA ATAVLDSVKVSAI ALQKV P+G+GE
Sbjct  485  YYDDPTVLRYLERLEGVGSSPVAAAAAIAKIGAGATAVLDSVKVSAIHALQKVFPIGNGE  544

Query  749  TSVRRHG----NSFYTATESDE----LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIK  594
             + R +      S+    +SDE    +  GD      + G  E + SD  EQ+ IT+KIK
Sbjct  545  KTERIYEESEMKSYNLPFDSDETGVRIDQGDTY----VVGINEANRSDGLEQQDITDKIK  600

Query  593  DLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTA-DVVSIGPSKVEVSEEV  417
            D  VKI  AGVAVGLLT++GLKFL  R  SS L+KD  S+V A DV ++G S VE S+E+
Sbjct  601  DATVKIMCAGVAVGLLTILGLKFLPYRNVSSKLQKDTSSAVVASDVTNVGASPVESSDEI  660

Query  416  PRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDY  237
            PRM+ARFAESLV KWQN+KS ALGPDH LEKLSE+LDGQMLK+WT+RAAEIAQHGWFWDY
Sbjct  661  PRMDARFAESLVCKWQNVKSLALGPDHCLEKLSEVLDGQMLKIWTERAAEIAQHGWFWDY  720

Query  236  TLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGW  57
             L NL IDSVTVSVDGRRAIVEATLEESAQLTD A PEH+DSYSTTYTTRYE+SC KSGW
Sbjct  721  QLVNLNIDSVTVSVDGRRAIVEATLEESAQLTDVAKPEHNDSYSTTYTTRYEMSCAKSGW  780

Query  56   RIVEGAVLKS  27
            +IVEGAVLKS
Sbjct  781  KIVEGAVLKS  790



>ref|XP_002262674.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Vitis vinifera]
 emb|CBI37371.3| unnamed protein product [Vitis vinifera]
Length=800

 Score =   358 bits (918),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 209/305 (69%), Positives = 244/305 (80%), Gaps = 7/305 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEGVGGSPLAAAAAIARIGAEATAVLD+VK SAIQALQKV P+  G 
Sbjct  497  YYDDPTVLRYLERLEGVGGSPLAAAAAIARIGAEATAVLDNVKASAIQALQKVFPVDHGN  556

Query  749  TSVRRH----GNSFYTATESDELSHGDKTFPENMAGFAERSPSDD-QEQEMITEKIKDLV  585
             ++RR      NS       + L +  +    N+A   + + SD+  EQ++ITEKIKD  
Sbjct  557  ENLRREDSGINNSVPVVESEEPLQNPARDDSANIAEIPKENSSDEIYEQKLITEKIKDAS  616

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRME  405
            VKI   GV VGL+TLIGLK+L  + +SSILRK+ GS++ +DV ++G   VE SEEVPRM+
Sbjct  617  VKIMCGGVVVGLMTLIGLKYLPAKNNSSILRKEVGSAMASDVTNVG--LVENSEEVPRMD  674

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            ARFAE LVRKWQ+IKSQALGPDH L KL E+LDGQMLK+WTDRAA+IAQHGWFW+YTL N
Sbjct  675  ARFAEGLVRKWQSIKSQALGPDHCLGKLPEVLDGQMLKIWTDRAADIAQHGWFWEYTLLN  734

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVE  45
            LTIDSVTVS+DGRRA+VEATLEESA+LTD  HPEH+DSYSTTYTTRYE+SC  SGW+I E
Sbjct  735  LTIDSVTVSLDGRRAMVEATLEESARLTDTVHPEHNDSYSTTYTTRYEMSCNSSGWKITE  794

Query  44   GAVLK  30
            GAVLK
Sbjct  795  GAVLK  799



>emb|CAN78894.1| hypothetical protein VITISV_009566 [Vitis vinifera]
Length=789

 Score =   354 bits (908),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 210/305 (69%), Positives = 246/305 (81%), Gaps = 7/305 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEGVGGSPLAAAAAIARIGAEATAVLD+VK SAIQALQKV P+  G 
Sbjct  486  YYDDPTVLRYLERLEGVGGSPLAAAAAIARIGAEATAVLDNVKASAIQALQKVFPVDHGN  545

Query  749  TSVRRHG---NSFYTATESDE-LSHGDKTFPENMAGFAERSPSDD-QEQEMITEKIKDLV  585
             ++RR     N+     ES+E L +  +    N+A   + + SD+  EQ++ITEKIKD  
Sbjct  546  ENLRREDSGINNSVPVVESEEPLQNPARDDSANIAEIPKENSSDEIYEQKLITEKIKDAS  605

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRME  405
            VKI   GV VGL+TLIGLK+L  + +SSILRK+ GS++ +DV ++G   VE SEEVPRM+
Sbjct  606  VKIMCGGVVVGLMTLIGLKYLPAKNNSSILRKEVGSAMASDVTNVG--LVENSEEVPRMD  663

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            ARFAE LVRKWQ+IKSQALGPDH L KL E+LDGQMLK+WTDRAA+IAQHGWFW+YTL N
Sbjct  664  ARFAEGLVRKWQSIKSQALGPDHCLGKLPEVLDGQMLKIWTDRAADIAQHGWFWEYTLLN  723

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVE  45
            LTIDSVTVS+DGRRA+VEATLEESA+LTD  H EH+DSYSTTYTTRYE+SC  SGW+I E
Sbjct  724  LTIDSVTVSLDGRRAMVEATLEESARLTDTXHQEHNDSYSTTYTTRYEMSCNNSGWKITE  783

Query  44   GAVLK  30
            GAVLK
Sbjct  784  GAVLK  788



>ref|XP_009767345.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Nicotiana sylvestris]
Length=816

 Score =   352 bits (902),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 217/306 (71%), Positives = 240/306 (78%), Gaps = 5/306 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG G SPLAAAAAIARIGAEATAVLDSVK SAIQALQKV P GDGE
Sbjct  510  YYDDPTVLRYLERLEGGGASPLAAAAAIARIGAEATAVLDSVKASAIQALQKVFPAGDGE  569

Query  749  TSVRRHG----NSFYTATE-SDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLV  585
             SVRR+G    N F  A    D +   D+          ER PS  QEQ+MIT+KIKD  
Sbjct  570  GSVRRYGDNEMNEFDIAKPFEDPVELRDQNNFITSVEDPERVPSGYQEQDMITDKIKDAT  629

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRME  405
            VKI  AGVAVG LTL+GLK  S +  SS+LR   GS++ +DV+++G + VE   EVPRM+
Sbjct  630  VKIMCAGVAVGFLTLVGLKLSSFKHGSSVLRNGTGSAIASDVINVGATLVENPLEVPRMD  689

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            AR AES+VR WQNIKSQ+LGPDH L KLSE+LDGQMLK+WTDRA EIAQHGWFWDY L N
Sbjct  690  ARLAESMVRMWQNIKSQSLGPDHCLNKLSEVLDGQMLKIWTDRATEIAQHGWFWDYELLN  749

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVE  45
            LTIDSVTVSVDGRRAIVEATLEESA LTD AHPEH+DSYSTTYTTRYE+S   SGW+IVE
Sbjct  750  LTIDSVTVSVDGRRAIVEATLEESASLTDMAHPEHNDSYSTTYTTRYEMSWANSGWKIVE  809

Query  44   GAVLKS  27
            GAVLKS
Sbjct  810  GAVLKS  815



>ref|XP_009587872.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Nicotiana tomentosiformis]
Length=817

 Score =   343 bits (880),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 213/306 (70%), Positives = 238/306 (78%), Gaps = 5/306 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG G SPLAAAAAIARIGAEATAVLDSVK SAIQALQKV P GDGE
Sbjct  511  YYDDPTVLRYLERLEGGGASPLAAAAAIARIGAEATAVLDSVKASAIQALQKVFPAGDGE  570

Query  749  TSVRRHG----NSFYTATE-SDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLV  585
             SVRR+G    N F  A    D +   D+          ER PS  QEQ+MIT+KIKD  
Sbjct  571  GSVRRYGDNEMNEFDIAKPFEDPVELRDQNNFITSVEDPERIPSGYQEQDMITDKIKDAT  630

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRME  405
            +KI  AGVAVG LTL+GLK  S +  SS+ R   GS++ ++V+++G + VE   EVPRM+
Sbjct  631  MKIMCAGVAVGFLTLVGLKLSSFKHGSSVRRNGIGSAIASNVINVGATLVENPLEVPRMD  690

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            AR AES+VR WQNIKSQ+LGPDH L KLSE+LDGQMLK+WTDRA EIAQHGWFWDY L N
Sbjct  691  ARLAESMVRMWQNIKSQSLGPDHCLNKLSEVLDGQMLKIWTDRATEIAQHGWFWDYELLN  750

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVE  45
            LTIDSVTVSVDGRRAIVEATLEESA LTD  HPEH+DSYSTTYTTRYE+S   SGW+IVE
Sbjct  751  LTIDSVTVSVDGRRAIVEATLEESASLTDIVHPEHNDSYSTTYTTRYEMSWANSGWKIVE  810

Query  44   GAVLKS  27
            GAVLKS
Sbjct  811  GAVLKS  816



>emb|CDP07437.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   343 bits (879),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 202/307 (66%), Positives = 237/307 (77%), Gaps = 6/307 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDD  VLRYLERLEG G SPLAAAAAIA++GAEATAVLDSVK SAIQALQKV PLG  +
Sbjct  509  YYDDSTVLRYLERLEGRGRSPLAAAAAIAKLGAEATAVLDSVKFSAIQALQKVFPLGPSD  568

Query  749  TSVRRHG----NSFYTATESDELSHGDK-TFPENMAGFAERSPSDD-QEQEMITEKIKDL  588
             SV+        S   A ES+E +  +      N     +R   D+  EQE ITE+IK+ 
Sbjct  569  RSVKTDEEFEIKSSEVAGESEEPTRPNNWDDSSNTGVLPDRQEYDELHEQEQITEEIKET  628

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRM  408
            +VKI  AGVAVGLL L GLKF+ +R   S LRKD GS++ +DV+++G S  E   ++PRM
Sbjct  629  IVKIMCAGVAVGLLALFGLKFIPSRHGMSTLRKDAGSAIESDVINVGASVDEKDVKIPRM  688

Query  407  EARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQ  228
            +AR AE+LVRKWQNIKS+ALGPDH LEKLSE+LDGQMLK+WTDR AEIAQHGWFW + L 
Sbjct  689  DARLAENLVRKWQNIKSEALGPDHCLEKLSEVLDGQMLKIWTDRGAEIAQHGWFWQHMLL  748

Query  227  NLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIV  48
            NL IDSVTVSVDG+RAIVEATLEESAQLTD AHPEH+DSY++ YTTRYE+SC KSGW+I 
Sbjct  749  NLNIDSVTVSVDGQRAIVEATLEESAQLTDVAHPEHNDSYNSIYTTRYEMSCTKSGWKIT  808

Query  47   EGAVLKS  27
            EGAVLK+
Sbjct  809  EGAVLKA  815



>ref|XP_011083887.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic, partial [Sesamum indicum]
Length=747

 Score =   335 bits (859),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 241/305 (79%), Gaps = 6/305 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERL G G SPLAAAAAIARIGAEATAVLD+VK SAIQALQKV PL  GE
Sbjct  445  YYDDPTVLRYLERLGGAGRSPLAAAAAIARIGAEATAVLDNVKASAIQALQKVFPLRTGE  504

Query  749  TSVRRHG----NSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVV  582
             +VR +     NS+     S+E          NM G   RS    QE E+IT+KIKD  V
Sbjct  505  KNVRLYEESEMNSYDLPVASEETGVRPDQDDSNMFG-VPRSNGLHQE-EIITDKIKDATV  562

Query  581  KITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEA  402
            KI  AGVAVGLLTL+GL+FL  R DSS L KD G+SV +DV+++G S VE ++E+PRM+A
Sbjct  563  KIMCAGVAVGLLTLLGLRFLPYRNDSSNLHKDAGTSVASDVINVGASLVENTDEIPRMDA  622

Query  401  RFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNL  222
            RFAESLV KWQ++KS ALGPDH L KLSE+LDGQMLK+WTDRAAEIAQHGWFW+Y L NL
Sbjct  623  RFAESLVLKWQSVKSLALGPDHCLGKLSEVLDGQMLKIWTDRAAEIAQHGWFWNYQLLNL  682

Query  221  TIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEG  42
             IDSVTVS DGRRAIVEATLEESAQLTD AHPEH+DSYS TYTTRYE+SC KSGW+IV+G
Sbjct  683  NIDSVTVSADGRRAIVEATLEESAQLTDVAHPEHNDSYSITYTTRYEMSCAKSGWKIVDG  742

Query  41   AVLKS  27
            AVLKS
Sbjct  743  AVLKS  747



>ref|XP_010271467.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Nelumbo nucifera]
Length=803

 Score =   328 bits (840),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 200/308 (65%), Positives = 238/308 (77%), Gaps = 13/308 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigae-atAVLDSVKVSAIQALQKVIPLGDG  753
            YYDDP VLRYLER+EGVGGSPLAAAAAIARIGAE  TAVLD+VK SA+ ALQKV P+G+ 
Sbjct  502  YYDDPTVLRYLERMEGVGGSPLAAAAAIARIGAEATTAVLDNVKASAMLALQKVFPVGNK  561

Query  752  ETSVRRH----GNSFYTATESDELSHGDKTFPENMAGFAE--RSPSDDQEQEMITEKIKD  591
            E  +R+      ++F +A ES E    DK   EN     E     S + +++ +TEKIKD
Sbjct  562  EGRMRKEEDYDNSAFVSAIESVE--PDDKPNGENSGSSEEVYEKMSYNTDKQWMTEKIKD  619

Query  590  LVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPR  411
              VKI  AGV VGL+TL GLK+L  R  S +L++D  S + AD +S+    VE   ++PR
Sbjct  620  ASVKIMCAGVVVGLVTLAGLKYLPTRNGSLVLQRDT-SVMAADAISLDEKAVE---DMPR  675

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+ARFAESLVR+WQNIKSQALGPDHRL KL EILDGQMLK+WTDRAAEIAQHGWFW+YTL
Sbjct  676  MDARFAESLVRQWQNIKSQALGPDHRLSKLPEILDGQMLKIWTDRAAEIAQHGWFWEYTL  735

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
              LTIDSVTVS+DGRRA+VEATLEE A+LTD  HPEH+DSY+TTYTTRYE+SC +SGW+I
Sbjct  736  LGLTIDSVTVSLDGRRALVEATLEEEARLTDMVHPEHNDSYNTTYTTRYEMSCSRSGWKI  795

Query  50   VEGAVLKS  27
             EGAVLK+
Sbjct  796  TEGAVLKA  803



>ref|NP_001265966.1| Hop-interacting protein THI044 [Solanum lycopersicum]
 gb|AEW69805.1| Hop-interacting protein THI044 [Solanum lycopersicum]
Length=819

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 206/310 (66%), Positives = 235/310 (76%), Gaps = 9/310 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG G SPLAAAAAIARIGAEATAVLDSVK SAIQALQKV P GDGE
Sbjct  509  YYDDPTVLRYLERLEGGGASPLAAAAAIARIGAEATAVLDSVKASAIQALQKVFPAGDGE  568

Query  749  TSVRRHG----NSFYTATESDELSH-GDKTFPENMAGFAERSPSDDQEQEMITEKIKDLV  585
             SVRR+G    N F  A   ++L    D+       G  ER  S+ QEQ++IT++IKD  
Sbjct  569  GSVRRYGDNEMNEFDIAKPFEDLEELRDQNNFITTVGDPERKSSNYQEQDVITDRIKDAS  628

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSI--LRKDDGSSVTADVVSI--GPSKVEVSEEV  417
            +KI  AGVAVG  TL+GLK  S R  SS+       GS++ +DV+++    S VE   EV
Sbjct  629  LKIMCAGVAVGFFTLVGLKLSSFRHGSSVQHCASATGSAIASDVINVDTSASPVENPLEV  688

Query  416  PRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDY  237
            PRM+AR AES+VRKWQNIKSQ+LG DH L +LSE+LDGQMLK+WTDRA EIAQHGWFW+Y
Sbjct  689  PRMDARLAESIVRKWQNIKSQSLGTDHCLNRLSEVLDGQMLKIWTDRAREIAQHGWFWEY  748

Query  236  TLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGW  57
             L NL IDSVTVS DGRRA VEATLEESA LTD AHPEH+DSYSTTYTTRY++S   SGW
Sbjct  749  KLLNLAIDSVTVSADGRRATVEATLEESASLTDVAHPEHNDSYSTTYTTRYDMSWANSGW  808

Query  56   RIVEGAVLKS  27
            +IVEGAVLKS
Sbjct  809  KIVEGAVLKS  818



>ref|XP_006342010.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X2 [Solanum tuberosum]
Length=818

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 205/310 (66%), Positives = 235/310 (76%), Gaps = 9/310 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG G SPLAAAAAIARIGAEATAVLDSVK SAIQALQKV P GDGE
Sbjct  508  YYDDPTVLRYLERLEGGGASPLAAAAAIARIGAEATAVLDSVKASAIQALQKVFPAGDGE  567

Query  749  TSVRRHG----NSFYTATESDELSH-GDKTFPENMAGFAERSPSDDQEQEMITEKIKDLV  585
             SVRR+G    N F  A   ++L    D+       G  ER  S+ QEQ++IT++IKD  
Sbjct  568  GSVRRYGDNEMNEFDIAKPFEDLGELRDQNNFITTVGDPERKSSNYQEQDVITDRIKDAS  627

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDD--GSSVTADVVSI--GPSKVEVSEEV  417
            VKI  AGVA+G LTL+GLK  S R  SS+       GS++ +DV+++    S VE   EV
Sbjct  628  VKIMCAGVAIGFLTLVGLKLSSFRHGSSVQHSASATGSAIASDVINVDASASPVENPLEV  687

Query  416  PRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDY  237
            PRM+AR AES+VRKWQNIKSQ+LG DH L +LSE+LDGQMLK+WTDRA EIAQHGWFW+Y
Sbjct  688  PRMDARLAESIVRKWQNIKSQSLGTDHCLNRLSEVLDGQMLKIWTDRATEIAQHGWFWEY  747

Query  236  TLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGW  57
             L NL IDSVTVS DGRRA VEATLEESA LTD AHPE++DSYST YTTRY++S   SGW
Sbjct  748  KLLNLAIDSVTVSADGRRATVEATLEESASLTDVAHPENNDSYSTIYTTRYDMSWANSGW  807

Query  56   RIVEGAVLKS  27
            +IVEGAVLKS
Sbjct  808  KIVEGAVLKS  817



>ref|XP_010320044.1| PREDICTED: hop-interacting protein THI044 isoform X1 [Solanum 
lycopersicum]
Length=826

 Score =   320 bits (819),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 206/317 (65%), Positives = 235/317 (74%), Gaps = 16/317 (5%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG G SPLAAAAAIARIGAEATAVLDSVK SAIQALQKV P GDGE
Sbjct  509  YYDDPTVLRYLERLEGGGASPLAAAAAIARIGAEATAVLDSVKASAIQALQKVFPAGDGE  568

Query  749  TSVRRHG----NSFYTATESDELSH-GDKTFPENMAGFAERSPSDDQEQEMITEKIKDLV  585
             SVRR+G    N F  A   ++L    D+       G  ER  S+ QEQ++IT++IKD  
Sbjct  569  GSVRRYGDNEMNEFDIAKPFEDLEELRDQNNFITTVGDPERKSSNYQEQDVITDRIKDAS  628

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSI--LRKDDGSSVTADVVSI---------GPSK  438
            +KI  AGVAVG  TL+GLK  S R  SS+       GS++ +DV+++           S 
Sbjct  629  LKIMCAGVAVGFFTLVGLKLSSFRHGSSVQHCASATGSAIASDVINVEILSATADTSASP  688

Query  437  VEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQ  258
            VE   EVPRM+AR AES+VRKWQNIKSQ+LG DH L +LSE+LDGQMLK+WTDRA EIAQ
Sbjct  689  VENPLEVPRMDARLAESIVRKWQNIKSQSLGTDHCLNRLSEVLDGQMLKIWTDRAREIAQ  748

Query  257  HGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYEL  78
            HGWFW+Y L NL IDSVTVS DGRRA VEATLEESA LTD AHPEH+DSYSTTYTTRY++
Sbjct  749  HGWFWEYKLLNLAIDSVTVSADGRRATVEATLEESASLTDVAHPEHNDSYSTTYTTRYDM  808

Query  77   SCGKSGWRIVEGAVLKS  27
            S   SGW+IVEGAVLKS
Sbjct  809  SWANSGWKIVEGAVLKS  825



>ref|XP_006342009.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X1 [Solanum tuberosum]
Length=825

 Score =   319 bits (818),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 205/317 (65%), Positives = 235/317 (74%), Gaps = 16/317 (5%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG G SPLAAAAAIARIGAEATAVLDSVK SAIQALQKV P GDGE
Sbjct  508  YYDDPTVLRYLERLEGGGASPLAAAAAIARIGAEATAVLDSVKASAIQALQKVFPAGDGE  567

Query  749  TSVRRHG----NSFYTATESDELSH-GDKTFPENMAGFAERSPSDDQEQEMITEKIKDLV  585
             SVRR+G    N F  A   ++L    D+       G  ER  S+ QEQ++IT++IKD  
Sbjct  568  GSVRRYGDNEMNEFDIAKPFEDLGELRDQNNFITTVGDPERKSSNYQEQDVITDRIKDAS  627

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDD--GSSVTADVVSI---------GPSK  438
            VKI  AGVA+G LTL+GLK  S R  SS+       GS++ +DV+++           S 
Sbjct  628  VKIMCAGVAIGFLTLVGLKLSSFRHGSSVQHSASATGSAIASDVINVEILSATADASASP  687

Query  437  VEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQ  258
            VE   EVPRM+AR AES+VRKWQNIKSQ+LG DH L +LSE+LDGQMLK+WTDRA EIAQ
Sbjct  688  VENPLEVPRMDARLAESIVRKWQNIKSQSLGTDHCLNRLSEVLDGQMLKIWTDRATEIAQ  747

Query  257  HGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYEL  78
            HGWFW+Y L NL IDSVTVS DGRRA VEATLEESA LTD AHPE++DSYST YTTRY++
Sbjct  748  HGWFWEYKLLNLAIDSVTVSADGRRATVEATLEESASLTDVAHPENNDSYSTIYTTRYDM  807

Query  77   SCGKSGWRIVEGAVLKS  27
            S   SGW+IVEGAVLKS
Sbjct  808  SWANSGWKIVEGAVLKS  824



>ref|XP_007017697.1| Chaperone DnaJ-domain superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY14922.1| Chaperone DnaJ-domain superfamily protein isoform 2 [Theobroma 
cacao]
Length=797

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 225/310 (73%), Gaps = 12/310 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEGVGGSPLAAAAAI RIGAEATAVLD VK SAIQALQKV PL   E
Sbjct  491  YYDDPTVLRYLERLEGVGGSPLAAAAAIVRIGAEATAVLDHVKASAIQALQKVFPLRSAE  550

Query  749  TSVRRH-----GNSFYTATESDELSHGDKTFPENMAGFAE----RSPSDDQEQEMITEKI  597
             SVR        N F+     + L   D   PE+ A  AE     S  +  E+E IT+KI
Sbjct  551  ESVRHQLDGEMSNIFHAVENEETLGKPD---PEDSAVLAEIPGKSSLEEMHEEETITDKI  607

Query  596  KDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEV  417
            KD  VKI SA V +GL+TL+GLK L  R+ SS++RK+   +++++V +IG       +E+
Sbjct  608  KDASVKIMSASVVIGLMTLVGLKVLPGRSSSSVIRKEISPAMSSNVSNIGSVDENSLQEL  667

Query  416  PRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDY  237
            PR++AR AE +VR+WQN+KSQA GPDH L+KL E+LDGQMLK WTDRAAEIAQ GW ++Y
Sbjct  668  PRIDARIAEGIVRRWQNVKSQAFGPDHCLDKLPEVLDGQMLKTWTDRAAEIAQLGWTYEY  727

Query  236  TLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGW  57
            +L +L IDSVT+S+DG+RA+VEATLEES  LTD  HPE++ S   +YTTRYE+S  KSGW
Sbjct  728  SLLSLAIDSVTLSLDGQRAVVEATLEESTCLTDVHHPENNASNVQSYTTRYEMSSTKSGW  787

Query  56   RIVEGAVLKS  27
            +I EG+V KS
Sbjct  788  KITEGSVFKS  797



>ref|XP_007017696.1| Chaperone DnaJ-domain superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY14921.1| Chaperone DnaJ-domain superfamily protein isoform 1 [Theobroma 
cacao]
Length=813

 Score =   311 bits (796),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 225/310 (73%), Gaps = 12/310 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEGVGGSPLAAAAAI RIGAEATAVLD VK SAIQALQKV PL   E
Sbjct  507  YYDDPTVLRYLERLEGVGGSPLAAAAAIVRIGAEATAVLDHVKASAIQALQKVFPLRSAE  566

Query  749  TSVRRH-----GNSFYTATESDELSHGDKTFPENMAGFAE----RSPSDDQEQEMITEKI  597
             SVR        N F+     + L   D   PE+ A  AE     S  +  E+E IT+KI
Sbjct  567  ESVRHQLDGEMSNIFHAVENEETLGKPD---PEDSAVLAEIPGKSSLEEMHEEETITDKI  623

Query  596  KDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEV  417
            KD  VKI SA V +GL+TL+GLK L  R+ SS++RK+   +++++V +IG       +E+
Sbjct  624  KDASVKIMSASVVIGLMTLVGLKVLPGRSSSSVIRKEISPAMSSNVSNIGSVDENSLQEL  683

Query  416  PRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDY  237
            PR++AR AE +VR+WQN+KSQA GPDH L+KL E+LDGQMLK WTDRAAEIAQ GW ++Y
Sbjct  684  PRIDARIAEGIVRRWQNVKSQAFGPDHCLDKLPEVLDGQMLKTWTDRAAEIAQLGWTYEY  743

Query  236  TLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGW  57
            +L +L IDSVT+S+DG+RA+VEATLEES  LTD  HPE++ S   +YTTRYE+S  KSGW
Sbjct  744  SLLSLAIDSVTLSLDGQRAVVEATLEESTCLTDVHHPENNASNVQSYTTRYEMSSTKSGW  803

Query  56   RIVEGAVLKS  27
            +I EG+V KS
Sbjct  804  KITEGSVFKS  813



>ref|XP_008221317.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Prunus mume]
Length=799

 Score =   308 bits (790),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 227/313 (73%), Gaps = 17/313 (5%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERL+G  GSPLAAAAAI RIGAEATAVLD+ K SA+QALQKV PLG  +
Sbjct  492  YYDDPTVLRYLERLDGTNGSPLAAAAAIVRIGAEATAVLDNFKASALQALQKVFPLGYRD  551

Query  749  TSVRRHGNSFYTAT-------ESDELSHGDKTFPENMAGFAERSPSDD----QEQEMITE  603
             +V+R  +     +       ES E S GD +        AE S  DD    +E+E+IT+
Sbjct  552  ENVQRQEDHEMNYSLLPVETGESLEESDGDDS-----VHVAEVSGRDDSVGLREEELITD  606

Query  602  KIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS-  426
            KIKD  VKI  AGV +GL+TL GL++L  R  SS L K+  S   +DV S G   VE S 
Sbjct  607  KIKDASVKIMCAGVVIGLMTLAGLRYLPARKGSSNLHKELSSVTASDVASAGLPGVEKSA  666

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
            EE+P+M+AR AE LVRKWQNIKSQA GP+H +E LSE+LDG+MLK+WTDRA EIAQ  W 
Sbjct  667  EELPKMDARIAEGLVRKWQNIKSQAFGPNHSVESLSEVLDGEMLKIWTDRATEIAQLNWS  726

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            +DY+L NL+IDSVTVS+DG+RA+VEATLEE AQLTD  HPEH+ S + TYTTRYE+SC  
Sbjct  727  YDYSLLNLSIDSVTVSLDGQRAVVEATLEELAQLTDVLHPEHNASNNRTYTTRYEMSCSS  786

Query  65   SGWRIVEGAVLKS  27
            SGW+I EGAVL+S
Sbjct  787  SGWKISEGAVLQS  799



>gb|KHG01462.1| accumulation and replication of chloroplasts 6, chloroplastic 
-like protein [Gossypium arboreum]
Length=795

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 181/309 (59%), Positives = 221/309 (72%), Gaps = 11/309 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG GGSPLAAAAAI RIGAEATAVLD VK SAIQALQKV PL   E
Sbjct  490  YYDDPTVLRYLERLEGAGGSPLAAAAAIVRIGAEATAVLDHVKASAIQALQKVFPLRRSE  549

Query  749  TSVRRH----GNSFYTATESDELSHGDKTFPENMAGFAE----RSPSDDQEQEMITEKIK  594
             + R       N+F      + L   D+   E+ A  AE     S     E+E I++KIK
Sbjct  550  ETARHQLDGEMNNFLPVESEETLGKPDQ---EDSAILAEVPGISSLEGMYEEETISDKIK  606

Query  593  DLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVP  414
            D  VKI SAGV +G++TL+GLKFLS +  SS+  K    ++  DV+++G    +  +E P
Sbjct  607  DASVKIMSAGVVIGVMTLVGLKFLSGKFSSSVTGKGISPAMATDVINVGSVDEKSLQEFP  666

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            RM+AR AE +VRKWQNIKS+A GPDHRL+KL E+LDGQMLK WTDRAAEIAQ GW ++Y+
Sbjct  667  RMDARIAEGIVRKWQNIKSEAFGPDHRLDKLPEVLDGQMLKTWTDRAAEIAQLGWVYEYS  726

Query  233  LQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWR  54
            L N+ IDSVT+S+DG+RA+VEATLEES  LTD  HPE++ S   +YTTRYE+SC  SGW+
Sbjct  727  LLNMAIDSVTLSLDGQRAVVEATLEESTCLTDVHHPENNASNVNSYTTRYEMSCSNSGWK  786

Query  53   IVEGAVLKS  27
            I EG+V KS
Sbjct  787  ITEGSVYKS  795



>ref|XP_006435105.1| hypothetical protein CICLE_v100003722mg, partial [Citrus clementina]
 gb|ESR48345.1| hypothetical protein CICLE_v100003722mg, partial [Citrus clementina]
Length=489

 Score =   298 bits (764),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 177/304 (58%), Positives = 219/304 (72%), Gaps = 7/304 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiari-gaeatAVLDSVKVSAIQALQKVIPLGDG  753
            YYDDP VLRYLERLEG G SPLAAAAAI RI   EATAVLD VK S IQALQKV PLG G
Sbjct  181  YYDDPTVLRYLERLEGNGSSPLAAAAAIVRIGATEATAVLDHVKSSTIQALQKVFPLGQG  240

Query  752  ETSVR--RHGNSF--YTATESDE-LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
            + +V+   HG ++      E++E L+     F      +   S  D   ++ IT+KIKD+
Sbjct  241  DKAVKYVEHGETYDPVPVVETEESLTSDQNNFAFTTDAYGTSSSDDIHGEQSITDKIKDV  300

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVE-VSEEVPR  411
             VKI  AGVA+GL+TL+GLK+L  R  SS+ +K+ G +  +D++  GP   E + +E+PR
Sbjct  301  GVKIMCAGVAIGLITLVGLKYLPARNISSVQQKEIGLAKASDIIDAGPLLDEKLGQELPR  360

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+AR AE +VRKWQNIKSQA GPDH L KL E+LDGQMLKVWTDRA+EIAQ GW +DY+L
Sbjct  361  MDARLAEDIVRKWQNIKSQAFGPDHSLGKLPEVLDGQMLKVWTDRASEIAQLGWIYDYSL  420

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
             NLTIDSVT+S +GR A VEAT++ESA+LTD  HPE+ D   +TYT RYELS  KSGWRI
Sbjct  421  LNLTIDSVTLSQEGRHAWVEATVKESARLTDTVHPENCDEKISTYTARYELSSTKSGWRI  480

Query  50   VEGA  39
             +G+
Sbjct  481  TDGS  484



>gb|KDO84750.1| hypothetical protein CISIN_1g003752mg [Citrus sinensis]
Length=502

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 220/304 (72%), Gaps = 7/304 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiari-gaeatAVLDSVKVSAIQALQKVIPLGDG  753
            YYDDP VLRYLERLEG G SPLAAAAAI RI   EATAVLD VK S IQALQKV PLG G
Sbjct  194  YYDDPTVLRYLERLEGNGSSPLAAAAAIVRIGATEATAVLDHVKSSTIQALQKVFPLGQG  253

Query  752  ETSVR--RHGNSF--YTATESDE-LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
            + +V+   HG ++      E++E L+     F      +   S  D   ++ IT+KIKD+
Sbjct  254  DKAVKYVEHGETYDPVPVVETEESLTSDQNNFAFTTDAYGTSSSDDIHGEQSITDKIKDV  313

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVE-VSEEVPR  411
             VKI  AGVA+GL+TL+GLK+L  R  SS+ +K+ G +  +D++  GP   E + +E+PR
Sbjct  314  SVKIMCAGVAIGLVTLVGLKYLPTRNISSVQQKEIGLAKASDIIDAGPLLDEKLGQELPR  373

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+AR AE +VRKWQNIKSQA GPDH L KL E+LDGQMLKVWTDRA+EIAQ GW +DY+L
Sbjct  374  MDARLAEDIVRKWQNIKSQAFGPDHSLGKLPEVLDGQMLKVWTDRASEIAQLGWTYDYSL  433

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
             NLTIDSVT+S +GR A VEAT++ESA+LTD  HPE+ D   +TYTTRYELS  KSGWRI
Sbjct  434  LNLTIDSVTLSQEGRHAWVEATVKESARLTDTVHPENCDEKISTYTTRYELSSTKSGWRI  493

Query  50   VEGA  39
             +G+
Sbjct  494  TDGS  497



>gb|KJB58153.1| hypothetical protein B456_009G196600 [Gossypium raimondii]
Length=795

 Score =   305 bits (781),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 180/309 (58%), Positives = 221/309 (72%), Gaps = 11/309 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG GGSPLAAAAAI RIGAEATAVLD VK SAIQALQKV PL   E
Sbjct  490  YYDDPTVLRYLERLEGAGGSPLAAAAAIVRIGAEATAVLDHVKASAIQALQKVFPLRRSE  549

Query  749  TSVRRH----GNSFYTATESDELSHGDKTFPENMAGFAE----RSPSDDQEQEMITEKIK  594
             + R       N+F      + L   D+   E+ A  AE     S     E+E I++KIK
Sbjct  550  ETARHQLDGEMNNFLPVESEETLGKPDQ---EDSAILAEVPGISSLEGMYEEETISDKIK  606

Query  593  DLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVP  414
            D  VKI SAGV +G++TL+GLKFLS +  SS+  K    ++  DV+++G    +  +E+P
Sbjct  607  DASVKIMSAGVVIGVMTLVGLKFLSGKFSSSVTGKGISPAMATDVINVGSVDEKSLQELP  666

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            RM+AR AE +VRKWQNIKS+A GPDHRL+KL E+LDGQMLK WTDRAAEIAQ GW ++Y+
Sbjct  667  RMDARIAEGIVRKWQNIKSEAFGPDHRLDKLPEVLDGQMLKTWTDRAAEIAQLGWVYEYS  726

Query  233  LQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWR  54
            L N+ IDSVT+S+DG+RA+VEATLEES  LTD  H E++ S   +YTTRYE+SC  SGW+
Sbjct  727  LLNMAIDSVTLSLDGQRAVVEATLEESTCLTDVHHSENNASNVNSYTTRYEMSCSNSGWK  786

Query  53   IVEGAVLKS  27
            I EG+V KS
Sbjct  787  ITEGSVYKS  795



>ref|XP_009335546.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Pyrus x bretschneideri]
Length=790

 Score =   305 bits (781),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 183/318 (58%), Positives = 222/318 (70%), Gaps = 27/318 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERL+G  GSPLAAAAAI  IGAEATAVL + K SAIQALQKV P G   
Sbjct  483  YYDDPTVLRYLERLDGTNGSPLAAAAAIVNIGAEATAVLGNFKASAIQALQKVFPPG---  539

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDD----------------QEQ  618
                 H +   T  E +E+++     P       E S  D+                +E+
Sbjct  540  -----HRDENLTPQEDNEMNYA--FLPVENGEPLEESDGDESVHVPEVSGRNGSVGIREE  592

Query  617  EMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIG-PS  441
            E++T+KIKD  VKI  AGV +GL TLIGL++L  R  SS L K+  ++  +DV S G P 
Sbjct  593  ELMTDKIKDATVKIMCAGVVIGLTTLIGLRYLPARRGSSNLHKELSTATASDVTSAGLPG  652

Query  440  KVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIA  261
              + +EE+P+M+AR AE LVRKWQNIKSQA GP+H LEKLSE+LDG+MLK+WTDRA EIA
Sbjct  653  DEKSAEEIPKMDARIAEGLVRKWQNIKSQAFGPNHSLEKLSEVLDGEMLKIWTDRATEIA  712

Query  260  QHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYE  81
            Q  W +DYTL NL+IDSVTVS+DG+RA+VEATLEE AQLTD  HPEH+DS   TYTTRYE
Sbjct  713  QLNWSYDYTLLNLSIDSVTVSLDGQRAVVEATLEEMAQLTDVLHPEHNDSNRRTYTTRYE  772

Query  80   LSCGKSGWRIVEGAVLKS  27
            +SC  SGW+I+EGAVL+S
Sbjct  773  MSCSSSGWKIIEGAVLQS  790



>ref|XP_007227000.1| hypothetical protein PRUPE_ppa001578mg [Prunus persica]
 gb|EMJ28199.1| hypothetical protein PRUPE_ppa001578mg [Prunus persica]
Length=799

 Score =   305 bits (780),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 189/314 (60%), Positives = 227/314 (72%), Gaps = 18/314 (6%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERL+G  GSPLAAAAAI RIGAEATAVLD+ + SA+QALQKV PLG  +
Sbjct  491  YYDDPTVLRYLERLDGTNGSPLAAAAAIVRIGAEATAVLDNFRASALQALQKVFPLGYRD  550

Query  749  TSVRRHGNSFYTAT-------ESDELSHGDKTFPENMAGFAERSPSDD----QEQEMITE  603
             +V+R  +     +       ES E S GD +        AE S  DD    +E+E+IT+
Sbjct  551  ENVQRQEDHEMNYSLLPVETGESLEESDGDDS-----VHVAEVSGRDDSVGIREEELITD  605

Query  602  KIKDLVVKITSAGVAVGLLTLIG-LKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            KIKD  VKI  AGV +GL+TL G L++L  R  SS L K+  S   +DV S G   VE S
Sbjct  606  KIKDASVKIMCAGVVIGLMTLAGGLRYLPGRKGSSNLHKELSSVTASDVASAGLPGVEKS  665

Query  425  -EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGW  249
             EE+P+M+AR AE LVRKWQNIKSQA GP+H +E LSE+LDG+MLK+WTDRA EIAQ  W
Sbjct  666  AEELPKMDARIAEGLVRKWQNIKSQAFGPNHSVESLSEVLDGEMLKIWTDRATEIAQLNW  725

Query  248  FWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCG  69
             +DYTL NL+IDSVTVS+DG+RA+VEATLEE AQLTD  HPEH+ S + TYTTRYE+SC 
Sbjct  726  SYDYTLLNLSIDSVTVSLDGQRAVVEATLEELAQLTDVLHPEHNASNNRTYTTRYEMSCS  785

Query  68   KSGWRIVEGAVLKS  27
             SGW+I EGAVL+S
Sbjct  786  SSGWKISEGAVLQS  799



>ref|XP_004291818.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Fragaria vesca subsp. vesca]
Length=783

 Score =   302 bits (773),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 186/317 (59%), Positives = 225/317 (71%), Gaps = 29/317 (9%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERL+G  GSPLAAAAAI RIGAEATAVLDSVK SAIQAL+KV PLG   
Sbjct  480  YYDDPTVLRYLERLDGTNGSPLAAAAAIVRIGAEATAVLDSVKTSAIQALRKVFPLG---  536

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQ----------------EQ  618
               +R+ N   T  E  E+++     PE+     E S  DD                 ++
Sbjct  537  ---QRYKN--MTPQEDHEMNYS--LLPEDSGDPVEESYEDDSIRVAEVSGRDGSVDTLKE  589

Query  617  EMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSK  438
            E ITE+IKD  +KI  AGV +GL+T  GLK+L  R+ SS +RK+  S  T++V S   S 
Sbjct  590  ESITEQIKDASLKIMCAGVVIGLMTFAGLKYLPGRSSSSSIRKELASVTTSEVTS---SD  646

Query  437  VEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQ  258
            V+ + E+P+M+A+ AE LVRKWQNIKSQA GP H ++KLSE+LDG+MLK+WTDRA EIAQ
Sbjct  647  VKSAVELPKMDAQIAEGLVRKWQNIKSQAFGPGHSVDKLSEVLDGEMLKIWTDRANEIAQ  706

Query  257  HGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYEL  78
              W +DYTL NL+IDSVTVS+DG+RA+VEATLEE AQLTD  HPEHD S S TYTTRYE+
Sbjct  707  LNWSYDYTLLNLSIDSVTVSLDGQRAVVEATLEELAQLTDVLHPEHDASNSRTYTTRYEM  766

Query  77   SCGKSGWRIVEGAVLKS  27
            SC  SGW+I EGAVL+S
Sbjct  767  SCSSSGWKITEGAVLQS  783



>ref|XP_004167108.1| PREDICTED: LOW QUALITY PROTEIN: protein ACCUMULATION AND REPLICATION 
OF CHLOROPLASTS 6, chloroplastic-like, partial [Cucumis 
sativus]
Length=524

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 183/307 (60%), Positives = 220/307 (72%), Gaps = 9/307 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLE+LEGV GSPLAAAAAI +IGAEATAVLD VK SAIQAL+KV PL   +
Sbjct  221  YYDDPTVLRYLEKLEGVNGSPLAAAAAIVKIGAEATAVLDHVKSSAIQALRKVFPLT--Q  278

Query  749  TSVRRHGNS-----FYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEM-ITEKIKDL  588
             S RR   +     F        L + D+    N +  +ER+ + ++  E  IT++IKD 
Sbjct  279  NSYRREAEAEMEYVFPAGNSQVPLVNFDENERTNFSEVSERTEAGERNDEQPITDQIKDA  338

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRM  408
             VKI  AG+AVGLLTL GL+FL  R +++ L K+ GS + A   S+     + SEE  RM
Sbjct  339  SVKIMCAGLAVGLLTLAGLRFLPARNNTTALLKEAGSPI-ASTTSVASEVEKSSEEPSRM  397

Query  407  EARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQ  228
            +AR AE LVRKWQ+IKS A GP+H L KLSEILDG+MLK+WTDRA EI++ GWF+DYTL 
Sbjct  398  DARIAEGLVRKWQSIKSMAFGPEHCLAKLSEILDGEMLKIWTDRAIEISELGWFYDYTLS  457

Query  227  NLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIV  48
            NLTIDSVTVS DGRRA VEATLEESA+L D  HPEH+DS   TYTTRYELS   SGW+I 
Sbjct  458  NLTIDSVTVSFDGRRATVEATLEESARLIDVDHPEHNDSNQKTYTTRYELSYLTSGWKIT  517

Query  47   EGAVLKS  27
            +GAVL+S
Sbjct  518  KGAVLES  524



>ref|XP_002307697.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
 gb|EEE94693.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
Length=768

 Score =   301 bits (770),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 178/300 (59%), Positives = 216/300 (72%), Gaps = 19/300 (6%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLER EG G SPLAAAAAI RIGAEATAV+D VK SAIQALQKV PLG  +
Sbjct  486  YYDDPTVLRYLERQEGGGRSPLAAAAAIVRIGAEATAVIDHVKASAIQALQKVFPLGHKD  545

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                 H N             G  + PE +  +++  P    E+E+ITEKIKD  +KI  
Sbjct  546  MGAEFHEND------------GINSNPEEI--YSDEVP----EEELITEKIKDASIKIMC  587

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVE-VSEEVPRMEARFA  393
            AGVA+GLLTL GLK+   R  S I +K+ GS++ +D +++  +  E +SEE+PRM+ARFA
Sbjct  588  AGVAIGLLTLAGLKYFPPRTGSFIRQKEIGSAMASDTINLNSAVDEQISEELPRMDARFA  647

Query  392  ESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTID  213
            E +VRKWQNIKSQA GPDH L KL E+LD QMLK+WTDRAAEIA  GW ++Y L +LTID
Sbjct  648  EDIVRKWQNIKSQAFGPDHCLAKLPEVLDSQMLKIWTDRAAEIAHLGWVYEYMLLDLTID  707

Query  212  SVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGAVL  33
            SVTVSVDG  A+VEATL+ES +LTD  HPE++ S   TYTTRYELSC  SGW+I EGA++
Sbjct  708  SVTVSVDGLSAVVEATLKESTRLTDEVHPENNASNVKTYTTRYELSCSNSGWKITEGAIM  767



>ref|XP_006383730.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
 ref|XP_006383731.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
 gb|ERP61527.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
 gb|ERP61528.1| hypothetical protein POPTR_0005s25630g [Populus trichocarpa]
Length=785

 Score =   300 bits (769),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 182/305 (60%), Positives = 219/305 (72%), Gaps = 12/305 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLER EG G SPLAAAAAI RIGAEATAV+D VK SAIQALQKV PLG  +
Sbjct  486  YYDDPTVLRYLERQEGGGRSPLAAAAAIVRIGAEATAVIDHVKASAIQALQKVFPLGHKD  545

Query  749  TSVRRHGN----SFYTATESDELSHGDKTFPENMAGFAERSPSDD-QEQEMITEKIKDLV  585
                 H N    S  +A E++      K F        E   SD+  E+E+ITEKIKD  
Sbjct  546  MGAEFHENDGINSVLSAVETE------KPFESLGLENPEEIYSDEVPEEELITEKIKDAS  599

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVE-VSEEVPRM  408
            +KI  AGVA+GLLTL GLK+   R  S I +K+ GS++ +D +++  +  E +SEE+PRM
Sbjct  600  IKIMCAGVAIGLLTLAGLKYFPPRTGSFIRQKEIGSAMASDTINLNSAVDEQISEELPRM  659

Query  407  EARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQ  228
            +ARFAE +VRKWQNIKSQA GPDH L KL E+LD QMLK+WTDRAAEIA  GW ++Y L 
Sbjct  660  DARFAEDIVRKWQNIKSQAFGPDHCLAKLPEVLDSQMLKIWTDRAAEIAHLGWVYEYMLL  719

Query  227  NLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIV  48
            +LTIDSVTVSVDG  A+VEATL+ES +LTD  HPE++ S   TYTTRYELSC  SGW+I 
Sbjct  720  DLTIDSVTVSVDGLSAVVEATLKESTRLTDEVHPENNASNVKTYTTRYELSCSNSGWKIT  779

Query  47   EGAVL  33
            EGA++
Sbjct  780  EGAIM  784



>ref|XP_010672203.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Beta vulgaris subsp. vulgaris]
Length=814

 Score =   300 bits (768),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 186/308 (60%), Positives = 224/308 (73%), Gaps = 11/308 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP+VL+YLERLEG  GS LAAAAAI RIGA A AV+D+V  S IQALQKV P   GE
Sbjct  511  YYDDPIVLKYLERLEGGSGSSLAAAAAIVRIGAGAHAVIDNVTTSVIQALQKVFPPSSGE  570

Query  749  TSVRRHG----NSFYTATESDELSHGDKTFPENMA--GFAERSPSDDQEQEMITEKIKDL  588
              + R      N F     + EL   +     N+A   F E    D+ EQE +TEKIKDL
Sbjct  571  ERITRQEDVAVNGFGNEDVTMELGRDNTLDYVNLASSNFTE----DNIEQESVTEKIKDL  626

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEE-VPR  411
             VK+  AGV +GL TL G+K L  R+ S+I  +  GS+V +DV S+G S  E +EE VP+
Sbjct  627  GVKVMCAGVVIGLTTLAGMKLLPGRSGSAIPHRHLGSAVASDVSSVGLSVNETTEEKVPK  686

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+AR AE LVR+WQN+KSQALGP+H LEKLSE+LDG MLK+W DRA EIA+ GWFW+Y L
Sbjct  687  MDARLAEVLVRRWQNVKSQALGPNHSLEKLSEVLDGNMLKIWADRAKEIAERGWFWEYAL  746

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
             N+ IDSVT+S+DG+RA VEATLEESA LTDA  PEH+DSYS TYTTRYE+SC KSGW+I
Sbjct  747  VNVIIDSVTISLDGKRATVEATLEESANLTDATQPEHNDSYSRTYTTRYEMSCSKSGWKI  806

Query  50   VEGAVLKS  27
            +EGAVL+S
Sbjct  807  IEGAVLQS  814



>ref|XP_010095543.1| hypothetical protein L484_016017 [Morus notabilis]
 gb|EXB60663.1| hypothetical protein L484_016017 [Morus notabilis]
Length=791

 Score =   298 bits (763),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 228/310 (74%), Gaps = 12/310 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERL+G  GSPLAAAAAI RIGA ATAVLD VK SAI ALQKV PLGD +
Sbjct  485  YYDDPTVLRYLERLDGANGSPLAAAAAIVRIGAGATAVLDHVKSSAILALQKVFPLGDRD  544

Query  749  TSVRRHGNS----FYTATESDELSHGDKTFPENMAGFAERSPSDD----QEQEMITEKIK  594
             ++    +     F   +ES+E    +K   ++ +   E S +D     +E  +IT+ IK
Sbjct  545  KNLAHQEDGEMSHFLLPSESEEYPL-EKPGQDDSSHVTEISGNDQSDEVREVGLITDNIK  603

Query  593  DLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKV-EVSEEV  417
            D  VK+  A V +G+LTL+GL+FL  R  SS +RK+ GS   +D +S+G S V E +EE+
Sbjct  604  DASVKLMCASVVIGMLTLVGLRFLPAR--SSTIRKELGSVTASDALSLGLSGVNESAEEL  661

Query  416  PRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDY  237
            P+M+AR AE LVRKWQNIKSQA GP H + K +E+LDG+MLK+WTDRA+EIAQ GWF+DY
Sbjct  662  PKMDARIAEGLVRKWQNIKSQAFGPYHCIGKFAEVLDGRMLKIWTDRASEIAQLGWFYDY  721

Query  236  TLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGW  57
            +L NLTIDSVTVS+DG+RA+VEAT+EES QLTD  HPEHDDS + TYTTRYE+S   SGW
Sbjct  722  SLLNLTIDSVTVSLDGQRAVVEATIEESTQLTDLLHPEHDDSNTRTYTTRYEMSSSSSGW  781

Query  56   RIVEGAVLKS  27
            +I EGAVL+S
Sbjct  782  KITEGAVLES  791



>gb|KDO84749.1| hypothetical protein CISIN_1g003752mg [Citrus sinensis]
Length=798

 Score =   298 bits (763),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 220/304 (72%), Gaps = 7/304 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiari-gaeatAVLDSVKVSAIQALQKVIPLGDG  753
            YYDDP VLRYLERLEG G SPLAAAAAI RI   EATAVLD VK S IQALQKV PLG G
Sbjct  490  YYDDPTVLRYLERLEGNGSSPLAAAAAIVRIGATEATAVLDHVKSSTIQALQKVFPLGQG  549

Query  752  ETSVR--RHGNSF--YTATESDE-LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
            + +V+   HG ++      E++E L+     F      +   S  D   ++ IT+KIKD+
Sbjct  550  DKAVKYVEHGETYDPVPVVETEESLTSDQNNFAFTTDAYGTSSSDDIHGEQSITDKIKDV  609

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVE-VSEEVPR  411
             VKI  AGVA+GL+TL+GLK+L  R  SS+ +K+ G +  +D++  GP   E + +E+PR
Sbjct  610  SVKIMCAGVAIGLVTLVGLKYLPTRNISSVQQKEIGLAKASDIIDAGPLLDEKLGQELPR  669

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+AR AE +VRKWQNIKSQA GPDH L KL E+LDGQMLKVWTDRA+EIAQ GW +DY+L
Sbjct  670  MDARLAEDIVRKWQNIKSQAFGPDHSLGKLPEVLDGQMLKVWTDRASEIAQLGWTYDYSL  729

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
             NLTIDSVT+S +GR A VEAT++ESA+LTD  HPE+ D   +TYTTRYELS  KSGWRI
Sbjct  730  LNLTIDSVTLSQEGRHAWVEATVKESARLTDTVHPENCDEKISTYTTRYELSSTKSGWRI  789

Query  50   VEGA  39
             +G+
Sbjct  790  TDGS  793



>ref|XP_008388150.1| PREDICTED: LOW QUALITY PROTEIN: protein ACCUMULATION AND REPLICATION 
OF CHLOROPLASTS 6, chloroplastic-like [Malus domestica]
Length=815

 Score =   298 bits (763),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 183/318 (58%), Positives = 218/318 (69%), Gaps = 27/318 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERL+G  GSPLAAAAAI  IGAEATAVL + K SAIQALQKV P G   
Sbjct  508  YYDDPTVLRYLERLDGTNGSPLAAAAAIVNIGAEATAVLGNFKASAIQALQKVFPPG---  564

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDD----------------QEQ  618
                 H +   T  E +E+++     P       E S  D+                +E+
Sbjct  565  -----HRDENLTPQEDNEMNYA--FLPVENGEPLEESDGDESVHVGEVSGRNGSVGIREE  617

Query  617  EMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIG-PS  441
            E++T+KIKD  VKI  AGV +GL TLIGL++L  R D S L K+  S   +DV S G P 
Sbjct  618  ELMTDKIKDATVKIMCAGVVIGLTTLIGLRYLPARRDPSNLHKELSSVTASDVTSAGLPG  677

Query  440  KVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIA  261
              + +EE+P+M+AR AE LVRKWQNIKSQA GP+H LEKLSE+LDG+MLK+WTDRA EIA
Sbjct  678  DEKSAEEIPKMDARIAEGLVRKWQNIKSQAFGPNHSLEKLSEVLDGEMLKIWTDRATEIA  737

Query  260  QHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYE  81
            Q  W +DYTL NL IDSVTVS+D +RA+VEATLEE AQLTD  HPEH+DS S TYTTRY 
Sbjct  738  QLNWSYDYTLLNLNIDSVTVSLDRQRAVVEATLEEMAQLTDVLHPEHNDSNSRTYTTRYV  797

Query  80   LSCGKSGWRIVEGAVLKS  27
            +SC  SGW+I EGAVL+S
Sbjct  798  MSCSSSGWKISEGAVLQS  815



>ref|XP_006473597.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X1 [Citrus sinensis]
Length=798

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 178/304 (59%), Positives = 220/304 (72%), Gaps = 7/304 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiari-gaeatAVLDSVKVSAIQALQKVIPLGDG  753
            YYDDP VLRYLERLEG G SPLAAAAAI RI   EATAVLD VK S IQALQKV PLG G
Sbjct  490  YYDDPTVLRYLERLEGNGSSPLAAAAAIVRIGATEATAVLDHVKSSTIQALQKVFPLGRG  549

Query  752  ETSVR--RHGNSF--YTATESDE-LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
            + +V+   HG ++      E++E L+     F      +   S  D   ++ IT+KIKD+
Sbjct  550  DKAVKYVEHGETYDPVPVVETEESLTSDQNNFAFTTDAYGTSSSDDIHGEQSITDKIKDV  609

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVE-VSEEVPR  411
             VKI  AGVA+GL+TL+GLK+L  R  SS+ +K+ G +  +D++  GP   E + +E+PR
Sbjct  610  SVKIMCAGVAIGLVTLVGLKYLPTRNISSVQQKEIGLAKASDIIDAGPLLDEKLGQELPR  669

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+AR AE +VRKWQNIKSQA GPDH L KL E+LDGQMLKVWTDRA+EIAQ GW +DY+L
Sbjct  670  MDARLAEDIVRKWQNIKSQAFGPDHSLGKLPEVLDGQMLKVWTDRASEIAQLGWTYDYSL  729

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
             NLTIDSVT+S +GR A VEAT++ESA+LTD  HPE+ D   +TYTTRYELS  KSGWRI
Sbjct  730  LNLTIDSVTLSQEGRHAWVEATVKESARLTDTVHPENCDEKISTYTTRYELSSTKSGWRI  789

Query  50   VEGA  39
             +G+
Sbjct  790  TDGS  793



>gb|EPS66110.1| hypothetical protein M569_08664 [Genlisea aurea]
Length=792

 Score =   296 bits (757),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 184/316 (58%), Positives = 229/316 (72%), Gaps = 24/316 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKV-IPLGDG  753
            YYDDP VLRYLERLEGVG SPLA AAAI +IG EATA LD VK  AIQAL KV IP G+G
Sbjct  486  YYDDPTVLRYLERLEGVGRSPLAVAAAIVKIGQEATAALDIVKAGAIQALHKVFIPRGNG  545

Query  752  ETSVRRHGNSFYTATESDELSHGDKTFP------------ENMAGFAERSPSD-DQEQEM  612
            +  +  H       +E +E S+ D   P             ++ G  E + SD  Q+QE+
Sbjct  546  K-KISEH-------SEENENSNYDLAVPYEDAEIYRSLDDSSVDGTLEMNHSDWIQQQEV  597

Query  611  ITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSV-TADVVSIGPSKV  435
            IT+KIK   +KI SAGVAVGLLTL+GLKFL  R+  S L KD G +V ++DV++      
Sbjct  598  ITDKIKSATIKIMSAGVAVGLLTLVGLKFLPYRS-GSYLFKDKGEAVGSSDVINGESLLA  656

Query  434  EVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQH  255
            + S+EVPRM+ARFA+ LV KW NIK+QALGPDH L  L E+LDGQMLK+WT++A+E+A++
Sbjct  657  QSSDEVPRMDARFADILVHKWHNIKAQALGPDHCLAVLPEVLDGQMLKIWTEKASEMARN  716

Query  254  GWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELS  75
            GWFW+Y L NL+IDSV+VSVDGRRA VEAT EESA+LTD AHPE+++S S++YTTRYE+S
Sbjct  717  GWFWEYELLNLSIDSVSVSVDGRRATVEATFEESAKLTDVAHPENNNSLSSSYTTRYEMS  776

Query  74   CGKSGWRIVEGAVLKS  27
                GW+IVEGA LKS
Sbjct  777  FTNDGWKIVEGAALKS  792



>ref|XP_011045148.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Populus euphratica]
 ref|XP_011045149.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X2 [Populus euphratica]
Length=785

 Score =   295 bits (754),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 182/309 (59%), Positives = 221/309 (72%), Gaps = 20/309 (6%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLER EG G SPLAAAAAI RIGAEATAV+D VK SAIQALQKV PLG  +
Sbjct  486  YYDDPTVLRYLERQEGGGRSPLAAAAAIVRIGAEATAVIDHVKASAIQALQKVFPLGHKD  545

Query  749  TSVRRHGN----SFYTATESDELSHGDKTFP----ENMAG-FAERSPSDDQEQEMITEKI  597
                 H N    S  +A E++      K F     EN  G +++  P    E+E+ITEKI
Sbjct  546  MGAEFHENDGINSVLSAVETE------KPFESLGLENPEGIYSDEVP----EEELITEKI  595

Query  596  KDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVE-VSEE  420
            KD  +KI  AGVA+GLLTL GLK+   R  S I +K+ GS++ +D +++  +  E +SEE
Sbjct  596  KDASIKIMCAGVAIGLLTLGGLKYFPPRTGSFIRQKEIGSAMASDTINLNSAVDEQISEE  655

Query  419  VPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWD  240
            +PRM+ARFAE +VRKWQNIKSQA GPDH L KL E+LD QMLK+WTDRAAEIA  GW ++
Sbjct  656  LPRMDARFAEDIVRKWQNIKSQAFGPDHCLAKLPEVLDSQMLKIWTDRAAEIAHLGWIYE  715

Query  239  YTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG  60
            Y L +LTIDSVTVSVDG  A+VEATL+ES +LTD  HPE++ S   TYTTRYELS   SG
Sbjct  716  YVLLDLTIDSVTVSVDGLSAVVEATLKESTRLTDEVHPENNASNVKTYTTRYELSRSNSG  775

Query  59   WRIVEGAVL  33
            W+I EGA++
Sbjct  776  WKITEGAIM  784



>ref|XP_004152763.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like [Cucumis sativus]
Length=786

 Score =   292 bits (748),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 181/307 (59%), Positives = 218/307 (71%), Gaps = 12/307 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLE+LEGV GSPLAAAAAI +IGAEATAVLD VK SAIQAL+KV PL   +
Sbjct  486  YYDDPTVLRYLEKLEGVNGSPLAAAAAIVKIGAEATAVLDHVKSSAIQALRKVFPLT--Q  543

Query  749  TSVRRHGNS-----FYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEM-ITEKIKDL  588
             S RR   +     F        L + D+    N +  +ER+ + ++  E  IT++IKD 
Sbjct  544  NSYRREAEAEMEYVFPAGNSQVPLVNFDENERTNFSEVSERTEAGERNDEQPITDQIKDA  603

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRM  408
             VKI  AG+AVGLLTL GL+FL  R +++ L K+ GS + +    +  S    SEE  RM
Sbjct  604  SVKIMCAGLAVGLLTLAGLRFLPARNNTTALLKEAGSPIASTTSVVEKS----SEEPSRM  659

Query  407  EARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQ  228
            +AR AE LVRKWQ+IKS A GP+H L KLSEILDG+MLK+WTDRA EI++ GWF+DYTL 
Sbjct  660  DARIAEGLVRKWQSIKSMAFGPEHCLAKLSEILDGEMLKIWTDRAIEISELGWFYDYTLS  719

Query  227  NLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIV  48
            NLTIDSVTVS DGRRA VEATLEESA+L D  HPEH+DS   TYT RYELS   SGW+I 
Sbjct  720  NLTIDSVTVSFDGRRATVEATLEESARLIDVDHPEHNDSNQKTYTMRYELSYLTSGWKIT  779

Query  47   EGAVLKS  27
            +GAVL+S
Sbjct  780  KGAVLES  786



>gb|KGN62655.1| hypothetical protein Csa_2G365130 [Cucumis sativus]
Length=957

 Score =   295 bits (755),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 182/307 (59%), Positives = 219/307 (71%), Gaps = 9/307 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLE+LEGV GSPLAAAAAI +IGAEATAVLD VK SAIQAL+KV PL   +
Sbjct  654  YYDDPTVLRYLEKLEGVNGSPLAAAAAIVKIGAEATAVLDHVKSSAIQALRKVFPLT--Q  711

Query  749  TSVRRHGNS-----FYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEM-ITEKIKDL  588
             S RR   +     F        L + D+    N +  +ER+ + ++  E  IT++IKD 
Sbjct  712  NSYRREAEAEMEYVFPAGNSQVPLVNFDENERTNFSEVSERTEAGERNDEQPITDQIKDA  771

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRM  408
             VKI  AG+AVGLLTL GL+FL  R +++ L K+ GS + A   S+     + SEE  RM
Sbjct  772  SVKIMCAGLAVGLLTLAGLRFLPARNNTTALLKEAGSPI-ASTTSVASEVEKSSEEPSRM  830

Query  407  EARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQ  228
            +AR AE LVRKWQ+IKS A GP+H L KLSEILDG+MLK+WTDRA EI++ GWF+DYTL 
Sbjct  831  DARIAEGLVRKWQSIKSMAFGPEHCLAKLSEILDGEMLKIWTDRAIEISELGWFYDYTLS  890

Query  227  NLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIV  48
            NLTIDSVTVS DGRRA VEATLEESA+L D  HPEH+DS   TYT RYELS   SGW+I 
Sbjct  891  NLTIDSVTVSFDGRRATVEATLEESARLIDVDHPEHNDSNQKTYTMRYELSYLTSGWKIT  950

Query  47   EGAVLKS  27
            +GAVL+S
Sbjct  951  KGAVLES  957



>ref|XP_008444775.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Cucumis melo]
Length=789

 Score =   288 bits (736),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 182/308 (59%), Positives = 223/308 (72%), Gaps = 11/308 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLE+LEGV GSPLAAAAAI +IGAEATAVLD VK SAIQAL+KV PL   +
Sbjct  486  YYDDPTVLRYLEKLEGVNGSPLAAAAAIVKIGAEATAVLDHVKSSAIQALRKVFPLT--Q  543

Query  749  TSVRRHGNS-----FYTATESDELSHGDKTFPENMAGFAERSPSDD-QEQEMITEKIKDL  588
             S RR   +     F        L + D+    N+   +ER  + +  +++ IT++IKD 
Sbjct  544  NSYRREAEAEMEYVFPAGNSQVPLVNFDENERTNLPEVSERGEAGEINDEQPITDQIKDA  603

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS-EEVPR  411
             VKI  AG+AVGL TL GL+FL  R +++   K+ GSS+ A   S+  S+VE S EE+ R
Sbjct  604  SVKIMCAGLAVGLFTLAGLRFLPARNNTTASLKEAGSSI-ASTTSVA-SEVEKSIEELSR  661

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+AR AE LVRKWQ+IKS A GP+H L KL EILDG+MLK+WTDRA EI++ GWF+DYTL
Sbjct  662  MDARIAEGLVRKWQSIKSLAFGPEHCLAKLPEILDGEMLKIWTDRAIEISELGWFYDYTL  721

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
             NLTIDSVTVS DG+RA+VEATLEESA+L D  HPEH+DS   TYTTRYELS   SGW+I
Sbjct  722  SNLTIDSVTVSFDGQRAMVEATLEESARLIDVDHPEHNDSNQKTYTTRYELSYLSSGWKI  781

Query  50   VEGAVLKS  27
             +GAVL+S
Sbjct  782  TKGAVLES  789



>ref|XP_010061021.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Eucalyptus grandis]
 gb|KCW67920.1| hypothetical protein EUGRSUZ_F01622 [Eucalyptus grandis]
Length=804

 Score =   288 bits (736),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 223/307 (73%), Gaps = 6/307 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLE+LEG G SPLAAAAAIA+IGAEA+AV+D+VK SAIQAL+KV PL   +
Sbjct  498  YYDDPTVLRYLEKLEGGGSSPLAAAAAIAKIGAEASAVIDNVKDSAIQALRKVFPLSHSK  557

Query  749  --TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEM----ITEKIKDL  588
              T ++      Y+   S+          +N+A  +E S  DD   E     +T++IKD 
Sbjct  558  EVTGLQADMGPDYSIPSSEFTEPFTSPDGDNIANISEASRKDDTVSETDGYSMTDRIKDA  617

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRM  408
             VKI  AG+ +G +TL+GLK +  R+ S +L K+ GS++ +DV   G S   +SE+ PRM
Sbjct  618  SVKIMCAGLVIGAMTLVGLKCIPARSGSPVLHKEVGSAMASDVDCEGSSMDVLSEDSPRM  677

Query  407  EARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQ  228
            + + AESLVRKWQ IKSQALGPDH LEKLSE+LDGQMLK+WT+RAAEIA +GWFWDY+L 
Sbjct  678  DTKLAESLVRKWQFIKSQALGPDHCLEKLSEVLDGQMLKIWTNRAAEIAHNGWFWDYSLV  737

Query  227  NLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIV  48
            +LTIDSV +S+DGR A VEATLEESA+LTD  +PE +DSY+  YTTRYE+S   S W+I 
Sbjct  738  SLTIDSVILSMDGRHATVEATLEESARLTDVNNPERNDSYNKIYTTRYEMSHADSDWKIT  797

Query  47   EGAVLKS  27
            EGAVLKS
Sbjct  798  EGAVLKS  804



>ref|XP_010907356.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X2 [Elaeis guineensis]
Length=786

 Score =   280 bits (715),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 219/309 (71%), Gaps = 8/309 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDG-  753
            YYDD  VLRYLER+EG G SPLAAAAAIA IGAEATA L + K SA+QAL+KV PL +  
Sbjct  478  YYDDSTVLRYLERMEGGGSSPLAAAAAIANIGAEATAALGNAKSSALQALRKVFPLVNKL  537

Query  752  ETSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEM----ITEKIKDLV  585
            E S +   N  + +    + +       +  +GF   +  +   +E+    +   IK+  
Sbjct  538  ERSSKEEVNDSHDSVTEIQTNESGVKINQVSSGFEAEASGNLNSEELNEQDLMYDIKNAS  597

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIG---PSKVEVSEEVP  414
            VKI  AGV VGL+TL GLK L  +    + +K+ GS++ A+VV++G   P    + EE P
Sbjct  598  VKIMCAGVVVGLVTLAGLKHLPGKNVLPVAKKETGSAMAANVVNLGSDVPMVENLGEEAP  657

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M+AR AE+LV KWQN+KSQALGPDH L KL E+LDG+MLK+WTDRAAEIAQHGWFW YT
Sbjct  658  KMDARLAETLVHKWQNVKSQALGPDHCLIKLPEVLDGRMLKLWTDRAAEIAQHGWFWQYT  717

Query  233  LQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWR  54
            L  +T+DSV VS+DG RA VEAT++E+AQLTD AHPEH+DSYSTTYTTRYE++  KSGW+
Sbjct  718  LLGVTVDSVIVSLDGYRATVEATIQEAAQLTDGAHPEHNDSYSTTYTTRYEMAYSKSGWK  777

Query  53   IVEGAVLKS  27
            I EGAVLKS
Sbjct  778  ITEGAVLKS  786



>ref|XP_010907355.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Elaeis guineensis]
Length=814

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 219/309 (71%), Gaps = 8/309 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDG-  753
            YYDD  VLRYLER+EG G SPLAAAAAIA IGAEATA L + K SA+QAL+KV PL +  
Sbjct  506  YYDDSTVLRYLERMEGGGSSPLAAAAAIANIGAEATAALGNAKSSALQALRKVFPLVNKL  565

Query  752  ETSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEM----ITEKIKDLV  585
            E S +   N  + +    + +       +  +GF   +  +   +E+    +   IK+  
Sbjct  566  ERSSKEEVNDSHDSVTEIQTNESGVKINQVSSGFEAEASGNLNSEELNEQDLMYDIKNAS  625

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIG---PSKVEVSEEVP  414
            VKI  AGV VGL+TL GLK L  +    + +K+ GS++ A+VV++G   P    + EE P
Sbjct  626  VKIMCAGVVVGLVTLAGLKHLPGKNVLPVAKKETGSAMAANVVNLGSDVPMVENLGEEAP  685

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M+AR AE+LV KWQN+KSQALGPDH L KL E+LDG+MLK+WTDRAAEIAQHGWFW YT
Sbjct  686  KMDARLAETLVHKWQNVKSQALGPDHCLIKLPEVLDGRMLKLWTDRAAEIAQHGWFWQYT  745

Query  233  LQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWR  54
            L  +T+DSV VS+DG RA VEAT++E+AQLTD AHPEH+DSYSTTYTTRYE++  KSGW+
Sbjct  746  LLGVTVDSVIVSLDGYRATVEATIQEAAQLTDGAHPEHNDSYSTTYTTRYEMAYSKSGWK  805

Query  53   IVEGAVLKS  27
            I EGAVLKS
Sbjct  806  ITEGAVLKS  814



>gb|KHN39446.1| Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic 
[Glycine soja]
Length=583

 Score =   273 bits (697),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 215/306 (70%), Gaps = 5/306 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG   SPLAAAAAIA+IGAEATAV+  V+ S I AL+K  P+G  +
Sbjct  278  YYDDPTVLRYLERLEGGSNSPLAAAAAIAKIGAEATAVISQVQASVINALKKAFPVGSED  337

Query  749  TSVRRHGNS----FYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVV  582
              V+   N     F  +   + L   D+  P N      ++  + ++ E ITE+IK   V
Sbjct  338  QIVKHQVNGVNEDFGFSESENPLILSDQDSPVNAEVSGIKNTMETRKGEFITEEIKHASV  397

Query  581  KITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGP-SKVEVSEEVPRME  405
            +I  AGV +GL+TL+GLKFL  R  S ILRK  GS++ +D +++G     E  E++P+M+
Sbjct  398  QIMCAGVVIGLVTLVGLKFLPTRNGSPILRKMTGSAMVSDTINLGSLGDEEKVEQLPKMD  457

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            AR AE+LVRKWQ++KS+A GPDH L +L E+LDG+MLK+WTDRAAEIA+ GW +DYTL++
Sbjct  458  ARVAEALVRKWQSVKSEAFGPDHCLGRLHEVLDGEMLKIWTDRAAEIAERGWSYDYTLED  517

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVE  45
            L IDSVT+S +GRRA+VE TL+ES  L    HP+HD S S TYTTRYE+S   + W+IVE
Sbjct  518  LNIDSVTISQNGRRAVVETTLKESTHLNAVGHPQHDASNSRTYTTRYEMSFTGAEWKIVE  577

Query  44   GAVLKS  27
            GAVL+S
Sbjct  578  GAVLES  583



>ref|XP_009393636.1| PREDICTED: LOW QUALITY PROTEIN: protein ACCUMULATION AND REPLICATION 
OF CHLOROPLASTS 6, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=797

 Score =   278 bits (710),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 170/309 (55%), Positives = 224/309 (72%), Gaps = 13/309 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiari-gaeatAVLDSVKVSAIQALQKVIPLGDG  753
            YYDDPMVL+YLER+EG  GSPLAAAAAI +I   EATA L SVK S +QALQKV PL + 
Sbjct  494  YYDDPMVLKYLERMEGDHGSPLAAAAAIVKIGAEEATAALGSVKSSVLQALQKVFPLTNK  553

Query  752  ETSVRRHGNSFYTATESDELSHGDKT---FPENMAG----FAERSPSDDQEQEMITEKIK  594
            E   R    ++   T+     H  +T     ++ +G     +++S  +D  ++ +T +IK
Sbjct  554  EE--RLSSEAYRDGTDIVPDLHMQETVIKIDQDKSGSHVEVSKKSDPEDSYEQDLTNEIK  611

Query  593  DLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVP  414
              V+KI SAG+ VG+LT+IG+K L  R    +  K+ GS+  A+  +I  + VE   E+P
Sbjct  612  IAVMKIMSAGMVVGVLTMIGIKCLPGRNSLLVTGKETGSATAANFTNIDENFVE---EIP  668

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M+ARFAE+LV KWQN+KS+ALGPDH L +L E+LDG+MLK+WTDRA EIA+HGWFW+YT
Sbjct  669  KMDARFAETLVHKWQNVKSRALGPDHSLAELPEVLDGRMLKIWTDRAVEIAKHGWFWEYT  728

Query  233  LQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWR  54
            L  LTIDSVT+SVDGRRA+VEA +EE+A+LTD  HPEH+DSYSTTY+TRYE+   KSGW+
Sbjct  729  LLGLTIDSVTLSVDGRRAMVEARIEEAARLTDDTHPEHNDSYSTTYSTRYEMVHSKSGWK  788

Query  53   IVEGAVLKS  27
            I EG+VL+S
Sbjct  789  ITEGSVLQS  797



>gb|KDP38591.1| hypothetical protein JCGZ_04516 [Jatropha curcas]
Length=789

 Score =   277 bits (709),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 177/306 (58%), Positives = 220/306 (72%), Gaps = 10/306 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLER    G SPLAAAAAIARIGAEATAV+D VK SAIQAL+KV PL    
Sbjct  486  YYDDPAVLRYLER---GGHSPLAAAAAIARIGAEATAVIDHVKASAIQALRKVFPLNKKG  542

Query  749  TSVRRHGNS--FYTATESDELSHGDKTFPENMAGFAERSPSDD----QEQEMITEKIKDL  588
             ++    N+   Y+ +E +     ++  P+N A  AE S  +      E+E+IT++IKD 
Sbjct  543  ENIGFPENAGVNYSLSEVEAEEPVEEYDPDNAAIKAESSGKNTYGEVPEEELITDRIKDA  602

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS-EEVPR  411
             VKI  AGVAVGL+TL+GLK+L     S I R + GS++  + +S+G +  E S EE+PR
Sbjct  603  SVKIMCAGVAVGLMTLLGLKYLPTSNGSFIRRNETGSAMAVNTISVGLAIDEKSVEELPR  662

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+AR AE +VRKWQ IKSQA GPDH LEKL E+LD QMLK WTDRAAEIAQ GW +DYTL
Sbjct  663  MDARSAEGIVRKWQKIKSQAFGPDHSLEKLPEVLDDQMLKTWTDRAAEIAQLGWVYDYTL  722

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
             +LTIDSVTVS+DGR A+VEAT++ES  LTDA HPE++ S + TYTTRYE+S   S W+I
Sbjct  723  LDLTIDSVTVSLDGRHAVVEATIKESTCLTDAVHPENNASNTMTYTTRYEMSPSNSEWKI  782

Query  50   VEGAVL  33
             EGA++
Sbjct  783  TEGAIM  788



>ref|XP_004499214.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like [Cicer arietinum]
Length=793

 Score =   275 bits (703),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 166/308 (54%), Positives = 216/308 (70%), Gaps = 9/308 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEGVG SPLAAAAAIA+IGAEATAV+  V+ SAI AL++V P+G  +
Sbjct  488  YYDDPTVLRYLERLEGVGRSPLAAAAAIAKIGAEATAVIGHVQASAINALKRVFPVGSDD  547

Query  749  TSVRRHGNSFYTATESDE------LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
              +    NS    +   E      LS+ D +     +G   ++ ++  + + IT++IK+ 
Sbjct  548  KILTHQENSNKDNSSLSENEDPLILSNRDTSVNVEASGI--KNTAEINDGKFITDEIKNA  605

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGP-SKVEVSEEVPR  411
             V+I  AG  +GL+TL GLKFL  R  S I  K  GS++ +D V +GP    E+ E +P+
Sbjct  606  SVQIMCAGAVIGLVTLFGLKFLPARNGSPIFHKVTGSAMASDNVDLGPVGDEELGERLPK  665

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M AR AE+LVRKWQNIKSQA GPDH L +L E+LDG+MLK+WTDRAAEIA+  W +DY L
Sbjct  666  MNARVAEALVRKWQNIKSQAFGPDHCLGRLQEVLDGEMLKIWTDRAAEIAERDWSYDYNL  725

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
            ++L IDSVT+S +GRRA+VE+TL+ESA LT   HP+H  S + TYTTRYE+S   S W+I
Sbjct  726  EDLNIDSVTISQNGRRAVVESTLKESAHLTAVGHPQHASSNTRTYTTRYEMSFSGSEWKI  785

Query  50   VEGAVLKS  27
            VEGAVL+S
Sbjct  786  VEGAVLES  793



>ref|XP_007160698.1| hypothetical protein PHAVU_001G009500g [Phaseolus vulgaris]
 gb|ESW32692.1| hypothetical protein PHAVU_001G009500g [Phaseolus vulgaris]
Length=797

 Score =   273 bits (698),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 222/311 (71%), Gaps = 15/311 (5%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEGVG SPLAAAAAI +IGAEATAV+  V+ S I AL+KV P+G  E
Sbjct  492  YYDDPTVLRYLERLEGVGHSPLAAAAAIVKIGAEATAVITQVQASVINALKKVFPVG-SE  550

Query  749  TSVRRHGNS----FYTATESDE---LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKD  591
              + +H  S     ++ +ES+    LS GD +   +++G   +  ++  E E IT++IK+
Sbjct  551  DQIVKHLESGEKDNFSFSESENPLILSEGDSSVNVDVSGI--KDTAEASEGEFITDEIKN  608

Query  590  LVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVV---SIGPSKVEVSEE  420
              V+I  AGV +GL+TL+GLKFL  R  S +L K  GS++ +D +   S+G  +  V  +
Sbjct  609  ASVQIMCAGVVIGLVTLVGLKFLPTRNGSPMLHKITGSAMASDTINLDSLGDDEKGV--Q  666

Query  419  VPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWD  240
            +P+M+AR AE+LVRKWQ+IKSQA GPDH L +L E+LDG+MLKVWTDRAAEIA+ GW +D
Sbjct  667  LPKMDARVAEALVRKWQSIKSQAFGPDHCLGRLHEVLDGEMLKVWTDRAAEIAERGWSYD  726

Query  239  YTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG  60
            Y L++L IDSVT+S +G+RA+VE TL ES  L    HP+HD S S TYTTRYE+S    G
Sbjct  727  YILEDLNIDSVTISQNGQRAVVETTLTESTHLNAVGHPQHDASNSRTYTTRYEMSFSDPG  786

Query  59   WRIVEGAVLKS  27
            W+IVEG+VL+S
Sbjct  787  WKIVEGSVLES  797



>ref|XP_003545049.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X1 [Glycine max]
Length=794

 Score =   273 bits (697),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 164/306 (54%), Positives = 215/306 (70%), Gaps = 5/306 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG   SPLAAAAAIA+IGAEATAV+  V+ S I AL+K  P+G  +
Sbjct  489  YYDDPTVLRYLERLEGGSNSPLAAAAAIAKIGAEATAVISQVQASVINALKKAFPVGSED  548

Query  749  TSVRRHGNS----FYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVV  582
              V+   N     F  +   + L   D+  P N      ++  + ++ E ITE+IK   V
Sbjct  549  QIVKHQVNGVNEDFGFSESENPLILSDQDSPVNAEVSGIKNTMETRKGEFITEEIKHASV  608

Query  581  KITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGP-SKVEVSEEVPRME  405
            +I  AGV +GL+TL+GLKFL  R  S ILRK  GS++ +D +++G     E  E++P+M+
Sbjct  609  QIMCAGVVIGLVTLVGLKFLPTRNGSPILRKMTGSAMVSDTINLGSLGDEEKVEQLPKMD  668

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            AR AE+LVRKWQ++KS+A GPDH L +L E+LDG+MLK+WTDRAAEIA+ GW +DYTL++
Sbjct  669  ARVAEALVRKWQSVKSEAFGPDHCLGRLHEVLDGEMLKIWTDRAAEIAERGWSYDYTLED  728

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVE  45
            L IDSVT+S +GRRA+VE TL+ES  L    HP+HD S S TYTTRYE+S   + W+IVE
Sbjct  729  LNIDSVTISQNGRRAVVETTLKESTHLNAVGHPQHDASNSRTYTTRYEMSFTGAEWKIVE  788

Query  44   GAVLKS  27
            GAVL+S
Sbjct  789  GAVLES  794



>ref|XP_003589356.1| hypothetical protein MTR_1g023310 [Medicago truncatula]
 gb|AES59607.1| protein accumulation AND replication OFs protein [Medicago truncatula]
Length=796

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 162/306 (53%), Positives = 215/306 (70%), Gaps = 5/306 (2%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPL-GDG  753
            YYDDP VLRYLERLEG G SPLAAAAAIA+IGAEATAV+  V+ S I+AL++V P+  D 
Sbjct  491  YYDDPTVLRYLERLEGAGHSPLAAAAAIAKIGAEATAVIGHVQASVIKALKRVFPVRSDN  550

Query  752  ET---SVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVV  582
            +     V    +    +   D L   D+  P N+     ++ ++  +   IT++IK+  V
Sbjct  551  KILTYEVNGEKDHSSLSENEDPLRLSDQNPPVNVEVSGIKNTAEINDGNFITDEIKNASV  610

Query  581  KITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGP-SKVEVSEEVPRME  405
            KI  AGVA+GL+TL GLK L ++  S +L K  GS++ +D +++GP    E+ E++P+M 
Sbjct  611  KIMCAGVAIGLITLAGLKILPSKNGSPVLHKVTGSAIASDTINLGPVGDEELGEQLPKMS  670

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            A  AE+LVRKWQ IKSQA GPDH L +L E+LDG+MLK+WTDRAAEIA+ GW +DY L++
Sbjct  671  AMVAEALVRKWQYIKSQAFGPDHCLGRLQEVLDGEMLKIWTDRAAEIAELGWSYDYNLED  730

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVE  45
            L IDSVT+S +GRRA+VE TL+ES  LT   HP+H  S S TYTTRYE+S   SGW+I+E
Sbjct  731  LNIDSVTISQNGRRAVVETTLKESTHLTAVGHPQHATSNSRTYTTRYEMSFSDSGWKIIE  790

Query  44   GAVLKS  27
            GAVL+S
Sbjct  791  GAVLES  796



>ref|XP_003549451.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X1 [Glycine max]
Length=793

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 160/308 (52%), Positives = 217/308 (70%), Gaps = 9/308 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDD  VLRYLERLEG   SPLAAAAAI +IGAEATAV+  V+ S + AL+KV P+G  +
Sbjct  488  YYDDSTVLRYLERLEGGSHSPLAAAAAIVKIGAEATAVISQVQASVMNALKKVFPVGSED  547

Query  749  TSVRRHGNSF---YTATESDE---LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
              V+   N     +  +ES+    LS  D +    ++G   ++ ++  E E ITE+IK+ 
Sbjct  548  QIVKHQVNGVNEDFGFSESENPVILSDQDSSVNAEVSGI--KNTTETSEGEFITEEIKNA  605

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGP-SKVEVSEEVPR  411
             V+I  AGV +GL+TL+GLKFL +R    +L K  GS++ +D +++G     E  E++P+
Sbjct  606  SVQIMCAGVVIGLVTLVGLKFLPSRNGLPMLCKTTGSAMASDTINLGSLGDEEKVEQLPK  665

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+AR AE+LVRKWQ++KS+A GPDH + +L E+LDG+MLK+WTDRA EIA+ GW +DYTL
Sbjct  666  MDARVAEALVRKWQSVKSEAFGPDHCMGRLHEVLDGEMLKIWTDRAGEIAERGWSYDYTL  725

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
            ++L IDSVT+S +GRRA+VE TL+ES  L    HP+HD S S TYTTRYE+S    GW+I
Sbjct  726  EDLNIDSVTISQNGRRAVVETTLKESIHLNAIGHPQHDASNSRTYTTRYEMSFTGPGWKI  785

Query  50   VEGAVLKS  27
            VEGAVL+S
Sbjct  786  VEGAVLES  793



>gb|KHN12665.1| Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 6, chloroplastic 
[Glycine soja]
Length=836

 Score =   265 bits (676),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 218/308 (71%), Gaps = 9/308 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDD  VLRYLERLEG   SPLAAAAAIA+IGAEATAV+  V+ S + AL+KV P+G  +
Sbjct  531  YYDDSTVLRYLERLEGGSNSPLAAAAAIAKIGAEATAVISQVQASVMNALKKVFPVGSED  590

Query  749  TSVRRHGNSF---YTATESDE---LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
              V+   N     +  +ES+    LS  D +    ++G   ++ ++  E E ITE+IK+ 
Sbjct  591  QIVKHQVNGVNEDFGFSESENPVILSDQDSSVNAEVSGI--KNTTETSEGEFITEEIKNA  648

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGP-SKVEVSEEVPR  411
             V+I  AGV +GL+TL+GLKFL +R    +L K  GS++ +D +++G     E  E++P+
Sbjct  649  SVQIMCAGVVIGLVTLVGLKFLPSRNGLPMLCKTTGSAMASDTINLGSLGDEEKVEQLPK  708

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+AR AE+LVRKWQ++KS+A GPDH + +L E+LDG+MLK+WTDRA EIA+ GW +DYTL
Sbjct  709  MDARVAEALVRKWQSVKSEAFGPDHCMGRLHEVLDGEMLKIWTDRAGEIAERGWSYDYTL  768

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
            ++L IDSVT+S +GRRA+VE TL+ES  L    HP+HD S S TYTTRYE+S    GW+I
Sbjct  769  EDLNIDSVTISQNGRRAVVETTLKESIHLNAIGHPQHDASNSRTYTTRYEMSFTGPGWKI  828

Query  50   VEGAVLKS  27
            VEGAVL+S
Sbjct  829  VEGAVLES  836



>ref|XP_002510483.1| heat shock protein binding protein, putative [Ricinus communis]
 gb|EEF52670.1| heat shock protein binding protein, putative [Ricinus communis]
Length=781

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 205/305 (67%), Gaps = 13/305 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiari--gaeatAVLDSVKVSAIQALQKVIPLGD  756
            YYDDP VL YLE LEG GG PL A+AA        EATAV+D VK SAIQALQKV P+  
Sbjct  485  YYDDPTVLGYLENLEG-GGRPLLASAADIVRIGAEEATAVIDHVKASAIQALQKVFPISQ  543

Query  755  GETSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKI  576
              T +R  G ++     +DE  H +   P+  A  +    ++  E +++T++  D +VKI
Sbjct  544  KGTGLRNGGMNYPFPAIADE-EHQELLDPDVKAEISGEHNAEVIE-DLVTDRRTDTIVKI  601

Query  575  TSAGVAVGLLTLIGLKFLS--NRADSSILRKDDGSSVTADVVSIGPSKVEVS-EEVPRME  405
               GV +GL+T  GLK L   NR  + I     G ++ +D +S+G S  + S EE PRM+
Sbjct  602  MCTGVTIGLVTFFGLKCLPVRNRQCNEI-----GPAMASDTISVGFSLDDKSVEEFPRMD  656

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            ARFAE +VRKWQNIKSQA G DH L KL E+LDGQMLK WTDRAAE+ Q GW +DYTL +
Sbjct  657  ARFAEGIVRKWQNIKSQAFGSDHSLGKLHEVLDGQMLKTWTDRAAEVEQLGWVYDYTLLD  716

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVE  45
            LT+DSV VS+DG+ A+VEAT++ESA L DA HPE++ S  TTYTTRYE+SC   GW+I E
Sbjct  717  LTVDSVIVSLDGQHAVVEATIKESACLIDAVHPENNASNITTYTTRYEMSCSNLGWKITE  776

Query  44   GAVLK  30
            GA++K
Sbjct  777  GAIIK  781



>ref|XP_006854866.1| hypothetical protein AMTR_s00182p00037730 [Amborella trichopoda]
 gb|ERN16333.1| hypothetical protein AMTR_s00182p00037730 [Amborella trichopoda]
Length=795

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 212/307 (69%), Gaps = 10/307 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP+VL YLE LE  GGSPLAAAAAI RIG  ATA LD+VK SA+QAL+KV PLG+ +
Sbjct  493  YYDDPIVLSYLEGLEKGGGSPLAAAAAIVRIGQGATAALDNVKTSAMQALKKVFPLGNRD  552

Query  749  TSVRRHGN--SFYTATES---DELSHGDK-TFPENMAGFAERSPSDDQEQEMITEKIKDL  588
               R   +  + Y   E    DE+  G      E++A  A  S    + QE++ + IK++
Sbjct  553  ERKRERDDVPTVYELEEKVSMDEIDQGSSGALAEDIA--ATTSDEYGETQEIMADSIKEV  610

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRM  408
             +K+  AGV VGL  ++GLK +  R  S    K+  S++ A  +S          E+PRM
Sbjct  611  GIKVMCAGVVVGLAVIVGLKLVPARWGSLFSGKETPSALAA--ISEPEENASSVAEIPRM  668

Query  407  EARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQ  228
            +AR AE++VRKWQ+IKSQALG  H L KL E+L+GQMLK+W +RAAEIAQHGWFW+YTL 
Sbjct  669  DARLAENIVRKWQDIKSQALGRRHDLAKLPEVLEGQMLKIWRERAAEIAQHGWFWEYTLL  728

Query  227  NLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIV  48
             L I+S+TVS DGRRA+VE TLEE A+LTD  +PE++DSYST+YTTRYE+S    GW+IV
Sbjct  729  GLNIESITVSADGRRALVEVTLEEGARLTDDKNPENNDSYSTSYTTRYEMSFLDKGWKIV  788

Query  47   EGAVLKS  27
            EGAVLKS
Sbjct  789  EGAVLKS  795



>ref|XP_006403374.1| hypothetical protein EUTSA_v10003151mg [Eutrema salsugineum]
 gb|ESQ44827.1| hypothetical protein EUTSA_v10003151mg [Eutrema salsugineum]
Length=801

 Score =   254 bits (648),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 208/322 (65%), Gaps = 27/322 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPL----  762
            YYDDPMVL YLER+E V GSPLAAAAA+AR+GA      + VK SA+QALQKV P     
Sbjct  486  YYDDPMVLSYLERVEVVQGSPLAAAAAMARMGA------EHVKASAMQALQKVFPSRYSD  539

Query  761  GDGETSVRRHGNSFYTATESDELSHGDKT---------FPENM--------AGFAERSPS  633
            G G         +F      + + H D+T           EN         +G ++ S  
Sbjct  540  GIGTEPKDVQETAFTVDPVGNRVGHDDETVVSTGEAERLSENFDTNDYAIRSGVSKSSID  599

Query  632  DDQEQEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVS  453
                ++ + +K+K++ VK+ SAGV +G+++L GL+FL  ++ SS  RKD  SS  +D+ +
Sbjct  600  AVTAEKSVADKVKEVSVKVLSAGVVIGMISLAGLRFLPLKSSSSFQRKDMASSTASDIAT  659

Query  452  IGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRA  273
            +G  K E SE +PRM+AR AESLV KWQ IKSQA G DH +EKL E+LDG+MLK+WTDRA
Sbjct  660  VGSVKAEDSEALPRMDARTAESLVCKWQKIKSQAFGRDHCIEKLPEVLDGRMLKIWTDRA  719

Query  272  AEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttyt  93
             E AQ G  +DYTL  +++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYT
Sbjct  720  TETAQLGLVYDYTLLKVSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYT  779

Query  92   TRYELSCGKSGWRIVEGAVLKS  27
            TRYE    K+GW+I EG+VL S
Sbjct  780  TRYEAFWSKTGWKITEGSVLTS  801



>ref|XP_010494186.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Camelina sativa]
Length=800

 Score =   251 bits (640),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 207/322 (64%), Gaps = 27/322 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDPMVL YLER+E V GSPLAAAAA+AR+GA      + VK SA+QALQKV P    +
Sbjct  485  YYDDPMVLSYLERVEVVQGSPLAAAAAMARMGA------EHVKASALQALQKVFPSRYAD  538

Query  749  --------------------TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSD  630
                                 +V   G      TE++  S    T+   + G   +S +D
Sbjct  539  RTSDEPKDAQETVYSVDLVGNNVGHDGEPAVFITENERPSENVDTYDYVVQGGVSKSSTD  598

Query  629  DQE-QEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVS  453
                 + I + +K+  VKI +AGVA+G++ L   K+L  R+ SS  RKD  SS+ +D+ +
Sbjct  599  AVTVDKSIADMVKEASVKILAAGVAIGMILLFTQKYLPLRSSSSFQRKDMASSMESDIAT  658

Query  452  IGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRA  273
            IG ++ E SE +PRM+AR AES+V KWQ IKSQA G DHR+E L E+LDG+M+K+WTDRA
Sbjct  659  IGAARTEDSEALPRMDARTAESIVSKWQKIKSQAFGHDHRIEMLPEVLDGRMMKIWTDRA  718

Query  272  AEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttyt  93
            AE AQ G  +DYTL  L++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYT
Sbjct  719  AETAQLGLVYDYTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYT  778

Query  92   TRYELSCGKSGWRIVEGAVLKS  27
            TRYE+   KSGW+I EG+VL S
Sbjct  779  TRYEVFWSKSGWKITEGSVLAS  800



>gb|KFK32921.1| hypothetical protein AALP_AA6G306600 [Arabis alpina]
Length=794

 Score =   250 bits (638),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 164/319 (51%), Positives = 212/319 (66%), Gaps = 24/319 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIP-----  765
            YYDDPMVL YLER+E V GSPLAAAAA+ARIGA      + VK SA+QALQKV P     
Sbjct  482  YYDDPMVLSYLERVEVVQGSPLAAAAAMARIGA------EHVKASAMQALQKVFPSRNAD  535

Query  764  -----LGDGETSVR----RHGNSFYTATESDELSHGDKTFPEN-MAGFAERSPSDDQE--  621
                 L D + +V     R G+   T+    E     ++F +N  A  AE S S      
Sbjct  536  RSSAELKDAQETVDSVGDRAGDDGETSVFIAEAERPSESFDKNDYAIRAEVSKSSIGAVT  595

Query  620  -QEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGP  444
             ++   +K+K+  VKI SAGV +G+++L GLK++  +++SS+ RK+  SSV +D+  IG 
Sbjct  596  VEKSTADKVKEASVKILSAGVVIGMISLAGLKYMQFKSNSSLQRKNMASSVASDITPIGS  655

Query  443  SKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEI  264
             K + S  +PRM+AR AESLV KWQ IKSQA G DH +E L E+LDG+MLK+WTDRAAE 
Sbjct  656  VKADDSVALPRMDARTAESLVSKWQKIKSQAFGHDHCIEMLPEVLDGRMLKIWTDRAAET  715

Query  263  AQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRY  84
            A+ G  +DYTL  L++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYTTRY
Sbjct  716  AKLGLVYDYTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYTTRY  775

Query  83   ELSCGKSGWRIVEGAVLKS  27
            E+   KSGW+I EG+VL S
Sbjct  776  EVFWSKSGWKITEGSVLTS  794



>ref|XP_006280025.1| hypothetical protein CARUB_v10025901mg [Capsella rubella]
 gb|EOA12923.1| hypothetical protein CARUB_v10025901mg [Capsella rubella]
Length=770

 Score =   249 bits (635),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 155/302 (51%), Positives = 201/302 (67%), Gaps = 22/302 (7%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDPMVL YLER+E V GSPLAAAAA+AR+GA      + VK SA+QALQKV P     
Sbjct  490  YYDDPMVLSYLERVEVVQGSPLAAAAAMARMGA------EHVKASAMQALQKVFP-----  538

Query  749  TSVRRHGNSFYTATESDELSHGDKT-FPENMAGFAERSPSDDQEQEMITEKIKDLVVKIT  573
                    S +    SDE     +T F  N  G       D    + I + +K+ +VKI 
Sbjct  539  --------SRFADRTSDEPKDAQETVFSVNPVG--NNIDHDVTVDKSIADMVKEAIVKIL  588

Query  572  SAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFA  393
            +AGVA+G++ L   ++L  ++ SS  RKD  S++ +D+ + G ++ E SE +PRM+AR A
Sbjct  589  AAGVAIGVIALFTQRYLPPKSSSSFQRKDMASTMESDMATTGSARTEDSEALPRMDARTA  648

Query  392  ESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTID  213
            ES+V KWQ IKSQA G DHR+E L E+LDG+MLK+WTDRAAE AQ G  +DYTL  L++D
Sbjct  649  ESIVSKWQKIKSQAFGHDHRIELLPEVLDGRMLKIWTDRAAETAQLGLVYDYTLLKLSVD  708

Query  212  SVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGAVL  33
            SVT+S DG RA+VEATLEESA L+D  HPE++ +   TYTTRYE+   KSGW+I EG+VL
Sbjct  709  SVTISADGTRALVEATLEESACLSDLVHPENNATDVRTYTTRYEVFWSKSGWKITEGSVL  768

Query  32   KS  27
             S
Sbjct  769  AS  770



>ref|XP_010535302.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Tarenaya hassleriana]
 ref|XP_010535303.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Tarenaya hassleriana]
 ref|XP_010535304.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Tarenaya hassleriana]
 ref|XP_010535305.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Tarenaya hassleriana]
Length=804

 Score =   249 bits (635),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 158/324 (49%), Positives = 204/324 (63%), Gaps = 29/324 (9%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDPMVL YLER+E V GSPLAAAAA+ARIGA      + VK SAIQALQKV P  + +
Sbjct  487  YYDDPMVLSYLERVEVVQGSPLAAAAAMARIGA------EHVKASAIQALQKVFPPREVD  540

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFA---ERSPSDDQE--------------  621
                 H             S G+    E+   F+      PS++ +              
Sbjct  541  GISGTHKEDIQETVLPFSYSGGNLGPEESQNNFSVEESEGPSENCDSRGSVVQSEVLKNG  600

Query  620  ------QEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADV  459
                  +  I +++KD  VKI SAGV +G++TL GLKFL  ++ SS+   D GS++ +D+
Sbjct  601  IHDIHVENSIADRVKDASVKIASAGVVLGVITLAGLKFLPAKSSSSVPLNDMGSAMASDI  660

Query  458  VSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTD  279
             + G +  E SE  PRM AR AE+LVR WQNIKSQA G  HR++ L E+LDG+MLK+WTD
Sbjct  661  GATGTAVAEDSEAFPRMNARTAENLVRTWQNIKSQAFGQAHRIDMLPEVLDGRMLKIWTD  720

Query  278  RAAEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsystt  99
            RAAE +Q G  +DYTL   +IDSVTVS DG RA+VEATLEESA+LTD  HPE++ +   T
Sbjct  721  RAAETSQLGLVYDYTLMKFSIDSVTVSADGNRALVEATLEESARLTDLVHPENNATDVRT  780

Query  98   ytTRYELSCGKSGWRIVEGAVLKS  27
            YTTRYE +  KSGW+I +G+VL +
Sbjct  781  YTTRYEATRSKSGWKITQGSVLTT  804



>ref|XP_006403373.1| hypothetical protein EUTSA_v10003151mg [Eutrema salsugineum]
 gb|ESQ44826.1| hypothetical protein EUTSA_v10003151mg [Eutrema salsugineum]
Length=799

 Score =   247 bits (631),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 207/322 (64%), Gaps = 29/322 (9%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPL----  762
            YYDDPMVL YLER+E V GSPLAAAAA+AR+GA      + VK SA+QALQKV P     
Sbjct  486  YYDDPMVLSYLERVEVVQGSPLAAAAAMARMGA------EHVKASAMQALQKVFPSRYSD  539

Query  761  GDGETSVRRHGNSFYTATESDELSHGDKT---------FPENM--------AGFAERSPS  633
            G G         +F      + + H D+T           EN         +G ++ S  
Sbjct  540  GIGTEPKDVQETAFTVDPVGNRVGHDDETVVSTGEAERLSENFDTNDYAIRSGVSKSSID  599

Query  632  DDQEQEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVS  453
                ++ + +K+K++ VK+ SAGV +G+++L GL+FL  ++ SS  RKD  SS  +D+ +
Sbjct  600  AVTAEKSVADKVKEVSVKVLSAGVVIGMISLAGLRFLPLKSSSSFQRKDMASSTASDIAT  659

Query  452  IGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRA  273
            +   K E SE +PRM+AR AESLV KWQ IKSQA G DH +EKL E+LDG+MLK+WTDRA
Sbjct  660  V--VKAEDSEALPRMDARTAESLVCKWQKIKSQAFGRDHCIEKLPEVLDGRMLKIWTDRA  717

Query  272  AEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttyt  93
             E AQ G  +DYTL  +++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYT
Sbjct  718  TETAQLGLVYDYTLLKVSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYT  777

Query  92   TRYELSCGKSGWRIVEGAVLKS  27
            TRYE    K+GW+I EG+VL S
Sbjct  778  TRYEAFWSKTGWKITEGSVLTS  799



>ref|XP_010535306.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X2 [Tarenaya hassleriana]
Length=801

 Score =   245 bits (626),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 203/324 (63%), Gaps = 32/324 (10%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDPMVL YLER+E V GSPLAAAAA+ARIGA      + VK SAIQALQKV P  + +
Sbjct  487  YYDDPMVLSYLERVEVVQGSPLAAAAAMARIGA------EHVKASAIQALQKVFPPREVD  540

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFA---ERSPSDDQE--------------  621
                 H             S G+    E+   F+      PS++ +              
Sbjct  541  GISGTHKEDIQETVLPFSYSGGNLGPEESQNNFSVEESEGPSENCDSRGSVVQSEVLKNG  600

Query  620  ------QEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADV  459
                  +  I +++KD  VKI SAGV +G++TL GLKFL  ++ SS+   D GS++ +D 
Sbjct  601  IHDIHVENSIADRVKDASVKIASAGVVLGVITLAGLKFLPAKSSSSVPLNDMGSAMASD-  659

Query  458  VSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTD  279
              IG +  E SE  PRM AR AE+LVR WQNIKSQA G  HR++ L E+LDG+MLK+WTD
Sbjct  660  --IGATVAEDSEAFPRMNARTAENLVRTWQNIKSQAFGQAHRIDMLPEVLDGRMLKIWTD  717

Query  278  RAAEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsystt  99
            RAAE +Q G  +DYTL   +IDSVTVS DG RA+VEATLEESA+LTD  HPE++ +   T
Sbjct  718  RAAETSQLGLVYDYTLMKFSIDSVTVSADGNRALVEATLEESARLTDLVHPENNATDVRT  777

Query  98   ytTRYELSCGKSGWRIVEGAVLKS  27
            YTTRYE +  KSGW+I +G+VL +
Sbjct  778  YTTRYEATRSKSGWKITQGSVLTT  801



>gb|AAQ18646.1| division protein [Arabidopsis thaliana]
Length=801

 Score =   245 bits (625),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 206/322 (64%), Gaps = 28/322 (9%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIP-----  765
            YYDDPMVL YLER+E V GSPLAAAA +ARIGA      + VK SA+QALQKV P     
Sbjct  487  YYDDPMVLSYLERVEVVQGSPLAAAATMARIGA------EHVKASAMQALQKVFPSRYTD  540

Query  764  --------LGDGETSVRRHGNSFYTATESD----ELSHGDKTFPEN----MAGFAERSPS  633
                    + +   SV   GN+     E      E     + F  N     AG +E S  
Sbjct  541  RNSAEPKDVQETVFSVDPVGNNVGRDGEPGVFIAEAVRPSENFETNDYAIRAGVSESSVD  600

Query  632  DDQEQEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVS  453
            +   +  + E +K+  VKI +AGVA+GL++L   K+   ++ SS  RKD  SS+ +DV +
Sbjct  601  ETTVEMSVAEMLKEASVKILAAGVAIGLISLFSQKYFL-KSSSSFQRKDMVSSMESDVAT  659

Query  452  IGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRA  273
            IG  + + SE +PRM+AR AE++V KWQ IKS A GPDHR+E L E+LDG+MLK+WTDRA
Sbjct  660  IGSVRADDSEALPRMDARTAENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRA  719

Query  272  AEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttyt  93
            AE AQ G  +DYTL  L++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYT
Sbjct  720  AETAQLGLVYDYTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYT  779

Query  92   TRYELSCGKSGWRIVEGAVLKS  27
            TRYE+   KSGW+I EG+VL S
Sbjct  780  TRYEVFWSKSGWKITEGSVLAS  801



>ref|XP_002865514.1| hypothetical protein ARALYDRAFT_494787 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41773.1| hypothetical protein ARALYDRAFT_494787 [Arabidopsis lyrata subsp. 
lyrata]
Length=800

 Score =   244 bits (623),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 207/322 (64%), Gaps = 27/322 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIP-----  765
            YYDDPMVL YLER+E V GSPLAAAAA+ARIGA      + VK SA+QALQKV P     
Sbjct  485  YYDDPMVLNYLERVEVVQGSPLAAAAAMARIGA------EHVKASAMQALQKVFPSRYAD  538

Query  764  -----LGDGETSVRR--H-----GNSFYTATESDELSHGDKTFPEN----MAGFAERSPS  633
                   D + +V R  H     G+    A  + E     + F  N     AG ++ S  
Sbjct  539  RTSAEPKDAQETVLRVDHVGNNVGHDGEPAVFNAEAERPSENFETNDYAIRAGVSKSSVD  598

Query  632  DDQEQEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVS  453
                   + + +K+  VKI +AGVA+G+++L   K+L  ++ SS  RKD  SS+ +D+ +
Sbjct  599  AINVNMSVADMLKEASVKILAAGVAIGMISLFSQKYLPIKSSSSFQRKDMASSMESDIAT  658

Query  452  IGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRA  273
            IG  + + SE +PRM+AR AES+V KWQ IKSQA G DHR++ L E+LDG+MLK+WTDRA
Sbjct  659  IGSVRADDSEALPRMDARTAESIVSKWQKIKSQAFGHDHRIDMLPEVLDGRMLKIWTDRA  718

Query  272  AEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttyt  93
             E AQ G  +DYTL  L++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYT
Sbjct  719  VETAQLGLVYDYTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYT  778

Query  92   TRYELSCGKSGWRIVEGAVLKS  27
            TRYE+   KSGW+I EG+VL S
Sbjct  779  TRYEVFWSKSGWKITEGSVLAS  800



>gb|AAQ18645.1| division protein [Arabidopsis thaliana]
Length=801

 Score =   244 bits (622),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 206/322 (64%), Gaps = 28/322 (9%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIP-----  765
            YYDDPMVL YLER+E V GSPLAAAA +ARIGA      + VK SA+QALQKV P     
Sbjct  487  YYDDPMVLSYLERVEVVQGSPLAAAATMARIGA------EHVKASAMQALQKVFPSRYTD  540

Query  764  --------LGDGETSVRRHGNSFYTATESD----ELSHGDKTFPEN----MAGFAERSPS  633
                    + +   SV   GN+     E      E     + F  N     AG +E S  
Sbjct  541  RNSAEPKDVQETVFSVDPVGNNVGRDGEPGVFIAEAVRPSENFETNDYAIRAGVSESSVD  600

Query  632  DDQEQEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVS  453
            +   +  + + +K+  VKI +AGVA+GL++L   K+   ++ SS  RKD  SS+ +DV +
Sbjct  601  ETTVEMSVADMLKEASVKILAAGVAIGLISLFSQKYFL-KSSSSFQRKDMVSSMESDVAT  659

Query  452  IGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRA  273
            IG  + + SE +PRM+AR AE++V KWQ IKS A GPDHR+E L E+LDG+MLK+WTDRA
Sbjct  660  IGSVRADDSEALPRMDARTAENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRA  719

Query  272  AEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttyt  93
            AE AQ G  +DYTL  L++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYT
Sbjct  720  AETAQLGLVYDYTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYT  779

Query  92   TRYELSCGKSGWRIVEGAVLKS  27
            TRYE+   KSGW+I EG+VL S
Sbjct  780  TRYEVFWSKSGWKITEGSVLAS  801



>ref|XP_006280026.1| hypothetical protein CARUB_v10025901mg [Capsella rubella]
 gb|EOA12924.1| hypothetical protein CARUB_v10025901mg [Capsella rubella]
Length=805

 Score =   243 bits (621),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 158/325 (49%), Positives = 207/325 (64%), Gaps = 33/325 (10%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIP--LGD  756
            YYDDPMVL YLER+E V GSPLAAAAA+AR+GA      + VK SA+QALQKV P    D
Sbjct  490  YYDDPMVLSYLERVEVVQGSPLAAAAAMARMGA------EHVKASAMQALQKVFPSRFAD  543

Query  755  GET-----------SVRRHGNS---------FYTATE--SDELSHGDKTFPENMAGFAER  642
              +           SV   GN+         F T TE  S+     D        G  + 
Sbjct  544  RTSDEPKDAQETVFSVNPVGNNIDHDGEPAVFITETERPSENFDANDYAV---RGGILKN  600

Query  641  SPSDDQEQEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTAD  462
            +       + I + +K+ +VKI +AGVA+G++ L   ++L  ++ SS  RKD  S++ +D
Sbjct  601  TIETVTVDKSIADMVKEAIVKILAAGVAIGVIALFTQRYLPPKSSSSFQRKDMASTMESD  660

Query  461  VVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWT  282
            + + G ++ E SE +PRM+AR AES+V KWQ IKSQA G DHR+E L E+LDG+MLK+WT
Sbjct  661  MATTGSARTEDSEALPRMDARTAESIVSKWQKIKSQAFGHDHRIELLPEVLDGRMLKIWT  720

Query  281  DRAAEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsyst  102
            DRAAE AQ G  +DYTL  L++DSVT+S DG RA+VEATLEESA L+D  HPE++ +   
Sbjct  721  DRAAETAQLGLVYDYTLLKLSVDSVTISADGTRALVEATLEESACLSDLVHPENNATDVR  780

Query  101  tytTRYELSCGKSGWRIVEGAVLKS  27
            TYTTRYE+   KSGW+I EG+VL S
Sbjct  781  TYTTRYEVFWSKSGWKITEGSVLAS  805



>ref|NP_199063.1| protein accumulation and replication of chloroplasts 6 [Arabidopsis 
thaliana]
 sp|Q9FIG9.1|ARC6_ARATH RecName: Full=Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10489.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13895.1| unknown protein [Arabidopsis thaliana]
 gb|AAN12907.1| unknown protein [Arabidopsis thaliana]
 gb|AED94815.1| protein accumulation and replication of chloroplasts 6 [Arabidopsis 
thaliana]
Length=801

 Score =   242 bits (618),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 207/322 (64%), Gaps = 28/322 (9%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIP-----  765
            YYDDPMVL YLER+E V GSPLAAAAA+ARIGA      + VK SA+QALQKV P     
Sbjct  487  YYDDPMVLSYLERVEVVQGSPLAAAAAMARIGA------EHVKASAMQALQKVFPSRYTD  540

Query  764  --------LGDGETSVRRHGNSFYTATESD----ELSHGDKTFPEN----MAGFAERSPS  633
                    + +   SV   GN+     E      E     + F  N     AG +E S  
Sbjct  541  RNSAEPKDVQETVFSVDPVGNNVGRDGEPGVFIAEAVRPSENFETNDYAIRAGVSESSVD  600

Query  632  DDQEQEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVS  453
            +   +  + + +K+  VKI +AGVA+GL++L   K+   ++ SS  RKD  SS+ +DV +
Sbjct  601  ETTVEMSVADMLKEASVKILAAGVAIGLISLFSQKYFL-KSSSSFQRKDMVSSMESDVAT  659

Query  452  IGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRA  273
            IG  + + SE +PRM+AR AE++V KWQ IKS A GPDHR+E L E+LDG+MLK+WTDRA
Sbjct  660  IGSVRADDSEALPRMDARTAENIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRA  719

Query  272  AEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttyt  93
            AE AQ G  +DYTL  L++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYT
Sbjct  720  AETAQLGLVYDYTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYT  779

Query  92   TRYELSCGKSGWRIVEGAVLKS  27
            TRYE+   KSGW+I EG+VL S
Sbjct  780  TRYEVFWSKSGWKITEGSVLAS  801



>ref|XP_009101846.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X1 [Brassica rapa]
 emb|CDY22390.1| BnaA06g37120D [Brassica napus]
Length=783

 Score =   240 bits (612),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 206/309 (67%), Gaps = 14/309 (5%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIP--LGD  756
            YYDDPMVL YLER+E V GSPLAAAAA+AR+GA      + VK SAIQALQKV P    D
Sbjct  481  YYDDPMVLSYLERVEVVQGSPLAAAAAMARMGA------EHVKASAIQALQKVFPSRYSD  534

Query  755  GE---TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDD--QEQEMITEKIKD  591
             +   ++V R GN+     ++D+ +       E  +   +   S D    ++   +K+K+
Sbjct  535  AQETVSTVDRAGNNNVGHDDADDETAVLSAATEGPSEIFDTKSSVDAITVEQSNADKLKE  594

Query  590  LVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPR  411
              VKI SAGV VG+++L  L+++S +  SS+ RKD  SS  +++ +IG  K E S  +PR
Sbjct  595  ASVKILSAGVVVGIISLASLRYMSLKGSSSLQRKDMTSSTASEIATIGSVKSEDSVALPR  654

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+AR AESLV KWQ IKSQA G DH +E L E+LDG+MLK+WTDRA+E  Q G  +DYTL
Sbjct  655  MDARTAESLVSKWQKIKSQAFGRDHCIEMLPEVLDGRMLKIWTDRASETKQLGLVYDYTL  714

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS-GWR  54
              L++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYTTRYE    KS GW+
Sbjct  715  LKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYTTRYEAFWSKSGGWK  774

Query  53   IVEGAVLKS  27
            I EG+VL S
Sbjct  775  ITEGSVLAS  783



>emb|CDY61131.1| BnaCnng37370D [Brassica napus]
Length=782

 Score =   234 bits (597),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 162/310 (52%), Positives = 205/310 (66%), Gaps = 18/310 (6%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIP--LGD  756
            YYDDPMVL YLER+E V GSPLAAAAA+AR+GA      +  K SAIQALQKV P    D
Sbjct  482  YYDDPMVLSYLERVEVVQGSPLAAAAAMARMGA------EHAKASAIQALQKVFPSRYSD  535

Query  755  GE---TSVRRHGNSF-YTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMIT-EKIKD  591
             +   ++V   GN+  +   E+  LS   +   E    F  +S  D    E    +K+K+
Sbjct  536  AQETVSTVDHAGNNVGHDVDETAVLSAATEGASEI---FDTKSSVDAITVEKSNADKLKE  592

Query  590  LVVKITSAGVAVGLLTLIGLKFLSNRADSSIL-RKDDGSSVTADVVSIGPSKVEVSEEVP  414
              VKI SAGV VG+++L  L+++S +  SS L RKD  SS  +++ +IGP K E S  +P
Sbjct  593  ASVKILSAGVVVGIISLASLRYMSIKGGSSSLQRKDMTSSTASEIGTIGPVKSEDSVALP  652

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            RM+AR AESLV KWQ IKSQA G DH +E L E+LDG+MLK+WTDRA+E  Q G  +DYT
Sbjct  653  RMDARTAESLVSKWQKIKSQAFGRDHCIEMLPEVLDGRMLKIWTDRASETKQLGLVYDYT  712

Query  233  LQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS-GW  57
            L  L++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYTTRYE    KS GW
Sbjct  713  LLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYTTRYEAFWSKSGGW  772

Query  56   RIVEGAVLKS  27
            +I EG+VL S
Sbjct  773  KITEGSVLTS  782



>ref|XP_010481984.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like [Camelina sativa]
Length=192

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 145/191 (76%), Gaps = 0/191 (0%)
 Frame = -1

Query  599  IKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEE  420
            +K+  VKI +AGVA+G+++L   K+L  R+ SS  RKD  SS+ +D+ +IG ++ E SE 
Sbjct  2    VKEASVKILAAGVAIGMISLFTQKYLPQRSSSSFQRKDMPSSMESDIATIGSARTEDSEA  61

Query  419  VPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWD  240
            +PRM+AR AES+V KWQ IKSQA G DHR+E L E+LDG+MLK+WTDRAAE AQ G  +D
Sbjct  62   LPRMDARTAESIVSKWQKIKSQAFGHDHRIEMLPEVLDGRMLKIWTDRAAETAQLGLVYD  121

Query  239  YTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG  60
            YTL  L++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYTTRYE+   KSG
Sbjct  122  YTLLKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYTTRYEVFWSKSG  181

Query  59   WRIVEGAVLKS  27
            W+I EG+VL S
Sbjct  182  WKITEGSVLAS  192



>ref|XP_009101847.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic isoform X2 [Brassica rapa]
Length=781

 Score =   233 bits (595),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 157/309 (51%), Positives = 205/309 (66%), Gaps = 16/309 (5%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIP--LGD  756
            YYDDPMVL YLER+E V GSPLAAAAA+AR+GA      + VK SAIQALQKV P    D
Sbjct  481  YYDDPMVLSYLERVEVVQGSPLAAAAAMARMGA------EHVKASAIQALQKVFPSRYSD  534

Query  755  GE---TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDD--QEQEMITEKIKD  591
             +   ++V R GN+     ++D+ +       E  +   +   S D    ++   +K+K+
Sbjct  535  AQETVSTVDRAGNNNVGHDDADDETAVLSAATEGPSEIFDTKSSVDAITVEQSNADKLKE  594

Query  590  LVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPR  411
              VKI SAGV VG+++L  L+++S +  SS+ RKD  SS  +++ +I   K E S  +PR
Sbjct  595  ASVKILSAGVVVGIISLASLRYMSLKGSSSLQRKDMTSSTASEIATI--VKSEDSVALPR  652

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+AR AESLV KWQ IKSQA G DH +E L E+LDG+MLK+WTDRA+E  Q G  +DYTL
Sbjct  653  MDARTAESLVSKWQKIKSQAFGRDHCIEMLPEVLDGRMLKIWTDRASETKQLGLVYDYTL  712

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS-GWR  54
              L++DSVTVS DG RA+VEATLEESA L+D  HPE++ +   TYTTRYE    KS GW+
Sbjct  713  LKLSVDSVTVSADGTRALVEATLEESACLSDLVHPENNATDVRTYTTRYEAFWSKSGGWK  772

Query  53   IVEGAVLKS  27
            I EG+VL S
Sbjct  773  ITEGSVLAS  781



>gb|ADE75665.1| unknown [Picea sitchensis]
Length=586

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 154/331 (47%), Positives = 210/331 (63%), Gaps = 39/331 (12%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDD  VL YLERLE   GSPLAAAAAI RIGA A A L +VK SAIQ L+KV PLG+  
Sbjct  265  YYDDSSVLSYLERLEKGRGSPLAAAAAIVRIGAGAGAALGNVKASAIQTLKKVFPLGNKR  324

Query  749  TSVRRHGNSFYT-ATESD-------------------ELSHGDKTFPENMAGFAERSPSD  630
                   N   T +TE+                     +S+GD +   + + F++ +   
Sbjct  325  GGKEARANIAPTISTEAKSTIDLPHKDYPNSDIYKQPRMSNGDISNLSDASEFSKPTTES  384

Query  629  ---------DQEQEMITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADS-SILRKDDG  480
                     ++E  +++++I    VKI  AGV VG+L + GL +L  +  S   L++   
Sbjct  385  WGENSGAMGEEELFLLSKRIGSFGVKIVCAGVVVGVLAIAGLGYLPGQHSSMKTLKEVPF  444

Query  479  SSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQ  300
            S+   D ++ G          P+M+AR AE+LVRKWQ +KSQALGP+H + +LSEILDGQ
Sbjct  445  STTIGDNLNYG---------APKMDARLAENLVRKWQMLKSQALGPNHAVSRLSEILDGQ  495

Query  299  MLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEH  120
            MLK+W++RA +IA+HGWFW+Y+L  LTI+SVTVS DG RA+VEATL+E+A+L D +HPEH
Sbjct  496  MLKIWSERAKDIAEHGWFWEYSLLGLTIESVTVSTDGMRAMVEATLQEAARLIDTSHPEH  555

Query  119  ddsysttytTRYELSCGKSGWRIVEGAVLKS  27
            +DSY +TYTTRYE++  K  W+I +GAVL+S
Sbjct  556  NDSYRSTYTTRYEMTNVKGTWKITDGAVLRS  586



>ref|XP_002453221.1| hypothetical protein SORBIDRAFT_04g001860 [Sorghum bicolor]
 gb|EES06197.1| hypothetical protein SORBIDRAFT_04g001860 [Sorghum bicolor]
Length=762

 Score =   229 bits (583),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 197/303 (65%), Gaps = 23/303 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLER+EG G S LAAAAAIA++GA+ATA L +VK SA+QA  KV PL +  
Sbjct  481  YYDDPKVLSYLERMEGGGASHLAAAAAIAKLGAQATAALGTVKSSALQAFSKVFPLIE--  538

Query  749  TSVRRHGNSFYTATESDELSHG-DKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKIT  573
              + R G      T  D+L    +K   E++AG A                 K+  +KI 
Sbjct  539  -QLDRSGKD----TPGDDLEKSLEKLAQESVAGDA-------------IHDSKNAALKII  580

Query  572  SAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFA  393
            SAG    L  +IGLK L  +     L+ + GS   AD V  G    E   E+PRM+A+ A
Sbjct  581  SAGALFALFAVIGLKCLPRKKSLPALKSEYGSVAVADSVD-GLGADEEPLEIPRMDAKLA  639

Query  392  ESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTID  213
            E +VRKWQ+IKS+ALGP+H +  L EILDG MLKVW DRA EI +HGWFW+YTL ++TID
Sbjct  640  EDIVRKWQSIKSKALGPEHTVTALQEILDGNMLKVWMDRATEIERHGWFWEYTLSDVTID  699

Query  212  SVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS-GWRIVEGAV  36
            S+TVS+DGRRA VEAT+EE  QLTD A P+++D+Y T YT RYE+S  KS GWRI EGAV
Sbjct  700  SITVSMDGRRATVEATIEEMGQLTDVADPKNNDAYDTKYTARYEMSYSKSGGWRITEGAV  759

Query  35   LKS  27
            LKS
Sbjct  760  LKS  762



>dbj|BAH01566.1| unnamed protein product [Oryza sativa Japonica Group]
Length=552

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 199/304 (65%), Gaps = 25/304 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLER+EG G S LAAAAAIA++GA+ATA L +VK +AIQA  KV PL    
Sbjct  271  YYDDPEVLSYLERMEGGGASHLAAAAAIAKLGAQATAALGTVKSNAIQAFNKVFPL----  326

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
              + +   S    T+      G   + EN     E +P+ D          ++  +KI S
Sbjct  327  --IEQLDRSAMENTKD-----GPGGYLENFD--QENAPAHDS---------RNAALKIIS  368

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVV--SIGPSKVEVSEEVPRMEARF  396
            AG    LL +IG K+L  +   S +R + GS   A+ V  +  P+  E    +PRM+A+ 
Sbjct  369  AGALFALLAVIGAKYLPRKRPLSAIRSEHGSVAVANSVDSTDDPALDEDPVHIPRMDAKL  428

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE +VRKWQ+IKS+ALGP+H +  L E+LDG MLKVWTDRAAEI +HGWFW+YTL ++TI
Sbjct  429  AEDIVRKWQSIKSKALGPEHSVASLQEVLDGNMLKVWTDRAAEIERHGWFWEYTLSDVTI  488

Query  215  DSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK-SGWRIVEGA  39
            DS+T+S+DGRRA VEAT++E+ QLTD   P ++DSY T YTTRYE++  K  GW+I EGA
Sbjct  489  DSITISLDGRRATVEATIDEAGQLTDVTEPRNNDSYDTKYTTRYEMAFSKLGGWKITEGA  548

Query  38   VLKS  27
            VLKS
Sbjct  549  VLKS  552



>ref|XP_004952074.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like [Setaria italica]
Length=762

 Score =   224 bits (572),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 198/305 (65%), Gaps = 27/305 (9%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLER+EG G S LAAAAAIA++GA+ATA L SVK SA+QA  KV PL    
Sbjct  481  YYDDPKVLSYLERMEGGGASHLAAAAAIAKLGAQATAALGSVKSSALQAFSKVFPL----  536

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKI---KDLVVK  579
                            ++L   DK   +N +   E+S  +  +Q +  + I   K+  +K
Sbjct  537  ---------------MEQLDRSDK---DNPSDDIEKSLENLAQQNVTGDDIHDSKNTALK  578

Query  578  ITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEAR  399
            I SAG    L  +IGLK L  +     +R +  S   AD VS GP+  E   E PRM+A+
Sbjct  579  IISAGALFALFAVIGLKCLPRKKSLPAVRSEYESVAVADSVS-GPAVDEEPLEFPRMDAK  637

Query  398  FAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLT  219
             AE +VRKWQ+IKS+ALGP+H +  L E+LDG MLKVW+DRA EI +HGWFW+YTL ++T
Sbjct  638  LAEDIVRKWQSIKSKALGPEHSVPALQEVLDGNMLKVWSDRATEIERHGWFWEYTLSDVT  697

Query  218  IDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS-GWRIVEG  42
            IDSVTVSVDGRRA VE T+EE  QLTD A  +++DSY T YTTRYE++  KS GW I EG
Sbjct  698  IDSVTVSVDGRRATVEVTIEEVGQLTDVADSKNNDSYDTKYTTRYEMAYSKSGGWMITEG  757

Query  41   AVLKS  27
            AVLKS
Sbjct  758  AVLKS  762



>tpg|DAA01472.1| TPA_exp: plastid division protein precursor [Oryza sativa (indica 
cultivar-group)]
 dbj|BAD07942.1| plastid division protein precursor [Oryza sativa Japonica Group]
Length=760

 Score =   223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 199/304 (65%), Gaps = 25/304 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLER+EG G S LAAAAAIA++GA+ATA L +VK +AIQA  KV PL    
Sbjct  479  YYDDPEVLSYLERMEGGGASHLAAAAAIAKLGAQATAALGTVKSNAIQAFNKVFPL----  534

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
              + +   S    T+      G   + EN     E +P+ D          ++  +KI S
Sbjct  535  --IEQLDRSAMENTKD-----GPGGYLENFD--QENAPAHDS---------RNAALKIIS  576

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVV--SIGPSKVEVSEEVPRMEARF  396
            AG    LL +IG K+L  +   S +R + GS   A+ V  +  P+  E    +PRM+A+ 
Sbjct  577  AGALFALLAVIGAKYLPRKRPLSAIRSEHGSVAVANSVDSTDDPALDEDPVHIPRMDAKL  636

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE +VRKWQ+IKS+ALGP+H +  L E+LDG MLKVWTDRAAEI +HGWFW+YTL ++TI
Sbjct  637  AEDIVRKWQSIKSKALGPEHSVASLQEVLDGNMLKVWTDRAAEIERHGWFWEYTLSDVTI  696

Query  215  DSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK-SGWRIVEGA  39
            DS+T+S+DGRRA VEAT++E+ QLTD   P ++DSY T YTTRYE++  K  GW+I EGA
Sbjct  697  DSITISLDGRRATVEATIDEAGQLTDVTEPRNNDSYDTKYTTRYEMAFSKLGGWKITEGA  756

Query  38   VLKS  27
            VLKS
Sbjct  757  VLKS  760



>gb|EEC72377.1| hypothetical protein OsI_05646 [Oryza sativa Indica Group]
 gb|EEE56207.1| hypothetical protein OsJ_05178 [Oryza sativa Japonica Group]
Length=769

 Score =   223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 152/304 (50%), Positives = 199/304 (65%), Gaps = 25/304 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLER+EG G S LAAAAAIA++GA+ATA L +VK +AIQA  KV PL    
Sbjct  488  YYDDPEVLSYLERMEGGGASHLAAAAAIAKLGAQATAALGTVKSNAIQAFNKVFPL----  543

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
              + +   S    T+      G   + EN     E +P+ D          ++  +KI S
Sbjct  544  --IEQLDRSAMENTKD-----GPGGYLENFD--QENAPAHDS---------RNAALKIIS  585

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVV--SIGPSKVEVSEEVPRMEARF  396
            AG    LL +IG K+L  +   S +R + GS   A+ V  +  P+  E    +PRM+A+ 
Sbjct  586  AGALFALLAVIGAKYLPRKRPLSAIRSEHGSVAVANSVDSTDDPALDEDPVHIPRMDAKL  645

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE +VRKWQ+IKS+ALGP+H +  L E+LDG MLKVWTDRAAEI +HGWFW+YTL ++TI
Sbjct  646  AEDIVRKWQSIKSKALGPEHSVASLQEVLDGNMLKVWTDRAAEIERHGWFWEYTLSDVTI  705

Query  215  DSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK-SGWRIVEGA  39
            DS+T+S+DGRRA VEAT++E+ QLTD   P ++DSY T YTTRYE++  K  GW+I EGA
Sbjct  706  DSITISLDGRRATVEATIDEAGQLTDVTEPRNNDSYDTKYTTRYEMAFSKLGGWKITEGA  765

Query  38   VLKS  27
            VLKS
Sbjct  766  VLKS  769



>gb|EMS50085.1| hypothetical protein TRIUR3_08207 [Triticum urartu]
Length=704

 Score =   220 bits (560),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 195/306 (64%), Gaps = 27/306 (9%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLE +EG G S LAAAAAIA++GA+ATA L +VK SAIQA  K+ PL    
Sbjct  420  YYDDPKVLSYLEMMEGGGASHLAAAAAIAKLGAQATAALGTVKSSAIQAFNKIFPL----  475

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKD---LVVK  579
                              +   D++  EN     E S +   ++ ++   I+D     +K
Sbjct  476  ------------------IEQLDRSDMENANDGPEESVNKFDQKTIMGFDIRDSKNAALK  517

Query  578  ITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVV-SIGPSKVEVSEEVPRMEA  402
            I SA     L+T+IG+K+L        +R +  S   A+VV S+     +   ++PRM+A
Sbjct  518  IVSASALFALMTVIGMKYLPRNKVLPAIRSEHESMTVANVVDSVDDDAPDEPMQIPRMDA  577

Query  401  RFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNL  222
              AE +VRKWQ+IKS+ALG DH LE L E+LDG MLKVW DRAAEI + GWFWDYTL ++
Sbjct  578  NLAEGIVRKWQSIKSKALGSDHSLESLQEVLDGNMLKVWRDRAAEIERKGWFWDYTLSDV  637

Query  221  TIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELS-CGKSGWRIVE  45
             IDS+TVS+DGRRA VEAT+EE+ QLTDAA+P ++D Y T YTTRYE++  G  GW+I E
Sbjct  638  AIDSITVSLDGRRATVEATIEEAGQLTDAANPRNNDLYDTKYTTRYEMTFTGPGGWKITE  697

Query  44   GAVLKS  27
            GAVLKS
Sbjct  698  GAVLKS  703



>ref|XP_003573630.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Brachypodium distachyon]
Length=761

 Score =   220 bits (560),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 153/303 (50%), Positives = 202/303 (67%), Gaps = 25/303 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLE +EG G S LAAAAAIA++GA+ATA L +VK SA+QA  KV PL    
Sbjct  482  YYDDPKVLSYLEMMEGGGASHLAAAAAIAKLGAQATAALGTVKSSALQAFSKVFPL----  537

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
              + R      +A E+ +    +++  EN AG+                  K+  +KI S
Sbjct  538  --IERLD---LSAMENPD-DGLEQSLEENGAGYD-------------IYGSKNAALKIVS  578

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVV-SIGPSKVEVSEEVPRMEARFA  393
            A     LLT+IGLK++  +     +R +  S   ADVV S+    ++ S ++PRM+A+ A
Sbjct  579  ASAFFALLTVIGLKYMPRKRVLPAMRSEHESVAVADVVNSVDDHALDESIQIPRMDAKLA  638

Query  392  ESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTID  213
            E +VRKWQ+IKS+ALG DH +  L E+LDG MLKVWTDRAAEI ++GWFWDY L ++TID
Sbjct  639  EDIVRKWQSIKSKALGSDHSVASLQEVLDGNMLKVWTDRAAEIERNGWFWDYKLSDVTID  698

Query  212  SVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS-GWRIVEGAV  36
            S+TVS+DGRRA VEAT+EE+ QLTD  +P+++DSY T YTTRYE++  KS GW+I EGAV
Sbjct  699  SITVSMDGRRATVEATIEEAGQLTDVTNPKNNDSYDTKYTTRYEMTFAKSGGWKITEGAV  758

Query  35   LKS  27
            LKS
Sbjct  759  LKS  761



>dbj|BAK04117.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 152/307 (50%), Positives = 196/307 (64%), Gaps = 28/307 (9%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLE +EG G S LAAAAAIA++GA+ATA L +VK SAIQA  K+ PL    
Sbjct  300  YYDDPKVLSYLEMMEGGGASHLAAAAAIAKLGAQATAALGTVKSSAIQAFNKIFPL----  355

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMA-GFAERSPSDDQEQEMITEKI--KDLVVK  579
                              +   D++  EN   G  E     DQ+  M  + +  K+  +K
Sbjct  356  ------------------IEQLDRSAMENPNDGLEESVNKFDQKNIMGFDILDSKNAFLK  397

Query  578  ITSAGVAVGLLTLIGLKFLS-NRADSSILRKDDGSSVTADVV-SIGPSKVEVSEEVPRME  405
            I SA     LLT+IG+K+L   +     +R +  S   A+VV S+   + +   ++P+M+
Sbjct  398  IVSASALFALLTVIGMKYLPRKKVLLPAIRSEHESVAVANVVDSVDDDEPDEPIQIPKMD  457

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            A+ AE +VRKWQ+IKS+ALG DH +  L E+LDG MLKVWTDRAAEI + GWFWDYTL N
Sbjct  458  AKLAEDIVRKWQSIKSKALGSDHSVASLQEVLDGNMLKVWTDRAAEIERKGWFWDYTLFN  517

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELS-CGKSGWRIV  48
            + IDS+TVS+DGRRA VEAT+EE+ QLTDA  P +DD Y T YTTRYE++  G  GW+I 
Sbjct  518  VAIDSITVSLDGRRATVEATIEEAGQLTDATDPRNDDLYDTKYTTRYEMAFTGPGGWKIT  577

Query  47   EGAVLKS  27
            EGAVLKS
Sbjct  578  EGAVLKS  584



>gb|AFW66593.1| hypothetical protein ZEAMMB73_835383 [Zea mays]
Length=630

 Score =   214 bits (544),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 193/303 (64%), Gaps = 23/303 (8%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLER+EG G S LAAAAAIA++GA+ATA L +VK SA+QA  KV PL +  
Sbjct  349  YYDDPKVLSYLERMEGGGASHLAAAAAIAKLGAQATAALGTVKSSALQAFSKVFPLTE--  406

Query  749  TSVRRHGNSFYTATESDELSHG-DKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKIT  573
              +   G        SD+L    +K    ++AG A     +D              +KI 
Sbjct  407  -QLDMSGKDI----PSDDLDKSLEKLAQGSVAGDAIHDSRND-------------ALKII  448

Query  572  SAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFA  393
            SAG  + L  ++GLK L        LR + GS    D +  GP+  E   E+PRM+A+ A
Sbjct  449  SAGTLLALFAVLGLKCLPRNKSLPALRGEYGSVAVVDSID-GPAADEEPLEIPRMDAKLA  507

Query  392  ESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTID  213
            E +VR+WQ+IKS+ALGP+H +  L E+L G MLKVW DRAAEI +HGWFW+Y L  +TID
Sbjct  508  EDIVRRWQSIKSKALGPEHTVTALQEVLGGNMLKVWADRAAEIERHGWFWEYALSGVTID  567

Query  212  SVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK-SGWRIVEGAV  36
            S+TVSVDGRRA VEAT+EE  +LTD   P++DD+Y T YT RYE++  + +GWRI EGAV
Sbjct  568  SITVSVDGRRAAVEATIEEVGRLTDVTDPKNDDAYDTKYTARYEMTYSRPAGWRITEGAV  627

Query  35   LKS  27
            L+S
Sbjct  628  LRS  630



>ref|XP_006646807.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like [Oryza brachyantha]
Length=633

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 150/307 (49%), Positives = 196/307 (64%), Gaps = 28/307 (9%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDD  VL YLER+EG G S LAAAAAIA++GA+ATA L +VK +AIQA  KV PL    
Sbjct  349  YYDDLKVLSYLERMEGGGASHLAAAAAIAKLGAQATAALGTVKSNAIQAFNKVFPL----  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSD-DQEQEM--ITEKIKDLVVK  579
                              +   DK+  EN     E S  + DQE  +  +T   ++  +K
Sbjct  405  ------------------IEQLDKSAMENPKDGPEGSLQNFDQENALGPVTHDSRNAALK  446

Query  578  ITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVV-SIG-PSKVEVSEEVPRME  405
            I SAG    L  +IG K+L  +     ++ + GS   A+ V SI  P+  E    +PRM+
Sbjct  447  ILSAGALFALFVVIGAKYLPRKRPLPAIKSEYGSVAAANSVDSIDDPALDEDPVHIPRMD  506

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
             + A+ +VRKWQ+IKS+ALGP+H +  L E+LDG MLKVW  RAAEI +HGWFW+YTL +
Sbjct  507  VKLAQDIVRKWQSIKSKALGPEHSVASLQEVLDGNMLKVWAGRAAEIERHGWFWEYTLSD  566

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK-SGWRIV  48
            +TIDS+TVS+DGRRA VEAT+EE+ QLTD   PE++DSY T YTTRYE++  K  GW+I 
Sbjct  567  VTIDSITVSLDGRRATVEATIEEAGQLTDVTEPENNDSYDTKYTTRYEMAFSKLGGWKIT  626

Query  47   EGAVLKS  27
            EGAVL+S
Sbjct  627  EGAVLRS  633



>ref|NP_001148117.1| LOC100281725 [Zea mays]
 gb|ACF86369.1| unknown [Zea mays]
 gb|ACG29776.1| division protein [Zea mays]
 gb|ACN27652.1| unknown [Zea mays]
 gb|AFW66594.1| division protein [Zea mays]
Length=761

 Score =   214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 195/315 (62%), Gaps = 47/315 (15%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLER+EG G S LAAAAAIA++GA+ATA L +VK SA+QA  KV PL    
Sbjct  480  YYDDPKVLSYLERMEGGGASHLAAAAAIAKLGAQATAALGTVKSSALQAFSKVFPL----  535

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKI---------  597
                         TE  ++S  D              PSDD ++ +  EK+         
Sbjct  536  -------------TEQLDMSGKD-------------IPSDDLDKSL--EKLAQGSVAGDA  567

Query  596  ----KDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEV  429
                ++  +KI SAG  + L  ++GLK L        LR + GS    D +  GP+  E 
Sbjct  568  IHDSRNDALKIISAGTLLALFAVLGLKCLPRNKSLPALRGEYGSVAVVDSID-GPAADEE  626

Query  428  SEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGW  249
              E+PRM+A+ AE +VR+WQ+IKS+ALGP+H +  L E+L G MLKVW DRAAEI +HGW
Sbjct  627  PLEIPRMDAKLAEDIVRRWQSIKSKALGPEHTVTALQEVLGGNMLKVWADRAAEIERHGW  686

Query  248  FWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCG  69
            FW+Y L  +TIDS+TVSVDGRRA VEAT+EE  +LTD   P++DD+Y T YT RYE++  
Sbjct  687  FWEYALSGVTIDSITVSVDGRRAAVEATIEEVGRLTDVTDPKNDDAYDTKYTARYEMTYS  746

Query  68   K-SGWRIVEGAVLKS  27
            + +GWRI EGAVL+S
Sbjct  747  RPAGWRITEGAVLRS  761



>dbj|BAJ84942.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=769

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 151/307 (49%), Positives = 195/307 (64%), Gaps = 28/307 (9%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLE +EG G S LAAAAAIA++GA+ATA L +VK SAIQA  K+ PL    
Sbjct  484  YYDDPKVLSYLEMMEGGGASHLAAAAAIAKLGAQATAALGTVKSSAIQAFNKIFPL----  539

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMA-GFAERSPSDDQEQEMITEKI--KDLVVK  579
                              +   D++  EN   G  E     DQ+  M  + +  K+  +K
Sbjct  540  ------------------IEQLDRSAMENPNDGLEESVNKFDQKNIMGFDILDSKNAFLK  581

Query  578  ITSAGVAVGLLTLIGLKFLS-NRADSSILRKDDGSSVTADVV-SIGPSKVEVSEEVPRME  405
            I SA     LLT+IG+K+L   +     +R +  S   A+VV S+   + +   ++P+M+
Sbjct  582  IVSASALFALLTVIGMKYLPRKKVLLPAIRSEHESVAVANVVDSVDDDEPDEPIQIPKMD  641

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            A+ AE +VRKWQ+IKS+ALG DH +  L E+LDG MLKVWTDRAAEI + GWFWDYTL N
Sbjct  642  AKLAEDIVRKWQSIKSKALGSDHSVASLQEVLDGNMLKVWTDRAAEIERKGWFWDYTLFN  701

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELS-CGKSGWRIV  48
            + IDS+TVS+DGRRA VEAT+EE+ QLTDA  P +DD Y T YTTRY ++  G  GW+I 
Sbjct  702  VAIDSITVSLDGRRATVEATIEEAGQLTDATDPRNDDLYDTKYTTRYGMAFTGPGGWKIT  761

Query  47   EGAVLKS  27
            EGAVLKS
Sbjct  762  EGAVLKS  768



>gb|AIU49256.1| ARC6, partial [Erythranthe guttata]
Length=544

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 150/297 (51%), Positives = 163/297 (55%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SP+AAAAAIA+IG        +VKVSAI ALQ         
Sbjct  366  YYDDPTVLRYLERLE----SPVAAAAAIAKIG--------AVKVSAIHALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP                            VKI  
Sbjct  405  -----------------------KVFPAT--------------------------VKIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGVAVGLLT++GLKFL                                   PRM+ARFAE
Sbjct  416  AGVAVGLLTILGLKFLP----------------------------------PRMDARFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            SLV KWQN+KS ALGPDH LEKLSE+LDGQMLK+WT+RAAEIAQHGWFWDY L NL IDS
Sbjct  442  SLVCKWQNVKSLALGPDHCLEKLSEVLDGQMLKIWTERAAEIAQHGWFWDYQLVNLNIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVSVDGRRAIVEATLEESA       PEH     +TYTTRYE+    SGW+IVEGA
Sbjct  502  VTVSVDGRRAIVEATLEESA-------PEH---NDSTYTTRYEM----SGWKIVEGA  544



>gb|AIU49271.1| ARC6, partial [Vitis vinifera]
Length=544

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 147/297 (49%), Positives = 162/297 (55%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLAAAAAIARIG        +VK SAIQALQ         
Sbjct  366  YYDDPTVLRYLERLE----SPLAAAAAIARIG--------AVKASAIQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI  
Sbjct  405  -----------------------KVFPAS--------------------------VKIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
             GV VGL+TLIGLK+L                                   PRM+ARFAE
Sbjct  416  GGVVVGLMTLIGLKYLP----------------------------------PRMDARFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
             LVRKWQ+IKSQALGPDH L KL E+LDGQMLK+WTDRAA+IAQHGWFW+YTL NLTIDS
Sbjct  442  GLVRKWQSIKSQALGPDHCLGKLPEVLDGQMLKIWTDRAADIAQHGWFWEYTLLNLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS+DGRRA+VEATLEESA       PEH     +TYTTRYE+    SGW+I EGA
Sbjct  502  VTVSLDGRRAMVEATLEESA-------PEH---NDSTYTTRYEM----SGWKITEGA  544



>gb|AIU49275.1| ARC6, partial [Platanus x acerifolia]
Length=544

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 158/297 (53%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDD  VLRYLERLE    SPLAAAAAI R        + +VK SAIQALQ         
Sbjct  366  YYDDSTVLRYLERLE----SPLAAAAAIVR--------IGAVKTSAIQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI  
Sbjct  405  -----------------------KVFPAS--------------------------VKIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
             GV VGLLT+ GLK+L                                   PRM+ARFAE
Sbjct  416  GGVLVGLLTMAGLKYLP----------------------------------PRMDARFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            +LVRKWQN+KSQALGPDH + KL E+L+GQMLK+WTDRAAEIAQHGWFW+YTL  LTIDS
Sbjct  442  TLVRKWQNVKSQALGPDHYVSKLPEVLEGQMLKIWTDRAAEIAQHGWFWEYTLLGLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS+DGRRA+VEATLEE+A       PEH     +TYTTRYE+    SGW+I EGA
Sbjct  502  VTVSLDGRRALVEATLEEAA-------PEH---NDSTYTTRYEM----SGWKITEGA  544



>gb|AIU49230.1| ARC6, partial [Magnolia denudata]
Length=544

 Score =   192 bits (488),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 145/297 (49%), Positives = 159/297 (54%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLAAAAAIARIG        +VK SAIQALQ         
Sbjct  366  YYDDPTVLRYLERLE----SPLAAAAAIARIG--------AVKTSAIQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP                            VKI  
Sbjct  405  -----------------------KVFPAT--------------------------VKIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGV VGLLTL GLK+L                                   PRM+ARFAE
Sbjct  416  AGVVVGLLTLAGLKYLP----------------------------------PRMDARFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            SLVRKWQ+IKSQALGPDH L KL E+L+GQMLK+WTDRAAEIAQHGWFW+YTL  LTIDS
Sbjct  442  SLVRKWQDIKSQALGPDHCLVKLPEVLEGQMLKIWTDRAAEIAQHGWFWEYTLLGLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS+DGR A+VEATLEE+A       PEH     +TYTTRYE+    SGW+I  GA
Sbjct  502  VTVSLDGRWAMVEATLEEAA-------PEH---NDSTYTTRYEM----SGWKITTGA  544



>gb|AIU49274.1| ARC6, partial [Cinnamomum camphora]
Length=544

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 141/297 (47%), Positives = 160/297 (54%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLAAAAAIA+IG        +VK +AI+ALQ         
Sbjct  366  YYDDPTVLRYLERLE----SPLAAAAAIAKIG--------AVKTTAIKALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP                            VKI  
Sbjct  405  -----------------------KVFPAT--------------------------VKIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
             GV VGLLTL GLK+L                                   PRM+ARFAE
Sbjct  416  GGVVVGLLTLAGLKYLP----------------------------------PRMDARFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            SLVRKWQ+IKS+ALGPDH L+KL E+L+GQMLK+W DRA+EIAQHGWFWDYTL  LTIDS
Sbjct  442  SLVRKWQSIKSEALGPDHCLDKLPEVLEGQMLKIWMDRASEIAQHGWFWDYTLLGLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS+DGRRAIVEATLEE+A       PEH     +TYTTRYE+    +GW+I EGA
Sbjct  502  VTVSLDGRRAIVEATLEEAA-------PEH---GDSTYTTRYEM----TGWKITEGA  544



>gb|AIU49268.1| ARC6, partial [Solanum lycopersicum]
Length=544

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 142/297 (48%), Positives = 157/297 (53%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLAAAAAIARIG        +VK SAIQALQ         
Sbjct  366  YYDDPTVLRYLERLE----SPLAAAAAIARIG--------AVKASAIQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP ++                          KI  
Sbjct  405  -----------------------KVFPASL--------------------------KIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGVAVG  TL+GLK  S                                  PRM+AR AE
Sbjct  416  AGVAVGFFTLVGLKLSS----------------------------------PRMDARLAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            S+VRKWQNIKSQ+LG DH L +LSE+LDGQMLK+WTDRA EIAQHGWFW+Y L NL IDS
Sbjct  442  SIVRKWQNIKSQSLGTDHCLNRLSEVLDGQMLKIWTDRAREIAQHGWFWEYKLLNLAIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS DGRRA VEATLEESA       PEH     +TYTTRY++    SGW+IVEGA
Sbjct  502  VTVSADGRRATVEATLEESA-------PEH---NDSTYTTRYDM----SGWKIVEGA  544



>gb|AIU49258.1| ARC6, partial [Solanum tuberosum]
Length=544

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 141/297 (47%), Positives = 157/297 (53%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLAAAAAIARIG        +VK SAIQALQ         
Sbjct  366  YYDDPTVLRYLERLE----SPLAAAAAIARIG--------AVKASAIQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI  
Sbjct  405  -----------------------KVFPAS--------------------------VKIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGVA+G LTL+GLK  S                                  PRM+AR AE
Sbjct  416  AGVAIGFLTLVGLKLSS----------------------------------PRMDARLAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            S+VRKWQNIKSQ+LG DH L +LSE+LDGQMLK+WTDRA EIAQHGWFW+Y L NL IDS
Sbjct  442  SIVRKWQNIKSQSLGTDHCLNRLSEVLDGQMLKIWTDRATEIAQHGWFWEYKLLNLAIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS DGRRA VEATLEESA       PE+     + YTTRY++    SGW+IVEGA
Sbjct  502  VTVSADGRRATVEATLEESA-------PEN---NDSIYTTRYDM----SGWKIVEGA  544



>gb|AIU49245.1| ARC6, partial [Buxus sinica]
Length=544

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 139/298 (47%), Positives = 156/298 (52%), Gaps = 120/298 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLAAAAAIARIG        +VK SAIQALQKV       
Sbjct  366  YYDDPTVLRYLERLE----SPLAAAAAIARIG--------AVKTSAIQALQKV-------  406

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                     FP +M                          KI  
Sbjct  407  -------------------------FPASM--------------------------KIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGV VG LTL GLKFL                                   PRM+ARFAE
Sbjct  416  AGVVVGALTLAGLKFLP----------------------------------PRMDARFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
             LVRKWQN+KSQALGPDH + KL E+L+G+MLK+WT+RAAEIAQ GWFW+YTL  LTIDS
Sbjct  442  YLVRKWQNVKSQALGPDHCMGKLPEVLEGRMLKIWTERAAEIAQQGWFWEYTLSGLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESA-QLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS+DGRRA VEATLEESA +  D+ +           TTRYE+    S W+I EGA
Sbjct  502  VTVSIDGRRATVEATLEESAPKRNDSTY-----------TTRYEM----SDWKITEGA  544



>gb|AIU49238.1| ARC6, partial [Gossypium raimondii]
Length=544

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 156/297 (53%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLAAAAAI R        + +VK SAIQALQ         
Sbjct  366  YYDDPTVLRYLERLE----SPLAAAAAIVR--------IGAVKASAIQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI S
Sbjct  405  -----------------------KVFPAS--------------------------VKIMS  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGV +G++TL+GLKFLS                                  PRM+AR AE
Sbjct  416  AGVVIGVMTLVGLKFLS----------------------------------PRMDARIAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
             +VRKWQNIKS+A GPDHRL+KL E+LDGQMLK WTDRAAEIAQ GW ++Y+L N+ IDS
Sbjct  442  GIVRKWQNIKSEAFGPDHRLDKLPEVLDGQMLKTWTDRAAEIAQLGWVYEYSLLNMAIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VT+S+DG+RA+VEATLEES    +A+           YTTRYE+    SGW+I EG+
Sbjct  502  VTLSLDGQRAVVEATLEESTSENNASS----------YTTRYEM----SGWKITEGS  544



>gb|AIU49226.1| ARC6, partial [Aquilegia coerulea]
Length=544

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 157/297 (53%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP+VL+YLER E    SPLAAAAAI R        + +VK SAI AL+KV       
Sbjct  366  YYDDPIVLKYLERQE----SPLAAAAAIVR--------IGAVKASAILALRKV-------  406

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                     FP ++                          KI S
Sbjct  407  -------------------------FPASL--------------------------KIMS  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGV +GLLT    K+L                                   PRM+ARFAE
Sbjct  416  AGVVIGLLTFGCFKYLP----------------------------------PRMDARFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            SLVRKWQ+ KSQALGPDH L  L E+L+GQMLKVWTDRAAEIAQHGWFW+YTL  LTIDS
Sbjct  442  SLVRKWQDAKSQALGPDHCLAILPEVLEGQMLKVWTDRAAEIAQHGWFWEYTLLGLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS+DGRRA+VEATLEE+A       PE+     +TYTTRYE+    SGW+I+EGA
Sbjct  502  VTVSLDGRRAMVEATLEEAA-------PEN---NDSTYTTRYEM----SGWKIIEGA  544



>gb|AIU49236.1| ARC6, partial [Sarcandra glabra]
Length=544

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 154/298 (52%), Gaps = 120/298 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLAAAAAIARIG        +VK SAIQALQ         
Sbjct  366  YYDDPTVLRYLERLE----SPLAAAAAIARIG--------AVKTSAIQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI  
Sbjct  405  -----------------------KVFPAS--------------------------VKIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
              V VGLLTL G+K+L                                   P+M+AR AE
Sbjct  416  GAVVVGLLTLAGMKYLP----------------------------------PKMDARLAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            ++VRKWQ IKSQALGPDH L KL E+L+G+MLKVW DRAAE+AQHGWFW+YTL  LTIDS
Sbjct  442  NIVRKWQEIKSQALGPDHCLTKLPEVLEGRMLKVWRDRAAEMAQHGWFWEYTLLGLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESA-QLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS+DGRRA+VEATLEESA    D+ +           TTRYE+    SGW+I EGA
Sbjct  502  VTVSLDGRRAMVEATLEESAPDCNDSTY-----------TTRYEM----SGWKITEGA  544



>gb|AIU49235.1| ARC6, partial [Acorus calamus]
Length=542

 Score =   179 bits (453),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 126/190 (66%), Gaps = 49/190 (26%)
 Frame = -1

Query  605  EKIKDLV-VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEV  429
            + +K+L  +KI  AGVAVGLLTL+GLKFL                               
Sbjct  401  QALKNLASLKIMCAGVAVGLLTLVGLKFLP------------------------------  430

Query  428  SEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGW  249
                PRM+AR AE++VRKWQ+IKSQALGPDH L KL E+L+G MLK+WTDRA+EIAQHGW
Sbjct  431  ----PRMDARLAEAVVRKWQDIKSQALGPDHCLTKLPEVLEGPMLKIWTDRASEIAQHGW  486

Query  248  FWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCG  69
            FW+YTL  LTI+SVT+S+DGRRA+VEATLEE+A       P+H     +TYTTRYE+   
Sbjct  487  FWEYTLLGLTIESVTISLDGRRAMVEATLEEAA-------PDH---RDSTYTTRYEM---  533

Query  68   KSGWRIVEGA  39
             SGW+I EGA
Sbjct  534  -SGWKITEGA  542



>ref|XP_001775455.1| predicted protein [Physcomitrella patens]
 gb|EDQ59784.1| predicted protein, partial [Physcomitrella patens]
Length=657

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 134/307 (44%), Positives = 185/307 (60%), Gaps = 37/307 (12%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            Y+DDP VL YLE LE   GS +AAAAAI RIGA A A L++VK +    L++V P+G   
Sbjct  382  YFDDPSVLSYLEGLEKGNGSHMAAAAAIVRIGAGAGAALNNVKAT----LKRVFPMG---  434

Query  749  TSVRRHGNSFYTATESDELSHGD----KTFPENMAGFAERSPSDDQEQEMITEKIKDLVV  582
                    S  + T SD L + D    + + +   G A RSPS ++              
Sbjct  435  -------RSSESTTTSDVLDNPDELPRREYHKGADGDA-RSPSLNR------------FF  474

Query  581  KITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEV--SEEVPRM  408
            +I   G+ +G L + GL++L  +   +   K      T  V S G ++ E    E VP+M
Sbjct  475  QIACGGLVLGALMIAGLRYLPLKTRPAHALKPS----TPTVSSTGITRTEALEVEVVPKM  530

Query  407  EARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQ  228
            +AR AE +VR+WQ  K++ALG  H +  L E+L+G+MLK WTDR +++ ++GWFW+YTL 
Sbjct  531  DARLAEIMVRRWQAAKARALGSAHDMAALPEVLEGEMLKSWTDRVSDVKRNGWFWEYTLL  590

Query  227  NLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIV  48
             L IDSVTVS DGRRA  EATL+E+A+L D  +P+H+DSY +TYTTRY+L  G  GWRI 
Sbjct  591  GLHIDSVTVSDDGRRATAEATLQEAARLVDRNNPDHNDSYRSTYTTRYDLRHGIDGWRIN  650

Query  47   EGAVLKS  27
             GAVL++
Sbjct  651  GGAVLRT  657



>gb|KDO84752.1| hypothetical protein CISIN_1g003752mg [Citrus sinensis]
Length=712

 Score =   180 bits (456),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 144/213 (68%), Gaps = 7/213 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiari-gaeatAVLDSVKVSAIQALQKVIPLGDG  753
            YYDDP VLRYLERLEG G SPLAAAAAI RI   EATAVLD VK S IQALQKV PLG G
Sbjct  490  YYDDPTVLRYLERLEGNGSSPLAAAAAIVRIGATEATAVLDHVKSSTIQALQKVFPLGQG  549

Query  752  ETSVR--RHGNSF--YTATESDE-LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
            + +V+   HG ++      E++E L+     F      +   S  D   ++ IT+KIKD+
Sbjct  550  DKAVKYVEHGETYDPVPVVETEESLTSDQNNFAFTTDAYGTSSSDDIHGEQSITDKIKDV  609

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVE-VSEEVPR  411
             VKI  AGVA+GL+TL+GLK+L  R  SS+ +K+ G +  +D++  GP   E + +E+PR
Sbjct  610  SVKIMCAGVAIGLVTLVGLKYLPTRNISSVQQKEIGLAKASDIIDAGPLLDEKLGQELPR  669

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEI  312
            M+AR AE +VRKWQNIKSQA GPDH L KL E+
Sbjct  670  MDARLAEDIVRKWQNIKSQAFGPDHSLGKLPEV  702



>ref|XP_006473598.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X2 [Citrus sinensis]
Length=712

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 144/213 (68%), Gaps = 7/213 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiari-gaeatAVLDSVKVSAIQALQKVIPLGDG  753
            YYDDP VLRYLERLEG G SPLAAAAAI RI   EATAVLD VK S IQALQKV PLG G
Sbjct  490  YYDDPTVLRYLERLEGNGSSPLAAAAAIVRIGATEATAVLDHVKSSTIQALQKVFPLGRG  549

Query  752  ETSVR--RHGNSF--YTATESDE-LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
            + +V+   HG ++      E++E L+     F      +   S  D   ++ IT+KIKD+
Sbjct  550  DKAVKYVEHGETYDPVPVVETEESLTSDQNNFAFTTDAYGTSSSDDIHGEQSITDKIKDV  609

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVE-VSEEVPR  411
             VKI  AGVA+GL+TL+GLK+L  R  SS+ +K+ G +  +D++  GP   E + +E+PR
Sbjct  610  SVKIMCAGVAIGLVTLVGLKYLPTRNISSVQQKEIGLAKASDIIDAGPLLDEKLGQELPR  669

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEI  312
            M+AR AE +VRKWQNIKSQA GPDH L KL E+
Sbjct  670  MDARLAEDIVRKWQNIKSQAFGPDHSLGKLPEV  702



>gb|KDO84751.1| hypothetical protein CISIN_1g003752mg [Citrus sinensis]
Length=701

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 143/212 (67%), Gaps = 7/212 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiari-gaeatAVLDSVKVSAIQALQKVIPLGDG  753
            YYDDP VLRYLERLEG G SPLAAAAAI RI   EATAVLD VK S IQALQKV PLG G
Sbjct  490  YYDDPTVLRYLERLEGNGSSPLAAAAAIVRIGATEATAVLDHVKSSTIQALQKVFPLGQG  549

Query  752  ETSVR--RHGNSF--YTATESDE-LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
            + +V+   HG ++      E++E L+     F      +   S  D   ++ IT+KIKD+
Sbjct  550  DKAVKYVEHGETYDPVPVVETEESLTSDQNNFAFTTDAYGTSSSDDIHGEQSITDKIKDV  609

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVE-VSEEVPR  411
             VKI  AGVA+GL+TL+GLK+L  R  SS+ +K+ G +  +D++  GP   E + +E+PR
Sbjct  610  SVKIMCAGVAIGLVTLVGLKYLPTRNISSVQQKEIGLAKASDIIDAGPLLDEKLGQELPR  669

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSE  315
            M+AR AE +VRKWQNIKSQA GPDH L KL E
Sbjct  670  MDARLAEDIVRKWQNIKSQAFGPDHSLGKLPE  701



>ref|XP_006473599.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X3 [Citrus sinensis]
Length=701

 Score =   178 bits (452),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 143/212 (67%), Gaps = 7/212 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiari-gaeatAVLDSVKVSAIQALQKVIPLGDG  753
            YYDDP VLRYLERLEG G SPLAAAAAI RI   EATAVLD VK S IQALQKV PLG G
Sbjct  490  YYDDPTVLRYLERLEGNGSSPLAAAAAIVRIGATEATAVLDHVKSSTIQALQKVFPLGRG  549

Query  752  ETSVR--RHGNSF--YTATESDE-LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
            + +V+   HG ++      E++E L+     F      +   S  D   ++ IT+KIKD+
Sbjct  550  DKAVKYVEHGETYDPVPVVETEESLTSDQNNFAFTTDAYGTSSSDDIHGEQSITDKIKDV  609

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVE-VSEEVPR  411
             VKI  AGVA+GL+TL+GLK+L  R  SS+ +K+ G +  +D++  GP   E + +E+PR
Sbjct  610  SVKIMCAGVAIGLVTLVGLKYLPTRNISSVQQKEIGLAKASDIIDAGPLLDEKLGQELPR  669

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSE  315
            M+AR AE +VRKWQNIKSQA GPDH L KL E
Sbjct  670  MDARLAEDIVRKWQNIKSQAFGPDHSLGKLPE  701



>gb|AIU49255.1| ARC6, partial [Manihot esculenta]
Length=544

 Score =   176 bits (446),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 130/297 (44%), Positives = 153/297 (52%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP +LRYLER E    SPLAAAAAI R        + +VK SAIQALQKV       
Sbjct  366  YYDDPTILRYLERQE----SPLAAAAAIVR--------IGAVKASAIQALQKV-------  406

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                     FP +M                          KI  
Sbjct  407  -------------------------FPASM--------------------------KIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGVA+GL+TL GLK+L                                   PRM+ RFAE
Sbjct  416  AGVAIGLMTLAGLKYLP----------------------------------PRMDTRFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
             +VRKWQNIKSQA GPDH L KL E+LDGQMLK WT+RAAEIAQ GW ++Y L +LTIDS
Sbjct  442  DMVRKWQNIKSQAFGPDHYLGKLPEVLDGQMLKTWTNRAAEIAQLGWVYEYQLLDLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS+DG+ A+VEATL+ESA   +A+          TYTTRYE+    SGW+I +GA
Sbjct  502  VTVSLDGQHAVVEATLKESAAENNAS----------TYTTRYEM----SGWKITKGA  544



>gb|AIU49265.1| ARC6, partial [Dioscorea oppositifolia]
Length=539

 Score =   176 bits (445),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 130/297 (44%), Positives = 154/297 (52%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDD  VLRYLE LE    SPLAAAAAI R        + +VK SA+QALQ         
Sbjct  361  YYDDTTVLRYLESLE----SPLAAAAAIVR--------IGTVKSSALQALQ---------  399

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI S
Sbjct  400  -----------------------KVFPAS--------------------------VKIMS  410

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGVAVGLLTL+GL+FL                                   P+M+ +FAE
Sbjct  411  AGVAVGLLTLVGLRFLP----------------------------------PKMDVKFAE  436

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            +LVRKWQNIKSQALGPDH L  L E LDG+MLK+W DRA EIA++GWFW+Y L ++TIDS
Sbjct  437  NLVRKWQNIKSQALGPDHCLADLPEALDGRMLKLWVDRATEIARYGWFWEYNLLDVTIDS  496

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            V VS+DGRRA VEAT+EE+A       PEH     +TYTTRYE+    +GW+I EGA
Sbjct  497  VIVSMDGRRATVEATIEEAA-------PEH---NDSTYTTRYEM----AGWKITEGA  539



>gb|AIU49263.1| ARC6, partial [Artemisia annua]
Length=115

 Score =   164 bits (415),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 14/129 (11%)
 Frame = -1

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
            E  PRM+ARFAE LVRKWQ++KSQALGPDH  EKLSE+LDGQMLK+W +RA E AQHGWF
Sbjct  1    ENSPRMDARFAEGLVRKWQDVKSQALGPDHCHEKLSEVLDGQMLKIWLERATEFAQHGWF  60

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            WDY+L N+TIDSVT+S+DGR A+VEATLEESA       PE+     +TYTTRYE+    
Sbjct  61   WDYSLLNMTIDSVTISLDGRLAVVEATLEESA-------PEN---NDSTYTTRYEM----  106

Query  65   SGWRIVEGA  39
            SGW+I +GA
Sbjct  107  SGWKITKGA  115



>gb|AIU49277.1| ARC6, partial [Houttuynia cordata]
Length=544

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 122/189 (65%), Gaps = 48/189 (25%)
 Frame = -1

Query  605  EKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            +K+  + VKI  AGVAVG+LTL  L++ S                               
Sbjct  404  QKVFPVTVKIMCAGVAVGVLTLGLLRYFS-------------------------------  432

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
               P+M+AR AE+LVR+WQN+KSQALGPDH LEKL E+L+GQMLK+WTDRAAEIAQHGWF
Sbjct  433  ---PKMDARLAENLVRQWQNVKSQALGPDHDLEKLPEVLEGQMLKIWTDRAAEIAQHGWF  489

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            W+Y L  LT+DSVTVS+DGRRA VEATLEE A       PEH     ++YTTRYE+    
Sbjct  490  WEYILLGLTVDSVTVSLDGRRAHVEATLEEEA-------PEH---NDSSYTTRYEM----  535

Query  65   SGWRIVEGA  39
            SGW+I EGA
Sbjct  536  SGWKISEGA  544



>gb|AIU49247.1| ARC6, partial [Chloranthus japonicus]
Length=544

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 133/298 (45%), Positives = 154/298 (52%), Gaps = 120/298 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLAAAAAIARIG        +VK SAIQALQ         
Sbjct  366  YYDDPTVLRYLERLE----SPLAAAAAIARIG--------AVKTSAIQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          V I  
Sbjct  405  -----------------------KVFPAS--------------------------VNIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
             GV VG+LTL G+K+L                                   P+M+AR AE
Sbjct  416  GGVVVGVLTLAGMKYLP----------------------------------PKMDARLAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            +LVRKWQ IKSQALGPDH L KL EIL+G+MLK+W DRAAE+AQ GWFW+YTL  LTIDS
Sbjct  442  NLVRKWQEIKSQALGPDHCLTKLPEILEGRMLKIWRDRAAEMAQQGWFWEYTLLGLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESA-QLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS+DGRRA+VEATL+ESA +  D+ +           TTRYE+    SGW+I EGA
Sbjct  502  VTVSLDGRRAMVEATLQESATEGNDSTY-----------TTRYEM----SGWKITEGA  544



>gb|AIU49249.1| ARC6, partial [Chimonanthus praecox]
Length=544

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 121/189 (64%), Gaps = 48/189 (25%)
 Frame = -1

Query  605  EKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            +K+  L VK+  AGV VGL TL GLK L+                               
Sbjct  404  QKVFPLTVKVMCAGVVVGLFTLAGLKCLT-------------------------------  432

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
               PRM+ARFAESLVRKWQNIKS+ALGP+H L KL E+L+G MLK+W DRAAEIAQHGWF
Sbjct  433  ---PRMDARFAESLVRKWQNIKSEALGPNHCLAKLPEVLEGHMLKIWKDRAAEIAQHGWF  489

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            W+YTL  LTIDSVTVS++G RA+VEATLEE+A       PE+     +TYTTRY++    
Sbjct  490  WEYTLLGLTIDSVTVSLNGCRAMVEATLEEAA-------PEN---NDSTYTTRYQM----  535

Query  65   SGWRIVEGA  39
            SGW+I EGA
Sbjct  536  SGWKITEGA  544



>gb|AIU49259.1| ARC6, partial [Populus trichocarpa]
Length=544

 Score =   174 bits (441),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 149/297 (50%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLER E    SPLAAAAAI R        + +VK SAIQALQ         
Sbjct  366  YYDDPTVLRYLERQE----SPLAAAAAIVR--------IGAVKASAIQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          +KI  
Sbjct  405  -----------------------KVFPAS--------------------------IKIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGVA+GLLTL GLK+                                    PRM+ARFAE
Sbjct  416  AGVAIGLLTLAGLKYFP----------------------------------PRMDARFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
             +VRKWQNIKSQA GPDH L KL E+LD QMLK+WTDRAAEIA  GW ++Y L +LTIDS
Sbjct  442  DIVRKWQNIKSQAFGPDHCLAKLPEVLDSQMLKIWTDRAAEIAHLGWVYEYMLLDLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVSVDG  A+VEATL+ES    +A+          TYTTRYEL    SGW+I EGA
Sbjct  502  VTVSVDGLSAVVEATLKESTPENNAS----------TYTTRYEL----SGWKITEGA  544



>gb|AIU49280.1| ARC6, partial [Trachycarpus fortunei]
Length=543

 Score =   174 bits (440),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 153/297 (52%), Gaps = 119/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLER++    SPLAAAAAIA+IG        +VK SA+QALQ         
Sbjct  366  YYDDPTVLRYLERMD----SPLAAAAAIAKIG--------AVKSSALQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP                            VKI  
Sbjct  405  -----------------------KVFPTG--------------------------VKIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AG+ VGL+TL G K+L                                   P+M+AR AE
Sbjct  416  AGIVVGLVTLAGFKYLP----------------------------------PKMDARLAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            +LVRKWQN+KSQALGPDH L KL E+LDG+MLK+WTDRAAEIAQHGWFW YTL  +T+DS
Sbjct  442  TLVRKWQNVKSQALGPDHCLTKLPEVLDGRMLKIWTDRAAEIAQHGWFWQYTLVGVTVDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            V V +DG RA VEAT++E+A       PEH     +TYTTRYE+     GW+I EGA
Sbjct  502  VIVFLDGHRATVEATIQEAA-------PEH---NDSTYTTRYEM-----GWKITEGA  543



>gb|AIU49244.1| ARC6, partial [Illicium henryi]
Length=544

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 120/189 (63%), Gaps = 48/189 (25%)
 Frame = -1

Query  605  EKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            +K+    +KI  AGV VGLL + GL +++                               
Sbjct  404  KKVLPASIKIMCAGVVVGLLAMGGLTYIA-------------------------------  432

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
               PRM+AR AESLVRKWQ+IKSQALGPDH L KL E+L+GQMLK+W DRAAEIAQHGWF
Sbjct  433  ---PRMDARLAESLVRKWQDIKSQALGPDHSLTKLPEVLEGQMLKIWKDRAAEIAQHGWF  489

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            W+YTL  LTIDSVTVS+DGRRA+VEATLEE A       PE+     ++Y+TRYE+    
Sbjct  490  WEYTLVGLTIDSVTVSMDGRRAVVEATLEEEA-------PEN---NDSSYSTRYEM----  535

Query  65   SGWRIVEGA  39
            SGW+I EGA
Sbjct  536  SGWKITEGA  544



>gb|AIU49250.1| ARC6, partial [Pandanus utilis]
Length=532

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 155/297 (52%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLE LE    SPLAAAAAI R        + +VK SA+QALQ         
Sbjct  354  YYDDPSVLRYLESLE----SPLAAAAAIVR--------VGAVKSSALQALQ---------  392

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI S
Sbjct  393  -----------------------KLFPAS--------------------------VKIMS  403

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AG  +GLLTL+GLK L                                   P+M+ARFAE
Sbjct  404  AGAVIGLLTLVGLKCLP----------------------------------PKMDARFAE  429

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            +LV KWQ+IKSQA+GP+H +  L E+LDG+MLK+W DRAAEIA+HGWFW+YTL  +T+DS
Sbjct  430  TLVHKWQDIKSQAMGPNHCVAGLPEVLDGRMLKIWADRAAEIAEHGWFWEYTLIGVTVDS  489

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VT+S+DG RA+VEAT+EE+A       PEH     +TYTTRYE+    SGW+I EG+
Sbjct  490  VTLSLDGHRAMVEATIEEAA-------PEH---NDSTYTTRYEM----SGWKITEGS  532



>ref|XP_001778770.1| predicted protein [Physcomitrella patens]
 gb|EDQ56468.1| predicted protein [Physcomitrella patens]
Length=782

 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 135/337 (40%), Positives = 188/337 (56%), Gaps = 47/337 (14%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPL-GDG  753
            Y+DDP VL YLE LE   GS +AAAAAI +IGA A A L +        L+KV P+ G+ 
Sbjct  457  YFDDPSVLSYLEGLEKGTGSHMAAAAAIVKIGAGAGAALKAT-------LKKVFPICGNN  509

Query  752  ETSVR------------RHGNSFYTATESDELSHGDKTFPENMAGFAERS--PSDDQEQE  615
            E+ +             R    F     +D    GD +F      F   +   S+++ ++
Sbjct  510  ESFITSAFLEYPVELPTRDFQQFVAHRGTD----GDPSFNGYAVDFEGENWEGSENELED  565

Query  614  MITEKIKDLV-----------VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGS---  477
             I  K K+ V           ++I  +G+  G L + GL+FL   +  + L +   S   
Sbjct  566  GIPSKAKNSVDDGSVRRSFGPIQIACSGLVFGALVMAGLRFLPLHSRVARLLESFASVGH  625

Query  476  ------SVTADVVSIGPSKVEVSE-EVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLS  318
                    T  + + G  K E  E EVP+M+AR AE +VRKWQ  K++ALGP H +  L 
Sbjct  626  SAQVPKPSTPVISTTGVRKKEAVEVEVPKMDARLAERMVRKWQAAKARALGPTHDMAALP  685

Query  317  EILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTD  138
            E+L+G+ML  WTDRA+++ ++GW W+Y L NLTID +TVS DGRRA  EATL+E+A L D
Sbjct  686  EVLEGEMLNSWTDRASDVMRNGWSWEYALLNLTIDILTVSDDGRRATAEATLQEAAHLVD  745

Query  137  AAHPEHddsysttytTRYELSCGKSGWRIVEGAVLKS  27
              +PEH+DSY  TYT RY+L  G +GWRI  GAVL++
Sbjct  746  INNPEHNDSYRDTYTARYDLRHGLNGWRIYGGAVLRT  782



>gb|AIU49231.1| ARC6, partial [Musa acuminata]
Length=544

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 123/189 (65%), Gaps = 48/189 (25%)
 Frame = -1

Query  605  EKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            +K+   V+KI SAG+ VG+LT+IG+K L                                
Sbjct  404  QKVFPAVMKIMSAGMVVGVLTMIGIKCLP-------------------------------  432

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
               P+M+ARFAE+LV KWQN+KS+ALGPDH L +L E+LDG+MLK+WTDRA EIA+HGWF
Sbjct  433  ---PKMDARFAETLVHKWQNVKSRALGPDHSLAELPEVLDGRMLKIWTDRAVEIAKHGWF  489

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            W+YTL  LTIDSVT+SVDGRRA+VEA +EE+A       PEH     +TY+TRYE+    
Sbjct  490  WEYTLLGLTIDSVTLSVDGRRAMVEARIEEAA-------PEH---NDSTYSTRYEM----  535

Query  65   SGWRIVEGA  39
            SGW+I EG+
Sbjct  536  SGWKITEGS  544



>gb|AIU49234.1| ARC6, partial [Theobroma cacao]
Length=544

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 152/297 (51%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLAAAAAI R        + +VK SAIQALQ         
Sbjct  366  YYDDPTVLRYLERLE----SPLAAAAAIVR--------IGAVKASAIQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI S
Sbjct  405  -----------------------KVFPAS--------------------------VKIMS  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            A V +GL+TL+GLK L                                   PR++AR AE
Sbjct  416  ASVVIGLMTLVGLKVLP----------------------------------PRIDARIAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
             +VR+WQN+KSQA GPDH L+KL E+LDGQMLK WTDRAAEIAQ GW ++Y+L +L IDS
Sbjct  442  GIVRRWQNVKSQAFGPDHCLDKLPEVLDGQMLKTWTDRAAEIAQLGWTYEYSLLSLAIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VT+S+DG+RA+VEATLEES    +A+           YTTRYE+    SGW+I EG+
Sbjct  502  VTLSLDGQRAVVEATLEESTPENNASS----------YTTRYEM----SGWKITEGS  544



>gb|AIU49254.1| ARC6, partial [Canna indica]
Length=544

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 123/297 (41%), Positives = 155/297 (52%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDPMVL+YLERLE    SPLAAAAAI +        + +VK S + AL+         
Sbjct  366  YYDDPMVLKYLERLE----SPLAAAAAIVK--------IGAVKSSVLHALR---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP                           V+KI S
Sbjct  405  -----------------------KVFPS--------------------------VMKIVS  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AG+ VGLLT++G+KFL                                   P+M+A+ AE
Sbjct  416  AGMMVGLLTVVGIKFLP----------------------------------PKMDAKLAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            ++V KWQN+KS+ALGPDH LE+L EIL+G+MLK+WTDRA EIAQHGW W+Y L  +TIDS
Sbjct  442  TIVHKWQNVKSRALGPDHSLEELPEILEGRMLKIWTDRAVEIAQHGWCWEYNLLGVTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS+DG RA+VEAT+EE +       PEH     +TY+TRYE+    SGW+I EGA
Sbjct  502  VTVSLDGCRAMVEATIEEVS-------PEH---NDSTYSTRYEM----SGWKITEGA  544



>gb|AIU49242.1| ARC6, partial [Eucalyptus grandis]
Length=544

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 154/297 (52%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLE+LE    SPLAAAAAIA+IG        +VK SAIQAL+         
Sbjct  366  YYDDPTVLRYLEKLE----SPLAAAAAIAKIG--------AVKDSAIQALR---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI  
Sbjct  405  -----------------------KVFPAS--------------------------VKIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AG+ +G +TL+GLK +                                   PRM+ + AE
Sbjct  416  AGLVIGAMTLVGLKCIP----------------------------------PRMDTKLAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            SLVRKWQ IKSQALGPDH LEKLSE+LDGQMLK+WT+RAAEIA +GWFWDY+L +LTIDS
Sbjct  442  SLVRKWQFIKSQALGPDHCLEKLSEVLDGQMLKIWTNRAAEIAHNGWFWDYSLVSLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            V +S+DGR A VEATLEESA       PE      + YTTRYE+    S W+I EGA
Sbjct  502  VILSMDGRHATVEATLEESA-------PER---NDSIYTTRYEM----SDWKITEGA  544



>gb|AIU49260.1| ARC6, partial [Prunus persica]
Length=545

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 128/298 (43%), Positives = 154/298 (52%), Gaps = 119/298 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERL+    SPLAAAAAI R        + + + SA+QALQ         
Sbjct  366  YYDDPTVLRYLERLD----SPLAAAAAIVR--------IGAFRASALQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI  
Sbjct  405  -----------------------KVFPAS--------------------------VKIMC  415

Query  569  AGVAVGLLTLIG-LKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFA  393
            AGV +GL+TL G L++L                                   P+M+AR A
Sbjct  416  AGVVIGLMTLAGGLRYLP----------------------------------PKMDARIA  441

Query  392  ESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTID  213
            E LVRKWQNIKSQA GP+H +E LSE+LDG+MLK+WTDRA EIAQ  W +DYTL NL+ID
Sbjct  442  EGLVRKWQNIKSQAFGPNHSVESLSEVLDGEMLKIWTDRATEIAQLNWSYDYTLLNLSID  501

Query  212  SVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            SVTVS+DG+RA+VEATLEE A       PEH    ++TYTTRYE+    SGW+I EGA
Sbjct  502  SVTVSLDGQRAVVEATLEELA-------PEH---NASTYTTRYEM----SGWKISEGA  545



>gb|AIU49237.1| ARC6, partial [Citrus clementina]
Length=512

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 118/189 (62%), Gaps = 48/189 (25%)
 Frame = -1

Query  605  EKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            +K+  + VKI  AGVA+GL+TL+GLK+L                                
Sbjct  372  QKVFPVGVKIMCAGVAIGLITLVGLKYLP-------------------------------  400

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
               PRM+AR AE +VRKWQNIKSQA GPDH L KL E+LDGQMLKVWTDRA+EIAQ GW 
Sbjct  401  ---PRMDARLAEDIVRKWQNIKSQAFGPDHSLGKLPEVLDGQMLKVWTDRASEIAQLGWI  457

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            +DY+L NLTIDSVT+S +GR A VEAT++ESA       PE+      TYT RYEL    
Sbjct  458  YDYSLLNLTIDSVTLSQEGRHAWVEATVKESA-------PEN---CDETYTARYEL----  503

Query  65   SGWRIVEGA  39
            SGWRI +G+
Sbjct  504  SGWRITDGS  512



>gb|AIU49279.1| ARC6, partial [Alisma plantago-aquatica]
Length=544

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 117/188 (62%), Gaps = 48/188 (26%)
 Frame = -1

Query  602  KIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSE  423
            K+   ++ +T  GV +GLL L+G K++                                 
Sbjct  405  KVFTAIIMVTCGGVMIGLLALLGFKYMP--------------------------------  432

Query  422  EVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFW  243
              PRM+A  AE LVR+WQ IKS+ALGPDH  +KLSE+LDG+MLK+WTDRA+EIA++GWFW
Sbjct  433  --PRMDASLAEKLVRRWQMIKSEALGPDHSFQKLSEVLDGRMLKIWTDRASEIAKNGWFW  490

Query  242  DYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS  63
             YTL NLTIDSVTVS+DG RA VEATL+E+A       PEH     ++Y+TRYE+    S
Sbjct  491  QYTLLNLTIDSVTVSLDGSRATVEATLKEAA-------PEH---NDSSYSTRYEM----S  536

Query  62   GWRIVEGA  39
            GW+I EGA
Sbjct  537  GWKITEGA  544



>gb|AIU49272.1| ARC6, partial [Lactuca sativa]
Length=544

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 116/189 (61%), Gaps = 48/189 (25%)
 Frame = -1

Query  605  EKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            +K+    VKI   GV VGLLTL GLK +                                
Sbjct  404  QKVFPAAVKIMCGGVVVGLLTLAGLKLMP-------------------------------  432

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
               PRM+AR AESLVRKWQ IKSQALGPDH  EKLSEILDGQMLK+W +RA EI +H WF
Sbjct  433  ---PRMDARLAESLVRKWQTIKSQALGPDHCHEKLSEILDGQMLKIWQERAIEIGEHSWF  489

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            WDY+L N+TIDSVT+S+DG  A+VEATLEESA       PE+     +TYTTRYE+    
Sbjct  490  WDYSLLNITIDSVTISLDGGLAVVEATLEESA-------PEN---NDSTYTTRYEM----  535

Query  65   SGWRIVEGA  39
            +GW+I +GA
Sbjct  536  AGWKITKGA  544



>gb|AIU49248.1| ARC6, partial [Ceratophyllum demersum]
Length=544

 Score =   165 bits (418),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 123/297 (41%), Positives = 151/297 (51%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLER E    SPLAAAAAI +        + +VK SAI+ALQ         
Sbjct  366  YYDDPTVLRYLERFE----SPLAAAAAIVK--------IGTVKASAIKALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                            I  
Sbjct  405  -----------------------KVFPASKT--------------------------IMV  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AG+AV LLTL+GLKF                                    P+M+A+FAE
Sbjct  416  AGLAVSLLTLVGLKFFP----------------------------------PKMDAQFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            +LVR+WQ IKSQALG DH L +L EIL+G+MLK+W +RA EIAQHGW+W Y+L  LTIDS
Sbjct  442  NLVRRWQEIKSQALGRDHSLSRLPEILEGRMLKIWIERATEIAQHGWYWKYSLLGLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            +T+++DGRRA VEATLEE+A       PE+     +TYTTRYE+    SGW+I EGA
Sbjct  502  ITLTLDGRRATVEATLEEAA-------PEN---NDSTYTTRYEI----SGWKIEEGA  544



>gb|AIU49241.1| ARC6, partial [Citrus sinensis]
Length=544

 Score =   165 bits (418),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 119/189 (63%), Gaps = 48/189 (25%)
 Frame = -1

Query  605  EKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            +K+  + VKI  AGVA+GL+TL+GLK+L                                
Sbjct  404  QKVFPVSVKIMCAGVAIGLVTLVGLKYLP-------------------------------  432

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
               PRM+AR AE +VRKWQNIKSQA GPDH L KL E+LDGQMLKVWTDRA+EIAQ GW 
Sbjct  433  ---PRMDARLAEDIVRKWQNIKSQAFGPDHSLGKLPEVLDGQMLKVWTDRASEIAQLGWT  489

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            +DY+L NLTIDSVT+S +GR A VEAT++ESA       PE+      TYTTRYEL    
Sbjct  490  YDYSLLNLTIDSVTLSQEGRHAWVEATVKESA-------PEN---CDETYTTRYEL----  535

Query  65   SGWRIVEGA  39
            SGWRI +G+
Sbjct  536  SGWRITDGS  544



>gb|AIU49251.1| ARC6, partial [Asparagus officinalis]
Length=544

 Score =   165 bits (417),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 122/296 (41%), Positives = 154/296 (52%), Gaps = 118/296 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP+VLRYLERLE    SPLAAAAAI +        + ++K S +QALQ         
Sbjct  366  YYDDPIVLRYLERLE----SPLAAAAAIVK--------IGTMKSSVLQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VK+  
Sbjct  405  -----------------------KVFPAS--------------------------VKLMG  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGV VGLLTL GLK+L                                   P+M+ARFAE
Sbjct  416  AGVVVGLLTLAGLKYLP----------------------------------PKMDARFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            +L+RKWQ IKSQALGPDH + + SE+LDG+ML++WTDR AEIAQ    W+YTL ++TIDS
Sbjct  442  TLIRKWQKIKSQALGPDHCVAEFSEVLDGRMLQIWTDRVAEIAQQQLSWEYTLLSVTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEG  42
            VTVS+DG+RA+VEAT+EE+A       PE+     +TY+TRYE+    SGW+I EG
Sbjct  502  VTVSMDGQRAMVEATIEEAA-------PEN---QDSTYSTRYEM----SGWKITEG  543



>gb|AIU49246.1| ARC6, partial [Iris japonica]
Length=544

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 154/297 (52%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLE++E    SPLAAAA+I +        + +VK + + ALQ         
Sbjct  366  YYDDPTVLRYLEKME----SPLAAAASIVK--------IGAVKSNVVDALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          +KI  
Sbjct  405  -----------------------KVFPAS--------------------------IKIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AG+AVG+LT+  L++L                                   P+M+AR+AE
Sbjct  416  AGIAVGILTVAALRYLP----------------------------------PKMDARYAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            +L+RKWQN+K QALGP HR+ KL E+L+ +ML++W DRAAE+A+ GWFW+YTLQ+LTIDS
Sbjct  442  TLLRKWQNVKFQALGPHHRVGKLPEVLEDRMLEIWKDRAAEVARKGWFWEYTLQDLTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VT+S+DGRRA+VEAT+ E+A        EH     +TYTTRYEL    SGW+I EGA
Sbjct  502  VTISLDGRRAVVEATINEAAS-------EH---KDSTYTTRYEL----SGWKITEGA  544



>gb|AIU49262.1| ARC6, partial [Phaseolus vulgaris]
Length=544

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 123/297 (41%), Positives = 150/297 (51%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLAAAAAI             VK+ A+QA           
Sbjct  366  YYDDPTVLRYLERLE----SPLAAAAAI-------------VKIGAVQA-----------  397

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                    S   A +        K FP +                          V+I  
Sbjct  398  --------SVINALK--------KVFPAS--------------------------VQIMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGV +GL+TL+GLKFL                                   P+M+AR AE
Sbjct  416  AGVVIGLVTLVGLKFLP----------------------------------PKMDARVAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            +LVRKWQ+IKSQA GPDH L +L E+LDG+MLKVWTDRAAEIA+ GW +DY L++L IDS
Sbjct  442  ALVRKWQSIKSQAFGPDHCLGRLHEVLDGEMLKVWTDRAAEIAERGWSYDYILEDLNIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VT+S +G+RA+VE TL ES    DA+          TYTTRYE+     GW+IVEG+
Sbjct  502  VTISQNGQRAVVETTLTESTPQHDAS----------TYTTRYEM----PGWKIVEGS  544



>gb|AIU49229.1| ARC6, partial [Lilium brownii]
Length=540

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 117/189 (62%), Gaps = 48/189 (25%)
 Frame = -1

Query  605  EKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            +K+  L V I    V VGLLTL+GLKFL                                
Sbjct  400  QKVFRLSVIIMCGSVVVGLLTLVGLKFLP-------------------------------  428

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
               P+M+A+ AE+LVRKWQNIKSQALGP+H L +L E+LDG+MLK+WTDRA EIAQ GWF
Sbjct  429  ---PKMDAKLAEALVRKWQNIKSQALGPEHYLAQLPEVLDGRMLKIWTDRAGEIAQQGWF  485

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            W+YTL  ++IDSVT+S DGRRA+VE T+EE+A        EH     +TY+T+YE+    
Sbjct  486  WEYTLLGVSIDSVTISSDGRRAMVEVTIEEAAS-------EH---NDSTYSTKYEM----  531

Query  65   SGWRIVEGA  39
            SGW+I EGA
Sbjct  532  SGWKITEGA  540



>gb|KCW67921.1| hypothetical protein EUGRSUZ_F01622 [Eucalyptus grandis]
Length=728

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 142/211 (67%), Gaps = 6/211 (3%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLE+LEG G SPLAAAAAIA+IGAEA+AV+D+VK SAIQAL+KV PL   +
Sbjct  498  YYDDPTVLRYLEKLEGGGSSPLAAAAAIAKIGAEASAVIDNVKDSAIQALRKVFPLSHSK  557

Query  749  --TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEM----ITEKIKDL  588
              T ++      Y+   S+          +N+A  +E S  DD   E     +T++IKD 
Sbjct  558  EVTGLQADMGPDYSIPSSEFTEPFTSPDGDNIANISEASRKDDTVSETDGYSMTDRIKDA  617

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRM  408
             VKI  AG+ +G +TL+GLK +  R+ S +L K+ GS++ +DV   G S   +SE+ PRM
Sbjct  618  SVKIMCAGLVIGAMTLVGLKCIPARSGSPVLHKEVGSAMASDVDCEGSSMDVLSEDSPRM  677

Query  407  EARFAESLVRKWQNIKSQALGPDHRLEKLSE  315
            + + AESLVRKWQ IKSQALGPDH LEKLSE
Sbjct  678  DTKLAESLVRKWQFIKSQALGPDHCLEKLSE  708



>ref|XP_002970022.1| hypothetical protein SELMODRAFT_92361, partial [Selaginella moellendorffii]
 gb|EFJ29146.1| hypothetical protein SELMODRAFT_92361, partial [Selaginella moellendorffii]
Length=656

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -1

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
            +EV RM+AR AE L+RKWQ  K++ALG    + +L+EILDGQMLK WTDRA E+A+HGW+
Sbjct  524  KEVLRMDARLAEQLIRKWQAAKAKALGVTRGITQLNEILDGQMLKSWTDRAVEVAKHGWY  583

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            W+Y L  + IDSVT+S DGRRA+VEATLEE+A+L D+ +P+ +DSY ++YTTRYEL  G 
Sbjct  584  WEYKLLEINIDSVTISEDGRRAMVEATLEETARLYDSNNPQRNDSYKSSYTTRYELHYGD  643

Query  65   SGWRIVEGAVLKS  27
            +GWRI +GAVL++
Sbjct  644  AGWRITDGAVLRT  656



>gb|AIU49239.1| ARC6, partial [Carica papaya]
Length=544

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 128/297 (43%), Positives = 151/297 (51%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLERLE    SPLAAAAAIARIG        +VK SAIQALQ V       
Sbjct  366  YYDDPTVLMYLERLE----SPLAAAAAIARIG--------AVKASAIQALQTV-------  406

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                     FP ++                          KI  
Sbjct  407  -------------------------FPASL--------------------------KIIC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
             GV +G++TL+GLK L                                   P+M+ARFAE
Sbjct  416  GGVLIGMITLVGLKSLP----------------------------------PKMDARFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
             +V KWQNIKS+A GP+HRLEKL E+LDG+MLK+W DRAAEIAQ G  +DYTL  +TIDS
Sbjct  442  DIVCKWQNIKSEAFGPNHRLEKLPEVLDGRMLKIWRDRAAEIAQLGLVYDYTLLKVTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS DG RA+VEA LEESA   +A+          TYTTRYE+    SGW+I EG+
Sbjct  502  VTVSADGCRAVVEAALEESAPENNAS----------TYTTRYEI----SGWKITEGS  544



>gb|AIU49266.1| ARC6, partial [Yucca filamentosa]
Length=544

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 118/296 (40%), Positives = 150/296 (51%), Gaps = 118/296 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLE    SPLA+AAAI +        + ++K S +QAL          
Sbjct  366  YYDDPTVLRYLERLE----SPLASAAAIVK--------IGTMKSSVLQALH---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          +K+  
Sbjct  405  -----------------------KVFPAS--------------------------IKLMC  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AG+ VGL TL GLK+L                                   P+M+ARFAE
Sbjct  416  AGMVVGLFTLAGLKYLP----------------------------------PKMDARFAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            +L+RKWQNIKSQALGPDH + +L E+L+GQMLK+WTDR AEI Q G  W+YTL  +T+DS
Sbjct  442  TLLRKWQNIKSQALGPDHCVAELPEVLEGQMLKIWTDRVAEIKQRGLSWEYTLLGVTVDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEG  42
            VTVS+DG RA+VEAT+EE+A       PE+     +TY+TRYE+    SGW+I EG
Sbjct  502  VTVSMDGHRAMVEATIEEAA-------PEN---EDSTYSTRYEM----SGWKITEG  543



>ref|XP_002993317.1| hypothetical protein SELMODRAFT_136906, partial [Selaginella 
moellendorffii]
 gb|EFJ05642.1| hypothetical protein SELMODRAFT_136906, partial [Selaginella 
moellendorffii]
Length=656

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -1

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
            +EV RM+AR AE L+RKWQ  K++ALG    + +L+EILDGQMLK WTDRA E+A+HGW+
Sbjct  524  KEVLRMDARLAEQLIRKWQAAKAKALGVTRAITQLNEILDGQMLKSWTDRAVEVAKHGWY  583

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            W+Y L  + IDSVT+S DGRRA+VEATL+E+A+L D+ +P+ +DSY ++YTTRYEL  G 
Sbjct  584  WEYKLLEINIDSVTISEDGRRAMVEATLQETARLYDSNNPQRNDSYKSSYTTRYELHYGD  643

Query  65   SGWRIVEGAVLKS  27
            +GWRI +GAVL++
Sbjct  644  NGWRITDGAVLRT  656



>gb|AIU49243.1| ARC6, partial [Glycine max]
Length=544

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 115/182 (63%), Gaps = 48/182 (26%)
 Frame = -1

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRME  405
            V+I  AGV +GL+TL+GLKFL                                   P+M+
Sbjct  411  VQIMCAGVVIGLVTLVGLKFLP----------------------------------PKMD  436

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            AR AE+LVRKWQ++KS+A GPDH L +L E+LDG+MLK+WTDRAAEIA+ GW +DYTL++
Sbjct  437  ARVAEALVRKWQSVKSEAFGPDHCLGRLHEVLDGEMLKIWTDRAAEIAERGWSYDYTLED  496

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVE  45
            L IDSVT+S +GRRA+VE TL+ES    DA+          TYTTRYE+    + W+IVE
Sbjct  497  LNIDSVTISQNGRRAVVETTLKESTPQHDAS----------TYTTRYEM----AEWKIVE  542

Query  44   GA  39
            GA
Sbjct  543  GA  544



>gb|AIU49228.1| ARC6, partial [Arabidopsis thaliana]
Length=543

 Score =   156 bits (395),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 124/297 (42%), Positives = 151/297 (51%), Gaps = 119/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDPMVL YLER+E    SPLAAAAA+AR        + +VK SA+QALQ         
Sbjct  366  YYDDPMVLSYLERVE----SPLAAAAAMAR--------IGAVKASAMQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI +
Sbjct  405  -----------------------KVFPAS--------------------------VKILA  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGVA+GL++L   K+                                    PRM+AR AE
Sbjct  416  AGVAIGLISLFSQKYF-----------------------------------PRMDARTAE  440

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            ++V KWQ IKS A GPDHR+E L E+LDG+MLK+WTDRAAE AQ G  +DYTL  L++DS
Sbjct  441  NIVSKWQKIKSLAFGPDHRIEMLPEVLDGRMLKIWTDRAAETAQLGLVYDYTLLKLSVDS  500

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS DG RA+VEATLEESA       PE+    +TTYTTRYE+    SGW+I EG+
Sbjct  501  VTVSADGTRALVEATLEESA-------PEN---NATTYTTRYEV----SGWKITEGS  543



>gb|AIU49264.1| ARC6, partial [Ricinus communis]
Length=544

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 112/189 (59%), Gaps = 48/189 (25%)
 Frame = -1

Query  605  EKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            +K+   +VKI   GV +GL+T  GLK L                                
Sbjct  404  QKVFPTIVKIMCTGVTIGLVTFFGLKCLP-------------------------------  432

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
               PRM+ARFAE +VRKWQNIKSQA G DH L KL E+LDGQMLK WTDRAAE+ Q GW 
Sbjct  433  ---PRMDARFAEGIVRKWQNIKSQAFGSDHSLGKLHEVLDGQMLKTWTDRAAEVEQLGWV  489

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            +DYTL +LT+DSV VS+DG+ A+VEAT++ESA   +A+          TYTTRYE+    
Sbjct  490  YDYTLLDLTVDSVIVSLDGQHAVVEATIKESAPENNAS----------TYTTRYEM----  535

Query  65   SGWRIVEGA  39
             GW+I EGA
Sbjct  536  LGWKITEGA  544



>gb|AIU49253.1| ARC6, partial [Medicago truncatula]
Length=544

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 113/182 (62%), Gaps = 48/182 (26%)
 Frame = -1

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRME  405
            VKI  AGVA+GL+TL GLK L                                   P+M 
Sbjct  411  VKIMCAGVAIGLITLAGLKILP----------------------------------PKMS  436

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            A  AE+LVRKWQ IKSQA GPDH L +L E+LDG+MLK+WTDRAAEIA+ GW +DY L++
Sbjct  437  AMVAEALVRKWQYIKSQAFGPDHCLGRLQEVLDGEMLKIWTDRAAEIAELGWSYDYNLED  496

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVE  45
            L IDSVT+S +GRRA+VE TL+ES        P+H    ++TYTTRYE+    SGW+I+E
Sbjct  497  LNIDSVTISQNGRRAVVETTLKEST-------PQH---ATSTYTTRYEM----SGWKIIE  542

Query  44   GA  39
            GA
Sbjct  543  GA  544



>ref|XP_006596571.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X2 [Glycine max]
Length=730

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 142/220 (65%), Gaps = 8/220 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG   SPLAAAAAIA+IGAEATAV+  V+ S I AL+K  P+G  +
Sbjct  489  YYDDPTVLRYLERLEGGSNSPLAAAAAIAKIGAEATAVISQVQASVINALKKAFPVGSED  548

Query  749  TSVRRHGNS----FYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVV  582
              V+   N     F  +   + L   D+  P N      ++  + ++ E ITE+IK   V
Sbjct  549  QIVKHQVNGVNEDFGFSESENPLILSDQDSPVNAEVSGIKNTMETRKGEFITEEIKHASV  608

Query  581  KITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGP-SKVEVSEEVPRME  405
            +I  AGV +GL+TL+GLKFL  R  S ILRK  GS++ +D +++G     E  E++P+M+
Sbjct  609  QIMCAGVVIGLVTLVGLKFLPTRNGSPILRKMTGSAMVSDTINLGSLGDEEKVEQLPKMD  668

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVW  285
            AR AE+LVRKWQ++KS+A GPDH L +L E +   +L+ W
Sbjct  669  ARVAEALVRKWQSVKSEAFGPDHCLGRLHEAM---LLEFW  705



>gb|AIU49227.1| ARC6, partial [Arabidopsis lyrata]
Length=544

 Score =   155 bits (391),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 123/297 (41%), Positives = 151/297 (51%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDPMVL YLER+E    SPLAAAAA+AR        + +VK SA+QALQ         
Sbjct  366  YYDDPMVLNYLERVE----SPLAAAAAMAR--------IGAVKASAMQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP +                          VKI +
Sbjct  405  -----------------------KVFPAS--------------------------VKILA  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGVA+G+++L   K+L                                   PRM+AR AE
Sbjct  416  AGVAIGMISLFSQKYLP----------------------------------PRMDARTAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            S+V KWQ IKSQA G DHR++ L E+LDG+MLK+WTDRA E AQ G  +DYTL  L++DS
Sbjct  442  SIVSKWQKIKSQAFGHDHRIDMLPEVLDGRMLKIWTDRAVETAQLGLVYDYTLLKLSVDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VTVS DG RA+VEATLEESA       PE+    +TTYTTRYE+    SGW+I EG+
Sbjct  502  VTVSADGTRALVEATLEESA-------PEN---NATTYTTRYEV----SGWKITEGS  544



>gb|AIU49240.1| ARC6, partial [Capsella rubella]
Length=544

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 124/297 (42%), Positives = 152/297 (51%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDPMVL YLER+E    SPLAAAAA+AR+G        +VK SA+QALQ         
Sbjct  366  YYDDPMVLSYLERVE----SPLAAAAAMARMG--------AVKASAMQALQ---------  404

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                   K FP                           +VKI +
Sbjct  405  -----------------------KVFPA--------------------------IVKILA  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AGVA+G++ L   ++L                                   PRM+AR AE
Sbjct  416  AGVAIGVIALFTQRYLP----------------------------------PRMDARTAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
            S+V KWQ IKSQA G DHR+E L E+LDG+MLK+WTDRAAE AQ G  +DYTL  L++DS
Sbjct  442  SIVSKWQKIKSQAFGHDHRIELLPEVLDGRMLKIWTDRAAETAQLGLVYDYTLLKLSVDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            VT+S DG RA+VEATLEESA       PE+    +TTYTTRYE+    SGW+I EG+
Sbjct  502  VTISADGTRALVEATLEESA-------PEN---NATTYTTRYEV----SGWKITEGS  544



>gb|AIU49276.1| ARC6, partial [Ginkgo biloba]
Length=544

 Score =   151 bits (382),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 116/189 (61%), Gaps = 48/189 (25%)
 Frame = -1

Query  605  EKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            +++    ++I  AGV VG+LTL  L+ L                                
Sbjct  404  QRVFPFPLQIVCAGVVVGVLTLAALRSLP-------------------------------  432

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
               P+M+AR AE+LVRKWQ  KS+ALGP+H + +LSEILDGQMLK+WT+RA +IAQHGWF
Sbjct  433  ---PKMDARLAENLVRKWQMSKSKALGPNHSISQLSEILDGQMLKIWTERANDIAQHGWF  489

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            W+Y+L  LTI+SVT+S +GRRA+VEATL+E+A       PEH     +TYTTRYE+    
Sbjct  490  WEYSLLGLTIESVTISAEGRRAVVEATLQEAA-------PEH---NDSTYTTRYEM----  535

Query  65   SGWRIVEGA  39
              W+I +GA
Sbjct  536  GNWKITDGA  544



>gb|AIU49261.1| ARC6, partial [Panicum virgatum]
Length=544

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 105/182 (58%), Gaps = 48/182 (26%)
 Frame = -1

Query  584  VKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRME  405
            +KI SAG    L  +IGLK L                                   PRM+
Sbjct  411  LKIISAGALFALFAVIGLKCLP----------------------------------PRMD  436

Query  404  ARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQN  225
            A+ AE +VRKWQ+IKS+ALGP+H    L E+LDG MLKVWTDRA EIA+HGWFW+YTL +
Sbjct  437  AKLAEDIVRKWQSIKSKALGPEHSAVVLQEVLDGNMLKVWTDRATEIARHGWFWEYTLSD  496

Query  224  LTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVE  45
            +TIDSVTVSVDGRRA VEAT+EE     + +           YTTRYE+     GWRI E
Sbjct  497  VTIDSVTVSVDGRRATVEATIEEVGPKNNDSK----------YTTRYEM----GGWRITE  542

Query  44   GA  39
            GA
Sbjct  543  GA  544



>gb|AIU49278.1| ARC6, partial [Zea mays]
Length=544

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 109/297 (37%), Positives = 133/297 (45%), Gaps = 118/297 (40%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VL YLER+E                 A A A L +VK SA+QA  KV       
Sbjct  366  YYDDPKVLSYLERMES------------HLAAAAAIAKLGAVKSSALQAFSKV-------  406

Query  749  TSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKITS  570
                                     FP+ +                          KI S
Sbjct  407  -------------------------FPDAL--------------------------KIIS  415

Query  569  AGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAE  390
            AG  + L  ++GLK L                                   PRM+A+ AE
Sbjct  416  AGTLLALFAVLGLKCLP----------------------------------PRMDAKLAE  441

Query  389  SLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDS  210
             +VR+WQ+IKS+ALGP+H +  L E+L G MLKVW DRAAEI +HGWFW+Y L  +TIDS
Sbjct  442  DIVRRWQSIKSKALGPEHTVTALQEVLGGNMLKVWADRAAEIERHGWFWEYALSGVTIDS  501

Query  209  VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            +TVSVDGRRA VEAT+EE     D A           YT RYE+    +GWRI EGA
Sbjct  502  ITVSVDGRRAAVEATIEEVGPKNDDAK----------YTARYEM----AGWRITEGA  544



>gb|AIU49269.1| ARC6, partial [Sorghum bicolor]
Length=544

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 105/188 (56%), Gaps = 48/188 (26%)
 Frame = -1

Query  602  KIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSE  423
            K+    +KI SAG    L  +IGLK L                                 
Sbjct  405  KVFPAALKIISAGALFALFAVIGLKCLP--------------------------------  432

Query  422  EVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFW  243
              PRM+A+ AE +VRKWQ+IKS+ALGP+H +  L EILDG MLKVW DRA EI +HGWFW
Sbjct  433  --PRMDAKLAEDIVRKWQSIKSKALGPEHTVTALQEILDGNMLKVWMDRATEIERHGWFW  490

Query  242  DYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS  63
            +YTL ++TIDS+TVS+DGRRA VEAT+EE     + A           YT RYE+     
Sbjct  491  EYTLSDVTIDSITVSMDGRRATVEATIEEMGPKNNDAK----------YTARYEM----G  536

Query  62   GWRIVEGA  39
            GWRI EGA
Sbjct  537  GWRITEGA  544



>gb|AIU49233.1| ARC6, partial [Brachypodium distachyon]
Length=544

 Score =   149 bits (375),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 111/188 (59%), Gaps = 48/188 (26%)
 Frame = -1

Query  602  KIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSE  423
            K+    +KI SA     LLT+IGLK++                                 
Sbjct  405  KVFPAALKIVSASAFFALLTVIGLKYMP--------------------------------  432

Query  422  EVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFW  243
              PRM+A+ AE +VRKWQ+IKS+ALG DH +  L E+LDG MLKVWTDRAAEI ++GWFW
Sbjct  433  --PRMDAKLAEDIVRKWQSIKSKALGSDHSVASLQEVLDGNMLKVWTDRAAEIERNGWFW  490

Query  242  DYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS  63
            DY L ++TIDS+TVS+DGRRA VEAT+EE       A P++     + YTTRYE+     
Sbjct  491  DYKLSDVTIDSITVSMDGRRATVEATIEE-------AGPKN---NDSKYTTRYEM----G  536

Query  62   GWRIVEGA  39
            GW+I EGA
Sbjct  537  GWKITEGA  544



>ref|XP_006601329.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X2 [Glycine max]
Length=744

 Score =   150 bits (379),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 145/222 (65%), Gaps = 12/222 (5%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDD  VLRYLERLEG   SPLAAAAAI +IGAEATAV+  V+ S + AL+KV P+G  +
Sbjct  488  YYDDSTVLRYLERLEGGSHSPLAAAAAIVKIGAEATAVISQVQASVMNALKKVFPVGSED  547

Query  749  TSVRRHGNSF---YTATESDE---LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
              V+   N     +  +ES+    LS  D +    ++G   ++ ++  E E ITE+IK+ 
Sbjct  548  QIVKHQVNGVNEDFGFSESENPVILSDQDSSVNAEVSGI--KNTTETSEGEFITEEIKNA  605

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGP-SKVEVSEEVPR  411
             V+I  AGV +GL+TL+GLKFL +R    +L K  GS++ +D +++G     E  E++P+
Sbjct  606  SVQIMCAGVVIGLVTLVGLKFLPSRNGLPMLCKTTGSAMASDTINLGSLGDEEKVEQLPK  665

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVW  285
            M+AR AE+LVRKWQ++KS+A GPDH + +L E +   +L+ W
Sbjct  666  MDARVAEALVRKWQSVKSEAFGPDHCMGRLHEAM---LLEFW  704



>ref|XP_006601331.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X4 [Glycine max]
Length=715

 Score =   150 bits (378),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 145/222 (65%), Gaps = 12/222 (5%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDD  VLRYLERLEG   SPLAAAAAI +IGAEATAV+  V+ S + AL+KV P+G  +
Sbjct  488  YYDDSTVLRYLERLEGGSHSPLAAAAAIVKIGAEATAVISQVQASVMNALKKVFPVGSED  547

Query  749  TSVRRHGNSF---YTATESDE---LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
              V+   N     +  +ES+    LS  D +    ++G   ++ ++  E E ITE+IK+ 
Sbjct  548  QIVKHQVNGVNEDFGFSESENPVILSDQDSSVNAEVSGI--KNTTETSEGEFITEEIKNA  605

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGP-SKVEVSEEVPR  411
             V+I  AGV +GL+TL+GLKFL +R    +L K  GS++ +D +++G     E  E++P+
Sbjct  606  SVQIMCAGVVIGLVTLVGLKFLPSRNGLPMLCKTTGSAMASDTINLGSLGDEEKVEQLPK  665

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVW  285
            M+AR AE+LVRKWQ++KS+A GPDH + +L E +   +L+ W
Sbjct  666  MDARVAEALVRKWQSVKSEAFGPDHCMGRLHEAM---LLEFW  704



>ref|XP_006601330.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic-like isoform X3 [Glycine max]
Length=721

 Score =   149 bits (377),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 145/222 (65%), Gaps = 12/222 (5%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDD  VLRYLERLEG   SPLAAAAAI +IGAEATAV+  V+ S + AL+KV P+G  +
Sbjct  488  YYDDSTVLRYLERLEGGSHSPLAAAAAIVKIGAEATAVISQVQASVMNALKKVFPVGSED  547

Query  749  TSVRRHGNSF---YTATESDE---LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
              V+   N     +  +ES+    LS  D +    ++G   ++ ++  E E ITE+IK+ 
Sbjct  548  QIVKHQVNGVNEDFGFSESENPVILSDQDSSVNAEVSGI--KNTTETSEGEFITEEIKNA  605

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGP-SKVEVSEEVPR  411
             V+I  AGV +GL+TL+GLKFL +R    +L K  GS++ +D +++G     E  E++P+
Sbjct  606  SVQIMCAGVVIGLVTLVGLKFLPSRNGLPMLCKTTGSAMASDTINLGSLGDEEKVEQLPK  665

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVW  285
            M+AR AE+LVRKWQ++KS+A GPDH + +L E +   +L+ W
Sbjct  666  MDARVAEALVRKWQSVKSEAFGPDHCMGRLHEAM---LLEFW  704



>gb|AIU49270.1| ARC6, partial [Schrenkiella parvula]
Length=544

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 115/189 (61%), Gaps = 48/189 (25%)
 Frame = -1

Query  605  EKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVS  426
            +K+  + VK+ SAGV +G+++L GL+FL                                
Sbjct  404  QKVFPVSVKVLSAGVVIGMISLAGLRFLP-------------------------------  432

Query  425  EEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWF  246
               PRM+AR AESLV KWQ IKSQA G DH +EKL E+LDG+MLK+WTDRA E AQ G  
Sbjct  433  ---PRMDARTAESLVCKWQKIKSQAFGRDHCIEKLPEVLDGRMLKIWTDRATETAQLGLV  489

Query  245  WDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            +DYTL  +++DSVTVS DG RA+VEATLEESA       PE+    +TTYTTRYE     
Sbjct  490  YDYTLLKVSVDSVTVSADGTRALVEATLEESA-------PEN---NATTYTTRYE----A  535

Query  65   SGWRIVEGA  39
            +GW+I EG+
Sbjct  536  TGWKITEGS  544



>gb|AIU49267.1| ARC6, partial [Setaria italica]
Length=544

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 105/188 (56%), Gaps = 48/188 (26%)
 Frame = -1

Query  602  KIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSE  423
            K+    +KI SAG    L  +IGLK L                                 
Sbjct  405  KVFPTALKIISAGALFALFAVIGLKCLP--------------------------------  432

Query  422  EVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFW  243
              PRM+A+ AE +VRKWQ+IKS+ALGP+H +  L E+LDG MLKVW+DRA EI +HGWFW
Sbjct  433  --PRMDAKLAEDIVRKWQSIKSKALGPEHSVPALQEVLDGNMLKVWSDRATEIERHGWFW  490

Query  242  DYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS  63
            +YTL ++TIDSVTVSVDGRRA VE T+EE     + +           YTTRYE+     
Sbjct  491  EYTLSDVTIDSVTVSVDGRRATVEVTIEEVGSKNNDSK----------YTTRYEM----G  536

Query  62   GWRIVEGA  39
            GW I EGA
Sbjct  537  GWMITEGA  544



>ref|XP_007017698.1| Chaperone DnaJ-domain superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY14923.1| Chaperone DnaJ-domain superfamily protein isoform 3 [Theobroma 
cacao]
Length=660

 Score =   135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 114/170 (67%), Gaps = 12/170 (7%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEGVGGSPLAAAAAI RIGAEATAVLD VK SAIQALQKV PL   E
Sbjct  491  YYDDPTVLRYLERLEGVGGSPLAAAAAIVRIGAEATAVLDHVKASAIQALQKVFPLRSAE  550

Query  749  TSVRRH-----GNSFYTATESDELSHGDKTFPENMAGFAE----RSPSDDQEQEMITEKI  597
             SVR        N F+     + L   D   PE+ A  AE     S  +  E+E IT+KI
Sbjct  551  ESVRHQLDGEMSNIFHAVENEETLGKPD---PEDSAVLAEIPGKSSLEEMHEEETITDKI  607

Query  596  KDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIG  447
            KD  VKI SA V +GL+TL+GLK L  R+ SS++RK+   +++++V +IG
Sbjct  608  KDASVKIMSASVVIGLMTLVGLKVLPGRSSSSVIRKEISPAMSSNVSNIG  657



>ref|XP_008777706.1| PREDICTED: protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 
6, chloroplastic [Phoenix dactylifera]
Length=722

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 101/218 (46%), Positives = 136/218 (62%), Gaps = 14/218 (6%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDG-  753
            YYDDP VLRYLER+EG G SPLAAAAAIA+IGAEATA L +VK SA+QALQKV PL +  
Sbjct  507  YYDDPTVLRYLERIEGGGSSPLAAAAAIAKIGAEATAALGNVKSSALQALQKVFPLVNKV  566

Query  752  ETSVRRHGNSFYTATESDELSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDLVVKIT  573
            E S +   N  + +    +         +  +GF E   S +   E + E  +DL+  I 
Sbjct  567  ERSSKEEVNDSHDSITEIQTKESVVKVDQVNSGF-EAEASGNLNSEGLDE--QDLMYDIR  623

Query  572  SAG-------VAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIG---PSKVEVSE  423
            +A        V VGL+TL GLK+L  +    + +K+ GS++ A+VV++G   P+     E
Sbjct  624  NASVKVVCAGVVVGLITLAGLKYLPGKNVLPVTKKETGSAMAANVVNLGSDVPTVENWGE  683

Query  422  EVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEIL  309
            + P+M++R AE+LVRKWQN+KSQALG DH L KL E+ 
Sbjct  684  QAPKMDSRLAETLVRKWQNVKSQALGQDHCLTKLPEVF  721



>gb|KDO84753.1| hypothetical protein CISIN_1g003752mg [Citrus sinensis]
 gb|KDO84754.1| hypothetical protein CISIN_1g003752mg [Citrus sinensis]
Length=670

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 109/167 (65%), Gaps = 6/167 (4%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiari-gaeatAVLDSVKVSAIQALQKVIPLGDG  753
            YYDDP VLRYLERLEG G SPLAAAAAI RI   EATAVLD VK S IQALQKV PLG G
Sbjct  490  YYDDPTVLRYLERLEGNGSSPLAAAAAIVRIGATEATAVLDHVKSSTIQALQKVFPLGQG  549

Query  752  ETSVR--RHGNSF--YTATESDE-LSHGDKTFPENMAGFAERSPSDDQEQEMITEKIKDL  588
            + +V+   HG ++      E++E L+     F      +   S  D   ++ IT+KIKD+
Sbjct  550  DKAVKYVEHGETYDPVPVVETEESLTSDQNNFAFTTDAYGTSSSDDIHGEQSITDKIKDV  609

Query  587  VVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIG  447
             VKI  AGVA+GL+TL+GLK+L  R  SS+ +K+ G +  +D++  G
Sbjct  610  SVKIMCAGVAIGLVTLVGLKYLPTRNISSVQQKEIGLAKASDIIDAG  656



>gb|KJB58154.1| hypothetical protein B456_009G196600 [Gossypium raimondii]
Length=655

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 107/167 (64%), Gaps = 11/167 (7%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP VLRYLERLEG GGSPLAAAAAI RIGAEATAVLD VK SAIQALQKV PL   E
Sbjct  490  YYDDPTVLRYLERLEGAGGSPLAAAAAIVRIGAEATAVLDHVKASAIQALQKVFPLRRSE  549

Query  749  TSVRRH----GNSFYTATESDELSHGDKTFPENMAGFAE----RSPSDDQEQEMITEKIK  594
             + R       N+F      + L   D+   E+ A  AE     S     E+E I++KIK
Sbjct  550  ETARHQLDGEMNNFLPVESEETLGKPDQ---EDSAILAEVPGISSLEGMYEEETISDKIK  606

Query  593  DLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVS  453
            D  VKI SAGV +G++TL+GLKFLS +  SS+  K    ++  DV++
Sbjct  607  DASVKIMSAGVVIGVMTLVGLKFLSGKFSSSVTGKGISPAMATDVIN  653



>ref|XP_002506694.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67952.1| predicted protein [Micromonas sp. RCC299]
Length=366

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 86/134 (64%), Gaps = 6/134 (4%)
 Frame = -1

Query  419  VPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWD  240
            VP ++A+ AE +VR+WQ+ K+QALG  H L+ L ++L+G ML+ W  RA ++  HGW W+
Sbjct  233  VPEVDAKVAEQVVRRWQHAKAQALGVAHNLKPLEQVLEGPMLQQWLTRAEDVRSHGWAWE  292

Query  239  YTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYEL-----S  75
            Y L +L+ID V  S+   RA+VEATL E A L D A  E DD Y +TY  RYEL      
Sbjct  293  YQLNSLSIDKVE-SLSETRAMVEATLTEVAILKDRARTEEDDRYESTYRARYELRRGEGR  351

Query  74   CGKSGWRIVEGAVL  33
             G   W+I+ G+V+
Sbjct  352  GGYRAWKIIGGSVV  365



>ref|XP_001421185.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99478.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=762

 Score =   104 bits (260),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 80/129 (62%), Gaps = 4/129 (3%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+   AE LVRKWQ  K+QA+G  H    L  ILDG ML+ W  RA ++A HGW W+Y L
Sbjct  634  MDKGTAEKLVRKWQMAKAQAMGQRHNTRYLDGILDGPMLQQWKTRAEDVATHGWAWEYKL  693

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELS-C--GKSG  60
             +L+IDSV V +   +  VE TL E A L D A  E DD Y +TY  +YEL  C  GK+ 
Sbjct  694  NDLSIDSVQV-IGTEKVFVETTLTEVAVLKDRARNEPDDVYESTYRAKYELKRCETGKNA  752

Query  59   WRIVEGAVL  33
            WRIV G+V+
Sbjct  753  WRIVGGSVV  761



>ref|XP_003078537.1| plastid division protein precurso (ISS) [Ostreococcus tauri]
Length=539

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 85/151 (56%), Gaps = 7/151 (5%)
 Frame = -1

Query  467  ADVVSIGPSKVEVSEEVP--RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQML  294
            ++V  + P++       P   M+   AE +VRKWQ  K+QALG  H + +L  IL+G ML
Sbjct  389  SNVKLLTPTRQTTPRPAPVYTMDKGTAEKIVRKWQTAKAQALGQTHNMRQLEGILEGPML  448

Query  293  KVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHdd  114
            + W  RA ++  HGW W+Y L  L+ID V  +V   +  VE TL E A L D A  E DD
Sbjct  449  QQWQTRAEDVKAHGWAWEYQLNELSIDHVQ-AVGTEKVFVETTLTEVAVLKDHAKNEPDD  507

Query  113  systtytTRYEL-SC---GKSGWRIVEGAVL  33
             Y +TY  +YEL  C    KS W+IV G V+
Sbjct  508  VYESTYRAKYELKKCRQGSKSEWKIVGGMVI  538



>ref|XP_007509799.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18914.1| predicted protein [Bathycoccus prasinos]
Length=927

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 78/127 (61%), Gaps = 2/127 (2%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+   AES+V++WQ IK++ALG  H    LS ILDG ML+ WT RA ++A HGW W+Y L
Sbjct  801  MDESTAESVVKRWQQIKAKALGSSHDSRALSNILDGPMLRQWTLRAEDVASHGWCWEYEL  860

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYEL-SCGKSGWR  54
              L I+ + +  +   AIVEA L E A L D +  + DD Y +TY  RYE+      GW+
Sbjct  861  NKLVIEKIEI-YNEDEAIVEARLTELAVLKDRSKVDDDDVYESTYRARYEMRRTSDGGWK  919

Query  53   IVEGAVL  33
            I  G+V+
Sbjct  920  IFGGSVV  926



>emb|CEF97403.1| Domain of unknown function DUF4101 [Ostreococcus tauri]
Length=818

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+   AE +VRKWQ  K+QALG  H + +L  IL+G ML+ W  RA ++  HGW W+Y L
Sbjct  689  MDKGTAEKIVRKWQTAKAQALGQTHNMRQLEGILEGPMLQQWQTRAEDVKAHGWAWEYQL  748

Query  230  QNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYEL-SC---GKS  63
              L+ID V  +V   +  VE TL E A L D A  E DD Y +TY  +YEL  C    KS
Sbjct  749  NELSIDHVQ-AVGTEKVFVETTLTEVAVLKDHAKNEPDDVYESTYRAKYELKKCRQGSKS  807

Query  62   GWRIVEGAVL  33
             W+IV G V+
Sbjct  808  EWKIVGGMVI  817



>emb|CDJ26504.1| unnamed protein product [Triticum aestivum]
Length=744

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 83/146 (57%), Gaps = 6/146 (4%)
 Frame = -1

Query  458  VSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTD  279
            +S G S V       RM  + AE+LV++WQ+IKS+ALGPD+ ++ LSE+LDG ML  W D
Sbjct  596  LSPGSSDVAAIARKERMSLQEAEALVKQWQDIKSEALGPDYEIDMLSEVLDGSMLSKWQD  655

Query  278  RAAEIAQHGWFWDYTLQNLTIDSVTVSV----DGRRAIVEATLEESAQLTDAAHPEHdds  111
             A        +W + L NL++    + +    DG  A + A LEE+A+L D + P+   S
Sbjct  656  LALSAKDQSCYWRFVLLNLSVVRAEILLDEAGDGEVAEINAVLEEAAELVDDSQPKK-PS  714

Query  110  ysttytTRYELSCGKSG-WRIVEGAV  36
            Y +TY  +Y L     G W+I E AV
Sbjct  715  YYSTYEVQYSLRRQDDGSWKICEAAV  740



>gb|EMT18208.1| hypothetical protein F775_01957 [Aegilops tauschii]
Length=760

 Score = 89.7 bits (221),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 88/173 (51%), Gaps = 13/173 (8%)
 Frame = -1

Query  542  LIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNI  363
            L  + +L+NR  S   R D         +S G S V       RM  + AE+LV++WQ+I
Sbjct  593  LSKMLWLNNRLHSRSERSD---------LSPGSSDVAAIARKERMSLQEAEALVKQWQDI  643

Query  362  KSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSV----  195
            KS+ALGPD+ ++ LSE+LDG ML  W D A        +W + L NL++    + +    
Sbjct  644  KSEALGPDYEIDMLSEVLDGSMLSKWQDLALSAKDQSCYWRFVLLNLSVVRAEILLDEAG  703

Query  194  DGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGAV  36
            DG  A ++A LEE+A+L D + P+    YST              W+I E AV
Sbjct  704  DGEVAEIDAVLEEAAELVDDSQPKKPSYYSTYEVQYTLRRQDDRSWKICEAAV  756



>tpg|DAA35367.1| TPA: LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_883312 
[Zea mays]
Length=302

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 92/169 (54%), Gaps = 15/169 (9%)
 Frame = -1

Query  527  FLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQAL  348
            +LS+R +S+    D   +V     ++   K+++ E         AE+LV++WQ+IKS+AL
Sbjct  140  WLSDRPNSNSKGSDKHPAVNDITAAVCKQKMDIQE---------AETLVKQWQDIKSEAL  190

Query  347  GPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVD----GRRA  180
            GPD++ + L EILDG ML  W D A        +W + L NL +    + +D    G  A
Sbjct  191  GPDYQTDMLPEILDGSMLSKWEDLALLAKDQSCYWRFVLLNLNVVRAEIILDEIGAGEAA  250

Query  179  IVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIVEGAV  36
             ++A LEE+A+L D + P+   SY +TY  +Y L     G W+I E AV
Sbjct  251  EIDAVLEEAAELVDDSQPKK-PSYYSTYEVQYVLRRQNDGSWKISEAAV  298



>dbj|BAK04719.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=403

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 83/146 (57%), Gaps = 6/146 (4%)
 Frame = -1

Query  458  VSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTD  279
            +S G   V       RM  + AE+LV++WQ+IKS+ALGPD+ ++ LS++LDG ML  W D
Sbjct  255  LSPGSGDVTAIARKERMSLQEAEALVKQWQDIKSEALGPDYEIDMLSDVLDGSMLSKWQD  314

Query  278  RAAEIAQHGWFWDYTLQNLTIDSVTVSV----DGRRAIVEATLEESAQLTDAAHPEHdds  111
             A        +W + L NL++    + +    DG  A ++A LEE+A+L D + P+   S
Sbjct  315  LALSAKDQSCYWRFVLLNLSVVRAEILLDEAGDGEVAEIDAVLEEAAELVDDSQPKK-PS  373

Query  110  ysttytTRYELSCGKSG-WRIVEGAV  36
            Y +TY  +Y L     G W+I E AV
Sbjct  374  YYSTYEVQYTLRRQDDGSWKICEAAV  399



>ref|NP_001132647.1| uncharacterized protein LOC100194122 [Zea mays]
 gb|ACF81578.1| unknown [Zea mays]
Length=302

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 92/169 (54%), Gaps = 15/169 (9%)
 Frame = -1

Query  527  FLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQAL  348
            +LS+R +S+    D   +V     ++   K+++ E         AE+LV++WQ+IKS+AL
Sbjct  140  WLSDRPNSNSKGSDKHPAVNDITAAVCKQKMDIQE---------AETLVKQWQDIKSEAL  190

Query  347  GPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVD----GRRA  180
            GPD++ + L EILDG ML  W D A        +W + L NL +    + +D    G  A
Sbjct  191  GPDYQTDMLPEILDGSMLSKWEDLALLAKDQSCYWRFVLLNLNVVRAEIILDEIGAGEAA  250

Query  179  IVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIVEGAV  36
             ++A LEE+A+L D + P+   SY +TY  +Y L     G W+I E AV
Sbjct  251  EIDAVLEEAAELVDDSQPKK-PSYYSTYEVQYVLRRQNDGSWKISEAAV  298



>tpg|DAA35365.1| TPA: hypothetical protein ZEAMMB73_883312 [Zea mays]
Length=800

 Score = 86.3 bits (212),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 92/169 (54%), Gaps = 15/169 (9%)
 Frame = -1

Query  527  FLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQAL  348
            +LS+R +S+    D   +V     ++   K+++ E         AE+LV++WQ+IKS+AL
Sbjct  638  WLSDRPNSNSKGSDKHPAVNDITAAVCKQKMDIQE---------AETLVKQWQDIKSEAL  688

Query  347  GPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVD----GRRA  180
            GPD++ + L EILDG ML  W D A        +W + L NL +    + +D    G  A
Sbjct  689  GPDYQTDMLPEILDGSMLSKWEDLALLAKDQSCYWRFVLLNLNVVRAEIILDEIGAGEAA  748

Query  179  IVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIVEGAV  36
             ++A LEE+A+L D + P+   SY +TY  +Y L     G W+I E AV
Sbjct  749  EIDAVLEEAAELVDDSQPKK-PSYYSTYEVQYVLRRQNDGSWKISEAAV  796



>ref|XP_002448767.1| hypothetical protein SORBIDRAFT_06g032820 [Sorghum bicolor]
 gb|EES13095.1| hypothetical protein SORBIDRAFT_06g032820 [Sorghum bicolor]
Length=798

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 79/131 (60%), Gaps = 6/131 (5%)
 Frame = -1

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M+ + AE+LV++WQ+IKS+ALGPD++ + L EILDG ML  W D A        +W + 
Sbjct  665  KMDIQEAEALVKQWQDIKSEALGPDYQTDMLPEILDGSMLSKWQDLALLAKDQSCYWRFV  724

Query  233  LQNLTIDSVTVSVD----GRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            L NL +    +++D    G  A ++A LEE+A+L D + P+   SY +TY  +Y L    
Sbjct  725  LLNLNVVRAEITLDEVGAGEAAEIDAVLEEAAELVDDSQPKK-PSYYSTYEVQYVLRRQN  783

Query  65   SG-WRIVEGAV  36
             G W+I E AV
Sbjct  784  DGSWKISEAAV  794



>ref|XP_010240606.1| PREDICTED: plastid division protein CDP1, chloroplastic [Brachypodium 
distachyon]
Length=804

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 71/129 (55%), Gaps = 4/129 (3%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M  + AE+LV++WQ+IKS+ALGPD+++  L EILD  ML  W D A        +W + L
Sbjct  672  MSLQEAEALVKQWQDIKSEALGPDYQINMLPEILDSSMLSKWQDLALLAKDQSCYWRFVL  731

Query  230  QNLTIDSVTVSVD----GRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS  63
             NL++    + +D    G  A ++A LEE+A+L D + P+    YST            S
Sbjct  732  LNLSVVRAEILLDEVAAGEVAEIDAVLEEAAELVDDSQPKKPSYYSTYEVKYVLRRQNDS  791

Query  62   GWRIVEGAV  36
             W+I E AV
Sbjct  792  SWKICEAAV  800



>ref|XP_005649950.1| hypothetical protein COCSUDRAFT_61625 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25406.1| hypothetical protein COCSUDRAFT_61625 [Coccomyxa subellipsoidea 
C-169]
Length=763

 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 82/150 (55%), Gaps = 7/150 (5%)
 Frame = -1

Query  479  SSVTADVVSIGPSKVEVSEEV-----PRMEARFAESLVRKWQNIKSQALGPDHRLEKLSE  315
            S++ A V + G + +   +E      P +    A SLV +WQ  K+ ALG DH +  L  
Sbjct  609  SNIAAAVTAPGRAAMGWVQETLVPPGPPLAVEDARSLVLRWQATKASALGGDHDVASLDG  668

Query  314  ILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDA  135
            IL  +ML+ W  RA  + +    W Y L+ +TID V  S DGRRA+VEATL E  +L  A
Sbjct  669  ILGERMLQAWKLRADALRKDQRHWRYDLREVTIDRVETSRDGRRALVEATLTEGGELL-A  727

Query  134  AHPEHddsysttytTRYELS-CGKSGWRIV  48
            A     DSY  T+T  YE+  CG  GWR+V
Sbjct  728  ADGTLIDSYRATFTQEYEMRLCGARGWRLV  757



>ref|XP_006653024.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Oryza brachyantha]
Length=728

 Score = 81.6 bits (200),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 72/129 (56%), Gaps = 4/129 (3%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M  + AE+LV++WQ+IKS+ALGPD++++ L EILDG ML  W + A        +W + L
Sbjct  596  MALQEAETLVKQWQDIKSEALGPDYQIDILPEILDGSMLSKWHNLALSAKDQSCYWRFVL  655

Query  230  QNLTIDSVTVSVD----GRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS  63
             NL++    + +D    G  A ++A LEE+A+L D + P+    YST             
Sbjct  656  LNLSVVRAEILLDETGSGEVAEIDAVLEEAAELVDESQPKKPSYYSTYEVQYILRKQCDG  715

Query  62   GWRIVEGAV  36
             W+I E +V
Sbjct  716  SWKIYEASV  724



>emb|CAJ86106.1| H0103C06.10 [Oryza sativa Indica Group]
Length=1136

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M  + AE+LV++WQ+IKS+ALGPD++++ L EILDG ML  W + A        +W + L
Sbjct  666  MALQEAETLVKQWQDIKSEALGPDYQIDMLPEILDGSMLSKWQELALSAKDQSCYWRFVL  725

Query  230  QNLTIDSVTVSVD----GRRAIVEATLEESAQLTDAAHPE  123
             NL++    + +D    G  A + A LEE+A+L D + P+
Sbjct  726  LNLSVVRAEILLDESGTGEVAEIGAVLEEAAELVDESQPK  765



>emb|CDO98565.1| unnamed protein product [Coffea canephora]
Length=837

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 69/128 (54%), Gaps = 3/128 (2%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M    AE+LVRKWQ+IK++ALGP+H +++L +ILD  ML  W   A        FW + L
Sbjct  706  MPVEEAETLVRKWQDIKAEALGPNHHVQRLFDILDESMLGQWQALADAAKAKSCFWKFVL  765

Query  230  QNLTI---DSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG  60
              L++   D +T       A +EA LEE+A+L D + P++ + YST     Y        
Sbjct  766  LQLSVLKADILTDETGNEMAEIEAILEEAAELVDDSQPKNPNYYSTYKIRYYLKRQYDGS  825

Query  59   WRIVEGAV  36
            WR  EG +
Sbjct  826  WRFCEGDI  833



>gb|EEC78247.1| hypothetical protein OsI_17910 [Oryza sativa Indica Group]
Length=1162

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 62/100 (62%), Gaps = 4/100 (4%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M  + AE+LV++WQ+IKS+ALGPD++++ L EILDG ML  W + A        +W + L
Sbjct  672  MALQEAETLVKQWQDIKSEALGPDYQIDMLPEILDGSMLSKWQELALSAKDQSCYWRFVL  731

Query  230  QNLTIDSVTVSVD----GRRAIVEATLEESAQLTDAAHPE  123
             NL++    + +D    G  A + A LEE+A+L D + P+
Sbjct  732  LNLSVVRAEILLDESGTGEVAEIGAVLEEAAELVDESQPK  771



>gb|EEE61900.1| hypothetical protein OsJ_16611 [Oryza sativa Japonica Group]
Length=1316

 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 4/95 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE+LV++WQ+IKS+ALGPD++++ L EILDG ML  W + A        +W + L NL++
Sbjct  672  AETLVKQWQDIKSEALGPDYQIDMLPEILDGSMLSKWQELALSAKDQSCYWRFVLLNLSV  731

Query  215  DSVTVSVD----GRRAIVEATLEESAQLTDAAHPE  123
                + +D    G  A + A LEE+A+L D + P+
Sbjct  732  VRAEILLDESGTGEVAEIGAVLEEAAELVDESQPK  766



>ref|XP_004960082.1| PREDICTED: LOW QUALITY PROTEIN: plastid division protein CDP1, 
chloroplastic-like [Setaria italica]
Length=800

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 72/130 (55%), Gaps = 4/130 (3%)
 Frame = -1

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M+ + AE+LV++WQ+IKS+ALGPD++++ L EILD  ++  W D A        +W + 
Sbjct  667  KMDIQEAEALVKQWQDIKSEALGPDYQIDMLLEILDDHLVVQWQDLALSAKDQSCYWRFV  726

Query  233  LQNLTIDSVTVSVD----GRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
            L NL +    + +D    G  A ++A LEE+A+L D + P+    YST            
Sbjct  727  LLNLDVVRAEIILDEVGAGEAAEIDAVLEEAAELVDDSQPKKPSYYSTYEVQYILRRQND  786

Query  65   SGWRIVEGAV  36
              W+I E AV
Sbjct  787  GSWKICEAAV  796



>emb|CBG76281.1| OO_Ba0005L10-OO_Ba0081K17.32 [Oryza officinalis]
Length=800

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 4/95 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE+LV++WQ+IKS+ALGPD++++ L EILDG ML  W   A        +W + L NL++
Sbjct  673  AETLVKQWQDIKSEALGPDYQIDMLPEILDGSMLSKWQGLALSAKDQSCYWRFVLLNLSV  732

Query  215  DSVTVSVD----GRRAIVEATLEESAQLTDAAHPE  123
                + +D    G  A ++  LEE+A+L D + P+
Sbjct  733  VRAEILLDESNAGEVAEIDVVLEEAAELVDESQPK  767



>emb|CDX92306.1| BnaA05g21010D [Brassica napus]
Length=805

 Score = 79.0 bits (193),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 69/125 (55%), Gaps = 6/125 (5%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LVR+W+NIK++ALGP H++  L E+LD  ML  W   A        +W + L NL I
Sbjct  678  AEELVRQWENIKAEALGPTHQVYSLPEVLDEAMLIQWQTLAQTAKAKSCYWRFVLLNLEI  737

Query  215  DSVTVSVD----GRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRI  51
                +S D    G  A +EA LEE+A+L D + P++   Y +TY  RY L   + G WR 
Sbjct  738  LQAHISTDGSIAGETAEIEAFLEEAAELVDESQPKN-AKYYSTYKIRYTLKKQEDGSWRF  796

Query  50   VEGAV  36
             +  +
Sbjct  797  CQSDI  801



>ref|XP_004235403.1| PREDICTED: plastid division protein CDP1, chloroplastic [Solanum 
lycopersicum]
Length=830

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 110/240 (46%), Gaps = 35/240 (15%)
 Frame = -1

Query  737  RHGNSFYTATESDELSHGDKT-FPENMAGFAERSPSDDQEQEMITEKIKDLVVKITSAGV  561
            ++G+ ++  T     SH  KT FP++ +    R PS+   +  ITEK+K L  K T    
Sbjct  618  KNGSGWWLNTPRTTSSHSWKTDFPQDPS---YRQPSN--RRSGITEKLKKLFPKFTM---  669

Query  560  AVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLV  381
                           + DS        S +     + G S    +     M    AE+L+
Sbjct  670  ---------------QIDS------QASGLQNSFFAAGLSPSATAAYKTPMPIEEAETLI  708

Query  380  RKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTV  201
            +KWQ IK++ALGPDH ++ L ++LD  ML  W   +        FW + L  L++    +
Sbjct  709  KKWQTIKAEALGPDHNIDGLFDVLDEPMLVQWQALSEAAKTRSCFWRFVLLQLSVLRAEI  768

Query  200  SVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIVEGAVL  33
              DG     A +EA LEE+A+L D +  ++  +Y +TY  RY L     G WR  EG +L
Sbjct  769  LTDGIGQEMAEIEAILEEAAELVDESQLKN-PNYYSTYKIRYVLKRQDGGAWRFSEGHIL  827



>ref|XP_011072068.1| PREDICTED: plastid division protein CDP1, chloroplastic [Sesamum 
indicum]
Length=831

 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 67/124 (54%), Gaps = 5/124 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE+LV++WQ IK++ALGPDH +  L EIL+G ML  W   A        FW + L  LT+
Sbjct  705  AETLVKRWQAIKAEALGPDHDIHCLFEILEGSMLVQWQALADAAKARSCFWRFVLLQLTV  764

Query  215  DSVTVSVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIV  48
                +  DG     A +E  LEE+A+L D   P++  +Y + Y  RY L     G WR  
Sbjct  765  VHADILKDGTGREMAEIEVLLEEAAELVDETQPKN-PTYYSPYKIRYLLKRQDDGSWRFC  823

Query  47   EGAV  36
            EG +
Sbjct  824  EGDI  827



>ref|XP_006441426.1| hypothetical protein CICLE_v10018888mg [Citrus clementina]
 gb|ESR54666.1| hypothetical protein CICLE_v10018888mg [Citrus clementina]
Length=812

 Score = 76.6 bits (187),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 93/185 (50%), Gaps = 11/185 (6%)
 Frame = -1

Query  578  ITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEAR  399
            I   GVA  L  LI +  L  R  S  L     S  +    S+  S + V++    +E  
Sbjct  631  IKRHGVASRLTELIKMVKLLFRNTSDTLY----SQSSCLPASLSTSNIAVTQRPMPLEE-  685

Query  398  FAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLT  219
             AE+LV++WQ IK++ALGP+H +  LSE LD  ML  W   A        +W + L  LT
Sbjct  686  -AEALVKQWQAIKAEALGPNHEVHSLSEALDESMLVQWEALADAAKARSCYWRFVLLQLT  744

Query  218  I---DSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRI  51
            I   D ++    G  A +EA LEE+A+L D + P++  +Y ++Y  RY L     G WR 
Sbjct  745  IVQADIISHGGVGEIAEIEAVLEEAAELVDESQPKN-PNYYSSYKIRYVLRKKDDGTWRF  803

Query  50   VEGAV  36
             +G +
Sbjct  804  CKGDI  808



>ref|XP_006493425.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Citrus sinensis]
Length=819

 Score = 76.3 bits (186),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 92/185 (50%), Gaps = 11/185 (6%)
 Frame = -1

Query  578  ITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEAR  399
            I   G+A  L  LI +  L  R  S  L     S  +    S+  S + V++    +E  
Sbjct  638  IKRHGIASRLTELIKMVKLLFRNTSDTLY----SQSSCLPASLSTSNIAVTQRPMPLEE-  692

Query  398  FAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLT  219
             AE+LV++WQ IK++ALGP+H +  LSE LD  ML  W   A        +W + L  LT
Sbjct  693  -AEALVKQWQAIKAEALGPNHEVHSLSEALDESMLVQWEALADAAKARSCYWRFVLLQLT  751

Query  218  IDSVTVSVD---GRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRI  51
            I    +  D   G  A +EA LEE+A+L D + P++  +Y ++Y  RY L     G WR 
Sbjct  752  IVQADIISDGGVGEIAEIEAVLEEAAELVDESQPKN-PNYYSSYKIRYVLRKKDDGTWRF  810

Query  50   VEGAV  36
             +G +
Sbjct  811  CKGDI  815



>gb|KDO46155.1| hypothetical protein CISIN_1g0034421mg, partial [Citrus sinensis]
Length=568

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 63/185 (34%), Positives = 93/185 (50%), Gaps = 11/185 (6%)
 Frame = -1

Query  578  ITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEAR  399
            I   G+A  L  LI +  L  R  S  L     S  +    S+  S + V++    +E  
Sbjct  387  IKRHGIASRLTELIKMVKLLFRNTSDTLY----SQSSCLPASLSTSNIAVTQRPMPLEE-  441

Query  398  FAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLT  219
             AE+LV++WQ IK++ALGP+H +  LSE LD  ML  W   A        +W + L  LT
Sbjct  442  -AEALVKQWQAIKAEALGPNHEVHSLSEALDESMLVQWEALADAAKARSCYWRFVLLQLT  500

Query  218  I---DSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRI  51
            I   D ++    G  A +EA LEE+A+L D + P++  +Y ++Y  RY L     G WR 
Sbjct  501  IVQADIISHGGVGEIAEIEAVLEEAAELVDESQPKN-PNYYSSYKIRYVLRKKDDGTWRF  559

Query  50   VEGAV  36
             +G +
Sbjct  560  CKGDI  564



>ref|XP_010275977.1| PREDICTED: plastid division protein CDP1, chloroplastic [Nelumbo 
nucifera]
Length=827

 Score = 74.7 bits (182),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 72/130 (55%), Gaps = 5/130 (4%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M    AE+LV++WQ IK++ALGP +++  LSEIL   ML  W   A        FW + L
Sbjct  696  MPVEEAEALVQEWQTIKAEALGPGYQVHGLSEILADSMLAQWQALAESAKARSCFWRFVL  755

Query  230  QNLTIDS---VTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG  60
              L++     V+    G  A +EA +EE+A+L D + P++  +Y +TY  RY L     G
Sbjct  756  LKLSVSQAEIVSNGTSGEIAEIEAMVEEAAELVDESQPKN-PTYYSTYKIRYLLKRQYDG  814

Query  59   -WRIVEGAVL  33
             WR  EG++L
Sbjct  815  SWRFCEGSIL  824



>ref|XP_006847842.1| hypothetical protein AMTR_s00029p00059460 [Amborella trichopoda]
 gb|ERN09423.1| hypothetical protein AMTR_s00029p00059460 [Amborella trichopoda]
Length=859

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 74/138 (54%), Gaps = 8/138 (6%)
 Frame = -1

Query  437  VEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQ  258
            V +  E+P  EA   E+LV++WQNIKS+ALGP+H +  L EIL   ML  W   A     
Sbjct  722  VLLKREMPFEEA---EALVKQWQNIKSEALGPNHHIHCLPEILAESMLSQWQALAESARL  778

Query  257  HGWFWDYTLQNLTIDSVTVSVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTR  87
               FW + L  ++I    +  DG     A +EA LEE+A+L D + P++  +Y +TY  R
Sbjct  779  RSCFWRFLLLQVSILRAEIVSDGIGWEMAEIEAVLEEAAELIDESQPKN-PNYYSTYQIR  837

Query  86   YELSCGKSG-WRIVEGAV  36
            Y L     G W+   G +
Sbjct  838  YVLKRQYDGTWKFCGGGI  855



>ref|XP_011047754.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=819

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 80/147 (54%), Gaps = 12/147 (8%)
 Frame = -1

Query  551  LLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKW  372
            LL+L+ +++  N+ D+   +K   S + A   SI PS   VS +  +M    AE+LV  W
Sbjct  650  LLSLLKMQY-GNQLDT---KKLQSSRLAA---SISPSMETVSRK--QMPVEEAEALVYHW  700

Query  371  QNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVD  192
            Q IK++ALGP +++  LSE+LD  ML  W D A        +W + L  L+I    +  D
Sbjct  701  QAIKAEALGPWYQVHSLSEVLDESMLAQWQDLAEAAKAQSCYWRFVLLQLSILRAEIFSD  760

Query  191  G---RRAIVEATLEESAQLTDAAHPEH  120
            G     A +E  LEE+A+L D +H ++
Sbjct  761  GYGLEIAEIEVLLEEAAELVDESHQKN  787



>ref|XP_011047753.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=824

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 80/147 (54%), Gaps = 12/147 (8%)
 Frame = -1

Query  551  LLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKW  372
            LL+L+ +++  N+ D+   +K   S + A   SI PS   VS +  +M    AE+LV  W
Sbjct  655  LLSLLKMQY-GNQLDT---KKLQSSRLAA---SISPSMETVSRK--QMPVEEAEALVYHW  705

Query  371  QNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVD  192
            Q IK++ALGP +++  LSE+LD  ML  W D A        +W + L  L+I    +  D
Sbjct  706  QAIKAEALGPWYQVHSLSEVLDESMLAQWQDLAEAAKAQSCYWRFVLLQLSILRAEIFSD  765

Query  191  G---RRAIVEATLEESAQLTDAAHPEH  120
            G     A +E  LEE+A+L D +H ++
Sbjct  766  GYGLEIAEIEVLLEEAAELVDESHQKN  792



>ref|XP_010666542.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=834

 Score = 73.9 bits (180),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 77/138 (56%), Gaps = 10/138 (7%)
 Frame = -1

Query  542  LIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNI  363
            L  LKF + R  ++  R+   SS+TA + S  P+   V + V  +EA  AE LVR+WQ I
Sbjct  666  LSTLKFGTTRHSNTGNRQK--SSLTASLSSPTPA---VYKRVMNLEA--AEGLVRQWQMI  718

Query  362  KSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI---DSVTVSVD  192
            K++ALGPDH+++ L +ILD  ML  W D A        FW + L  L++   D  + +  
Sbjct  719  KAEALGPDHQIDLLFDILDEAMLLEWQDLADAAKTKSCFWRFVLLQLSVLRADIFSDTTG  778

Query  191  GRRAIVEATLEESAQLTD  138
               A ++  LEE+A+L D
Sbjct  779  AETAEIDILLEEAAELID  796



>ref|XP_010666543.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=833

 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 77/138 (56%), Gaps = 10/138 (7%)
 Frame = -1

Query  542  LIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNI  363
            L  LKF + R  ++  R+   SS+TA + S  P+   V + V  +EA  AE LVR+WQ I
Sbjct  665  LSTLKFGTTRHSNTGNRQK--SSLTASLSSPTPA---VYKRVMNLEA--AEGLVRQWQMI  717

Query  362  KSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI---DSVTVSVD  192
            K++ALGPDH+++ L +ILD  ML  W D A        FW + L  L++   D  + +  
Sbjct  718  KAEALGPDHQIDLLFDILDEAMLLEWQDLADAAKTKSCFWRFVLLQLSVLRADIFSDTTG  777

Query  191  GRRAIVEATLEESAQLTD  138
               A ++  LEE+A+L D
Sbjct  778  AETAEIDILLEEAAELID  795



>gb|EYU22294.1| hypothetical protein MIMGU_mgv1a001394mg [Erythranthe guttata]
Length=826

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 69/130 (53%), Gaps = 5/130 (4%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M    AE+LV++WQ IK++ALGP+H    L +IL+G ML  W   A        FW + L
Sbjct  695  MPVEEAETLVKQWQAIKAEALGPNHDTGGLVDILEGSMLVQWQALADAAKGRSCFWRFVL  754

Query  230  QNLTIDSVTVSVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTRYELS-CGKS  63
              LTI    V  DG     A +E  LEE+A+L D + P++  +Y + Y  RY L   G  
Sbjct  755  LRLTIVHADVLEDGMGREMAEIEVRLEEAAELVDESQPKN-PTYYSPYKIRYLLKRQGDG  813

Query  62   GWRIVEGAVL  33
             W+  EG +L
Sbjct  814  SWKFCEGDIL  823



>ref|XP_006353937.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Solanum tuberosum]
Length=830

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE+L++KWQ IK++ALGPDH ++ L ++LD  ML  W   +        FW + L  L++
Sbjct  704  AETLIKKWQTIKAEALGPDHNIDGLFDVLDEPMLVQWQALSEAAKTRSCFWRFVLLQLSV  763

Query  215  DSVTVSVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIV  48
                +  DG     A +EA LEE+A+L D +  ++  +Y +TY  RY L     G WR  
Sbjct  764  LRAEILTDGIGQEMAEIEAILEEAAELVDESQLKN-PNYYSTYKIRYVLKRQDGGAWRFS  822

Query  47   EGAVL  33
            EG +L
Sbjct  823  EGDIL  827



>ref|XP_009792114.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=831

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE+LV+KWQ IK++ALGPDH ++ L ++LD  ML  W   +        FW + L  L++
Sbjct  705  AETLVKKWQTIKAEALGPDHNIDGLFDVLDEPMLVQWQGLSEAAKTTSCFWRFVLLQLSV  764

Query  215  DSVTVSVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIV  48
                +  DG     A +EA LEE+A+L D +  ++  +Y +TY  RY L     G WR  
Sbjct  765  LRAEILTDGTGQEMAEIEAILEEAAELVDESQLKN-PNYYSTYKIRYVLKRQDDGSWRFS  823

Query  47   EGAVL  33
            EG +L
Sbjct  824  EGDIL  828



>ref|XP_009590614.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=831

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE+LV+KWQ IK++ALGPDH ++ L ++LD  ML  W   +        FW + L  L++
Sbjct  705  AETLVKKWQTIKAEALGPDHNIDGLFDVLDEPMLVQWQGLSEAAKTTSCFWRFVLLQLSV  764

Query  215  DSVTVSVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIV  48
                +  DG     A +EA LEE+A+L D +  ++  +Y +TY  RY L     G WR  
Sbjct  765  LRAEILTDGTGQEMAEIEAVLEEAAELVDESQLKN-PNYYSTYKIRYVLKRQDDGSWRFS  823

Query  47   EGAVL  33
            EG +L
Sbjct  824  EGDIL  828



>ref|XP_009792113.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=832

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE+LV+KWQ IK++ALGPDH ++ L ++LD  ML  W   +        FW + L  L++
Sbjct  706  AETLVKKWQTIKAEALGPDHNIDGLFDVLDEPMLVQWQGLSEAAKTTSCFWRFVLLQLSV  765

Query  215  DSVTVSVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIV  48
                +  DG     A +EA LEE+A+L D +  ++  +Y +TY  RY L     G WR  
Sbjct  766  LRAEILTDGTGQEMAEIEAILEEAAELVDESQLKN-PNYYSTYKIRYVLKRQDDGSWRFS  824

Query  47   EGAVL  33
            EG +L
Sbjct  825  EGDIL  829



>gb|KDP45812.1| hypothetical protein JCGZ_17419 [Jatropha curcas]
Length=834

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 74/141 (52%), Gaps = 14/141 (10%)
 Frame = -1

Query  551  LLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKW  372
            LL ++ ++F       S LRK   + + A++     S+ +       M A  AE+LV++W
Sbjct  667  LLGMVKMQF----QKESDLRKYKNTELAANLAPRTLSRKQ-------MPAEEAEALVKQW  715

Query  371  QNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVD  192
            Q IK++ALGP+H +  LS++LD  ML  W   A E      +W + L  L++    +  D
Sbjct  716  QAIKAEALGPNHEIHSLSKVLDESMLAQWQALANEAKARPCYWRFVLLQLSVLRADIFSD  775

Query  191  G---RRAIVEATLEESAQLTD  138
            G     A +EA LEE+A+L D
Sbjct  776  GYGVELAEIEAVLEEAAELVD  796



>ref|XP_009590613.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=832

 Score = 72.8 bits (177),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 70/125 (56%), Gaps = 5/125 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE+LV+KWQ IK++ALGPDH ++ L ++LD  ML  W   +        FW + L  L++
Sbjct  706  AETLVKKWQTIKAEALGPDHNIDGLFDVLDEPMLVQWQGLSEAAKTTSCFWRFVLLQLSV  765

Query  215  DSVTVSVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIV  48
                +  DG     A +EA LEE+A+L D +  ++  +Y +TY  RY L     G WR  
Sbjct  766  LRAEILTDGTGQEMAEIEAVLEEAAELVDESQLKN-PNYYSTYKIRYVLKRQDDGSWRFS  824

Query  47   EGAVL  33
            EG +L
Sbjct  825  EGDIL  829



>ref|XP_004164805.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Cucumis sativus]
Length=844

 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 73/130 (56%), Gaps = 5/130 (4%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M    AE+LV +WQ IK++ALGP++++ KL++ILDG ML  W   A        +W + L
Sbjct  713  MSVEEAEALVNQWQTIKAEALGPNYQIHKLAKILDGTMLFQWEALADAAKAKSCYWKFVL  772

Query  230  QNLTIDSVTVSVDGRRAI---VEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG  60
              L++    +  D   A+   +E  LEE+A+L + A P++  SY + Y  RY +   + G
Sbjct  773  LQLSVLRAELLSDKFGAMALEIEVHLEEAAELVNEAEPKN-PSYYSNYKVRYLVKKQRDG  831

Query  59   -WRIVEGAVL  33
             W+  EG +L
Sbjct  832  SWKFCEGDIL  841



>ref|WP_015116621.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Rivularia sp. PCC 7116]
 gb|AFY53043.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Rivularia sp. PCC 7116]
Length=772

 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 68/124 (55%), Gaps = 1/124 (1%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE +VR W +IK QALG +H ++ L+ IL G  L +W + A ++ Q   +  +   NL+I
Sbjct  648  AEEIVRNWLSIKGQALGQNHNIQSLNNILTGTALALWRNIAQQVKQKNHYRTFDHSNLSI  707

Query  215  DSV-TVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRIVEGA  39
            +SV TV  +  +A +EAT+ E A+           SY+ T   RY +S     WRI E +
Sbjct  708  ESVDTVPGNNNQAAIEATVTEQARFYQNGKINERRSYNDTIKVRYMVSKIGGKWRIKEMS  767

Query  38   VLKS  27
            VL +
Sbjct  768  VLST  771



>ref|XP_004138549.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Cucumis sativus]
Length=844

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 73/130 (56%), Gaps = 5/130 (4%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M    AE+LV +WQ IK++ALGP++++ KL++ILDG ML  W   A        +W + L
Sbjct  713  MSVEEAEALVNQWQTIKAEALGPNYQIHKLAKILDGTMLFQWEALADAAKAKSCYWKFVL  772

Query  230  QNLTIDSVTVSVDGRRAI---VEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG  60
              L++    +  D   A+   +E  LEE+A+L + A P++  SY + Y  RY +   + G
Sbjct  773  LQLSVLRAELLSDKFGAMALEIEVHLEEAAELVNEAEPKN-PSYYSNYKVRYLVKKQQDG  831

Query  59   -WRIVEGAVL  33
             W+  EG +L
Sbjct  832  SWKFCEGDIL  841



>ref|XP_008803150.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Phoenix dactylifera]
Length=832

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = -1

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M A  AE+LV++WQ+IK+ ALGP ++++ LSEIL   ML  W D A        FW + 
Sbjct  695  QMTAEEAEALVKQWQDIKAVALGPSYQIQALSEILAESMLSKWQDLAHSAKARSCFWRFV  754

Query  233  LQNLTIDSVTVSVDG---RRAIVEATLEESAQLTD  138
            L +L+I    +  DG     A +EA LEE+A+L D
Sbjct  755  LLHLSILRAEIISDGVGSEIAEIEAVLEEAAELVD  789



>gb|KFK39238.1| hypothetical protein AALP_AA3G218300 [Arabis alpina]
Length=821

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 69/124 (56%), Gaps = 5/124 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LVR+W+N K++ALGP H++ +LSE+LD  ML  W   A        +W + L +L I
Sbjct  695  AEELVRQWENTKAEALGPTHQVYRLSELLDEFMLVQWQTLAETAKAKSCYWRFVLLHLEI  754

Query  215  DSVTVSVD---GRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIV  48
                +  D   G  A +EA +EE+A+L D + P++   Y +TY  RY L   + G W+  
Sbjct  755  LQADIFPDGIAGEVAEIEALIEEAAELVDESQPKN-AKYCSTYKIRYTLKKQEDGSWKFC  813

Query  47   EGAV  36
            E  +
Sbjct  814  ESDI  817



>ref|XP_010935548.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X5 [Elaeis guineensis]
Length=827

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 73/134 (54%), Gaps = 7/134 (5%)
 Frame = -1

Query  530  KFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQA  351
            + L ++ D+  L+    +S   D +S+ P+      ++ +M    AE+LV++WQ+IK+ A
Sbjct  660  RHLKHQKDAETLQ----NSWPTDDLSLLPAVAGNLLQMEQMAVEEAEALVKQWQDIKAVA  715

Query  350  LGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVDG---RRA  180
            LGP ++++ LSEIL   ML  W D A        FW + L +L+I    +  DG     A
Sbjct  716  LGPSYKIQALSEILAESMLSKWQDLAHSAKARSCFWRFVLLHLSIQRADIISDGVGSEIA  775

Query  179  IVEATLEESAQLTD  138
             +E  LEE+A+L D
Sbjct  776  EIEGVLEEAAELVD  789



>ref|XP_010935546.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X3 [Elaeis guineensis]
Length=831

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 73/134 (54%), Gaps = 7/134 (5%)
 Frame = -1

Query  530  KFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQA  351
            + L ++ D+  L+    +S   D +S+ P+      ++ +M    AE+LV++WQ+IK+ A
Sbjct  660  RHLKHQKDAETLQ----NSWPTDDLSLLPAVAGNLLQMEQMAVEEAEALVKQWQDIKAVA  715

Query  350  LGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVDG---RRA  180
            LGP ++++ LSEIL   ML  W D A        FW + L +L+I    +  DG     A
Sbjct  716  LGPSYKIQALSEILAESMLSKWQDLAHSAKARSCFWRFVLLHLSIQRADIISDGVGSEIA  775

Query  179  IVEATLEESAQLTD  138
             +E  LEE+A+L D
Sbjct  776  EIEGVLEEAAELVD  789



>ref|XP_010935544.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=866

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 73/134 (54%), Gaps = 7/134 (5%)
 Frame = -1

Query  530  KFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQA  351
            + L ++ D+  L+    +S   D +S+ P+      ++ +M    AE+LV++WQ+IK+ A
Sbjct  660  RHLKHQKDAETLQ----NSWPTDDLSLLPAVAGNLLQMEQMAVEEAEALVKQWQDIKAVA  715

Query  350  LGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVDG---RRA  180
            LGP ++++ LSEIL   ML  W D A        FW + L +L+I    +  DG     A
Sbjct  716  LGPSYKIQALSEILAESMLSKWQDLAHSAKARSCFWRFVLLHLSIQRADIISDGVGSEIA  775

Query  179  IVEATLEESAQLTD  138
             +E  LEE+A+L D
Sbjct  776  EIEGVLEEAAELVD  789



>ref|XP_010935547.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X4 [Elaeis guineensis]
Length=829

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 73/134 (54%), Gaps = 7/134 (5%)
 Frame = -1

Query  530  KFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQA  351
            + L ++ D+  L+    +S   D +S+ P+      ++ +M    AE+LV++WQ+IK+ A
Sbjct  660  RHLKHQKDAETLQ----NSWPTDDLSLLPAVAGNLLQMEQMAVEEAEALVKQWQDIKAVA  715

Query  350  LGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVDG---RRA  180
            LGP ++++ LSEIL   ML  W D A        FW + L +L+I    +  DG     A
Sbjct  716  LGPSYKIQALSEILAESMLSKWQDLAHSAKARSCFWRFVLLHLSIQRADIISDGVGSEIA  775

Query  179  IVEATLEESAQLTD  138
             +E  LEE+A+L D
Sbjct  776  EIEGVLEEAAELVD  789



>ref|XP_010935545.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=839

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 73/134 (54%), Gaps = 7/134 (5%)
 Frame = -1

Query  530  KFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQA  351
            + L ++ D+  L+    +S   D +S+ P+      ++ +M    AE+LV++WQ+IK+ A
Sbjct  660  RHLKHQKDAETLQ----NSWPTDDLSLLPAVAGNLLQMEQMAVEEAEALVKQWQDIKAVA  715

Query  350  LGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVDG---RRA  180
            LGP ++++ LSEIL   ML  W D A        FW + L +L+I    +  DG     A
Sbjct  716  LGPSYKIQALSEILAESMLSKWQDLAHSAKARSCFWRFVLLHLSIQRADIISDGVGSEIA  775

Query  179  IVEATLEESAQLTD  138
             +E  LEE+A+L D
Sbjct  776  EIEGVLEEAAELVD  789



>ref|XP_008463100.1| PREDICTED: plastid division protein CDP1, chloroplastic [Cucumis 
melo]
 ref|XP_008463101.1| PREDICTED: plastid division protein CDP1, chloroplastic [Cucumis 
melo]
Length=844

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 73/125 (58%), Gaps = 5/125 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE+LV++WQ IK++ALGP++++ +L++ILDG ML  W   A        +W + L  L++
Sbjct  718  AEALVKQWQTIKAEALGPNYQIHRLAKILDGTMLFQWQALADAAKAKSCYWKFVLLQLSV  777

Query  215  DSVTVSVDGRRAI---VEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIV  48
                +  D   A+   +E  LEE+A+L + A P++  SY + Y  RY +   + G W+  
Sbjct  778  LRAELLSDKFGAMALEIEVHLEEAAELVNEAEPKN-PSYYSNYKVRYLVKRLQDGSWKFC  836

Query  47   EGAVL  33
            EG +L
Sbjct  837  EGDIL  841



>ref|XP_010069516.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW57894.1| hypothetical protein EUGRSUZ_H00644 [Eucalyptus grandis]
Length=823

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 73/129 (57%), Gaps = 5/129 (4%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+   AESLV++WQ IK++ALGPD++++ L EILD  ML  W     +      +W + L
Sbjct  692  MQLEDAESLVKQWQTIKAEALGPDYQVQFLPEILDESMLVQWEALVDKAKARSCYWRFVL  751

Query  230  QNLTIDSVTVSVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG  60
              L++       DG     A ++A LEE+A+L D + P++  +Y ++Y  RY L   + G
Sbjct  752  LQLSVLRAETLSDGMGIEMAEIDALLEEAAELVDESQPKN-PNYYSSYKIRYVLKKQEDG  810

Query  59   -WRIVEGAV  36
             W+  +G V
Sbjct  811  SWKFCKGDV  819



>ref|XP_010069515.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
Length=824

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 73/129 (57%), Gaps = 5/129 (4%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+   AESLV++WQ IK++ALGPD++++ L EILD  ML  W     +      +W + L
Sbjct  693  MQLEDAESLVKQWQTIKAEALGPDYQVQFLPEILDESMLVQWEALVDKAKARSCYWRFVL  752

Query  230  QNLTIDSVTVSVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG  60
              L++       DG     A ++A LEE+A+L D + P++  +Y ++Y  RY L   + G
Sbjct  753  LQLSVLRAETLSDGMGIEMAEIDALLEEAAELVDESQPKN-PNYYSSYKIRYVLKKQEDG  811

Query  59   -WRIVEGAV  36
             W+  +G V
Sbjct  812  SWKFCKGDV  820



>ref|XP_006386191.1| hypothetical protein POPTR_0002s02900g, partial [Populus trichocarpa]
 gb|ERP63988.1| hypothetical protein POPTR_0002s02900g, partial [Populus trichocarpa]
Length=411

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 60/82 (73%), Gaps = 4/82 (5%)
 Frame = -1

Query  929  YYDDPMVLRYLERLEGVGGSPLaaaaaiarigaeatAVLDSVKVSAIQALQKVIPLGDGE  750
            YYDDP+VLRYLER EG G SPLAAAAAI RIGAEATAV+D VK SAIQALQKV PLG  +
Sbjct  265  YYDDPIVLRYLERQEGGGRSPLAAAAAIVRIGAEATAVIDHVKASAIQALQKVFPLGHKD  324

Query  749  TSVRRHGNSF----YTATESDE  696
                 H N +    + A E++E
Sbjct  325  IGAEIHENDWINYVHPAVETEE  346



>ref|XP_010940349.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=826

 Score = 70.9 bits (172),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = -1

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M    AE+LV++WQ+IK++ALGP+++++ LSEIL   ML  W D A        FW + 
Sbjct  694  QMAVEEAEALVKQWQDIKAEALGPNYQIQALSEILAETMLSKWQDLAHSAKARSCFWRFV  753

Query  233  LQNLTIDSVTVSVD---GRRAIVEATLEESAQLTD  138
            L +L+I    +  D      A +EA LEE+A+L D
Sbjct  754  LLDLSILRAEIVSDESGSEIAEIEAVLEEAAELVD  788



>ref|XP_008375062.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X1 [Malus domestica]
Length=810

 Score = 70.9 bits (172),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 67/126 (53%), Gaps = 9/126 (7%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LV++WQ IK++ALGP H +  LSEILD  ML  W   A        +W + L  L++
Sbjct  684  AEYLVKQWQAIKAEALGPTHEIHSLSEILDDSMLVQWQALADAAKARSCYWKFVLLQLSV  743

Query  215  ---DSVTVSVDGRRAIVEATLEESAQLTDAA---HPEHddsysttytTRYELSCGKSGWR  54
               + ++  V G RA +EA +EE+A+L + +   +P +  +Y   Y  R +       WR
Sbjct  744  LGAEIISDEVGGERAEIEAVVEEAAELVNESEQRNPSYYSTYKIWYVLRRQ---EDGSWR  800

Query  53   IVEGAV  36
              EG V
Sbjct  801  FCEGEV  806



>ref|XP_006374279.1| hypothetical protein POPTR_0015s05630g [Populus trichocarpa]
 gb|ERP52076.1| hypothetical protein POPTR_0015s05630g [Populus trichocarpa]
Length=815

 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 79/147 (54%), Gaps = 12/147 (8%)
 Frame = -1

Query  551  LLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKW  372
            LL+++ +++  N+ D+   +K   S + A   SI PS   VS +  +M    AE+LV  W
Sbjct  655  LLSMLKMQY-GNQLDT---KKLQSSRLAA---SISPSMETVSRK--QMPVEEAEALVNHW  705

Query  371  QNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVD  192
            Q IK++ALGP +++  LSE+LD  ML  W D A        +W + L  L+I    +  D
Sbjct  706  QAIKAEALGPWYQVHSLSEVLDESMLAQWQDLAEAAKAQSCYWRFVLLQLSILRADIFSD  765

Query  191  G---RRAIVEATLEESAQLTDAAHPEH  120
            G     A +E  LEE+A+L D +  ++
Sbjct  766  GYGLEIAEIEVLLEEAAELVDESQQKN  792



>ref|XP_009401118.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401126.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=826

 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 67/124 (54%), Gaps = 5/124 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE+LV +WQ+IK++ALGP H+++ LS IL   ML  W D A        FW + L    I
Sbjct  700  AEALVHQWQDIKAEALGPSHQIQLLSNILSEAMLSKWQDLANSAKAKSCFWRFVLIQAAI  759

Query  215  DSVTVSVDG---RRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIV  48
                +  DG     A +EA +EE+A+L D + P+   SY +TY   Y L   + G WRI 
Sbjct  760  LRAEIVSDGGDDEFAEIEAVIEEAAELVDESEPKK-PSYYSTYKVHYILRRQEDGSWRIC  818

Query  47   EGAV  36
             G +
Sbjct  819  RGDI  822



>gb|KHN24502.1| Plastid division protein CDP1, chloroplastic [Glycine soja]
Length=812

 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 67/131 (51%), Gaps = 3/131 (2%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M    AE++VR+WQ IK++ALGP H +  L+++LD  ML  W   A    +   +W + L
Sbjct  681  MPVEEAETMVRQWQTIKAEALGPSHEVNCLAQVLDESMLAQWKGLANAAKERSCYWRFLL  740

Query  230  QNLTIDSVTVSVDGR---RAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG  60
              L+I    +  DG     A +EA LEE+++L D +  ++ + Y T          G   
Sbjct  741  LKLSIIRADILSDGNGDDMAEIEALLEEASELVDGSQQKNPNYYLTYKVKYVMKRQGDGS  800

Query  59   WRIVEGAVLKS  27
            W+  E  ++++
Sbjct  801  WKFCENDIMET  811



>ref|XP_006376689.1| hypothetical protein POPTR_0012s033001g, partial [Populus trichocarpa]
 gb|ERP54486.1| hypothetical protein POPTR_0012s033001g, partial [Populus trichocarpa]
Length=485

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 79/147 (54%), Gaps = 12/147 (8%)
 Frame = -1

Query  551  LLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKW  372
            LL+++ +++  N+ D+   +K   S + A   SI PS   VS +  +M    AE+LV  W
Sbjct  316  LLSMLKMQY-GNQLDT---KKLQSSRLAA---SISPSMETVSRK--QMPVEEAEALVNHW  366

Query  371  QNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVD  192
            Q IK++ALGP +++  LSE+LD  ML  W D A        +W + L  L+I    +  D
Sbjct  367  QAIKAEALGPWYQVHSLSEVLDESMLAQWQDLAEAAKAQSCYWRFVLLQLSILRADIFSD  426

Query  191  G---RRAIVEATLEESAQLTDAAHPEH  120
            G     A +E  LEE+A+L D +  ++
Sbjct  427  GYGLEIAEIEVLLEEAAELVDESQQKN  453



>ref|XP_005850325.1| hypothetical protein CHLNCDRAFT_50630 [Chlorella variabilis]
 gb|EFN58223.1| hypothetical protein CHLNCDRAFT_50630 [Chlorella variabilis]
Length=848

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 83/159 (52%), Gaps = 3/159 (2%)
 Frame = -1

Query  506  SSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLE  327
            +++LR+  G+ ++             +  V ++    A S++ +WQ IK+ ALGP+H + 
Sbjct  692  AALLRQQQGAGLSPAAAPPAAVAARAAAPVVQLSRSEAASVIGRWQGIKAAALGPEHDIG  751

Query  326  KLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQ  147
             L  IL G +L  W +RA +I + GW + +T++   I+ V V  DG  A V AT  E+ Q
Sbjct  752  GLGAILRGDVLGQWQERAQQIQKKGWHYLHTMEASQINGVEVGADG-VASVSATFREAVQ  810

Query  146  LTDAAHPEHddsysttytTRYELSCGKSGWRIVEGAVLK  30
                A+ E   ++ + Y+  YEL      W ++ GAV++
Sbjct  811  AHRGAN-EPMQAFRSEYSVDYELMHEGGSW-VITGAVVR  847



>ref|WP_036533714.1| hypothetical protein [Neosynechococcus sphagnicola]
Length=263

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 69/144 (48%), Gaps = 5/144 (3%)
 Frame = -1

Query  467  ADVVSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKV  288
            A ++ + P+  E +     +    AE  ++ W   K+ ALGPDH++++L +IL    L  
Sbjct  124  AALLPLPPTHAEAT-----LTQTVAEKTIQTWLATKAIALGPDHKIDQLPQILAEPALSA  178

Query  287  WTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsy  108
            W  RA E  Q GW+W Y  +        + V   +A V+  + E+A+L +      + SY
Sbjct  179  WQQRATEAQQQGWYWKYQHKLEPTSLKLLEVSPNQAQVQVQVGEAAELYEGGQLNSNASY  238

Query  107  sttytTRYELSCGKSGWRIVEGAV  36
                  RY+L    + WRI + AV
Sbjct  239  DAQLLVRYQLVRNGTQWRIQDMAV  262



>ref|WP_015144712.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Pleurocapsa minor]
 gb|AFY78412.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Pleurocapsa sp. PCC 7327]
Length=770

 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 87/188 (46%), Gaps = 1/188 (1%)
 Frame = -1

Query  590  LVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDDGS-SVTADVVSIGPSKVEVSEEVP  414
            L++   +    VG   L+   F ++ +  + L+ +  S ++    ++I P+  +V     
Sbjct  583  LLLGAAAVVFGVGAFGLVNKWFEASSSPLNALKGEQLSIALNRPPIAIPPADAQVVIPPE  642

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
             +  + AE +++ W  +KSQA+G  H++EKL EIL G +L  W DR A++     +W Y 
Sbjct  643  VLTQQGAEQVIQTWLTVKSQAMGSQHQVEKLDEILTGTLLSQWRDRVAKLKGSNNYWHYQ  702

Query  233  LQNLTIDSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWR  54
             Q       T + +  RA VEA++ E A            S   +   RYEL   +  W 
Sbjct  703  HQMQVRSLKTDTQNPDRATVEASVREIANYYQNGQLNRGQSDDYSIRVRYELVRQQGRWL  762

Query  53   IVEGAVLK  30
            I    VL+
Sbjct  763  IQSSQVLR  770



>gb|KCW57895.1| hypothetical protein EUGRSUZ_H00644 [Eucalyptus grandis]
Length=796

 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+   AESLV++WQ IK++ALGPD++++ L EILD  ML  W     +      +W + L
Sbjct  692  MQLEDAESLVKQWQTIKAEALGPDYQVQFLPEILDESMLVQWEALVDKAKARSCYWRFVL  751

Query  230  QNLTIDSVTVSVDG---RRAIVEATLEESAQLTDAAHPEH  120
              L++       DG     A ++A LEE+A+L D + P++
Sbjct  752  LQLSVLRAETLSDGMGIEMAEIDALLEEAAELVDESQPKN  791



>ref|XP_009355926.1| PREDICTED: plastid division protein CDP1, chloroplastic [Pyrus 
x bretschneideri]
Length=812

 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 67/124 (54%), Gaps = 5/124 (4%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LV++WQ IK++ALGP H +  LSEILD  ML  W   A        +W + L  L++
Sbjct  686  AEDLVKQWQAIKAEALGPTHEIHSLSEILDDSMLVQWQALADAAKARSCYWKFVLLQLSV  745

Query  215  ---DSVTVSVDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSG-WRIV  48
               + ++  V G RA +E  +EE+A+L + +  ++   YST     Y L   + G WR  
Sbjct  746  LGAEIISDEVGGERAEIEVVVEEAAELVNESEQKNPSYYSTYKIW-YALKRQEDGSWRFC  804

Query  47   EGAV  36
            EG V
Sbjct  805  EGEV  808



>ref|WP_026097405.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=719

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 94/223 (42%), Gaps = 21/223 (9%)
 Frame = -1

Query  671  PENMAGFAERSPSDDQEQEMITEKIKDLVVKITSAGVAVGL----LTLIGLKFLSNRADS  504
            P N  G  E SP   +       + +   +KI    +A+G+    L L+G    S     
Sbjct  496  PSNPFGLDEDSPPSARRTGRRGRRPRRKGLKIDRLMIAIGVGVLGLALLGFILTSILGGL  555

Query  503  SILRKDDGSSVTADVVSIGPSKVEVSEEVP-----------RMEARFAESLVRKWQNIKS  357
            + +    G  +  D + IG +   V  E+P            ++   A + ++ W N+K+
Sbjct  556  AAMLGLSGPELDDDGLDIGIATPPV--ELPDATLPAIDPNAPIDTETARTTIQNWLNVKA  613

Query  356  QALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSV-DGRRA  180
             A+G D +++K+ EIL G  L  W + A     +GW+W+Y   +L I SVT    D  RA
Sbjct  614  NAMGSDRQIDKIQEILTGPALAEWQELAERAQTNGWYWEYQ-HDLDISSVTPDANDPNRA  672

Query  179  IVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKSGWRI  51
            +  A + E A L +   P      +      YEL      W+I
Sbjct  673  VATAQVREQATLYEGGQP--TTERNDNLNVMYELIRSDGTWKI  713



>gb|KGN45850.1| hypothetical protein Csa_6G014700 [Cucumis sativus]
Length=817

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M    AE+LV +WQ IK++ALGP++++ KL++ILDG ML  W   A        +W + L
Sbjct  713  MSVEEAEALVNQWQTIKAEALGPNYQIHKLAKILDGTMLFQWEALADAAKAKSCYWKFVL  772

Query  230  QNLTIDSVTVSVDGRRAI---VEATLEESAQLTDAAHPEH  120
              L++    +  D   A+   +E  LEE+A+L + A P++
Sbjct  773  LQLSVLRAELLSDKFGAMALEIEVHLEEAAELVNEAEPKN  812



>ref|XP_003549173.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Glycine max]
Length=812

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 55/95 (58%), Gaps = 3/95 (3%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE++VR+WQ IK++ALGP H +  L+++LD  ML  W   A    +   +W + L  L+I
Sbjct  686  AETMVRQWQTIKAEALGPSHEVNCLAQVLDESMLAQWKGLANAAKERSCYWRFLLLKLSI  745

Query  215  DSVTVSVDGR---RAIVEATLEESAQLTDAAHPEH  120
                +  DG     A +EA LEE+++L D +  ++
Sbjct  746  IRADILSDGNGDDMAEIEALLEEASELVDGSQQKN  780



>ref|XP_007210360.1| hypothetical protein PRUPE_ppa001548mg [Prunus persica]
 gb|EMJ11559.1| hypothetical protein PRUPE_ppa001548mg [Prunus persica]
Length=804

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 66/126 (52%), Gaps = 9/126 (7%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LV++WQ IK++ALGP H ++ L EILD  ML  W   A        +W + L  L++
Sbjct  678  AEDLVKQWQAIKAEALGPSHEIDSLCEILDQSMLVQWQALADAAKARSCYWRFVLLQLSV  737

Query  215  ---DSVTVSVDGRRAIVEATLEESAQLTDAA---HPEHddsysttytTRYELSCGKSGWR  54
               + ++  V G  A +EA LEE+A+L + +   +P +  +Y   Y  R +       WR
Sbjct  738  LRAEILSDEVGGEIAEIEAVLEEAAELVNESEQKNPSYYSTYKIWYVLRRQ---ADGSWR  794

Query  53   IVEGAV  36
              EG V
Sbjct  795  FCEGKV  800



>ref|XP_008240341.1| PREDICTED: plastid division protein CDP1, chloroplastic [Prunus 
mume]
Length=814

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 66/126 (52%), Gaps = 9/126 (7%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LV++WQ IK++ALGP H ++ L EILD  ML  W   A        +W + L  L++
Sbjct  688  AEDLVKQWQAIKAEALGPSHEIDSLCEILDQSMLVQWQALADAAKARSCYWRFVLLQLSV  747

Query  215  ---DSVTVSVDGRRAIVEATLEESAQLTDAA---HPEHddsysttytTRYELSCGKSGWR  54
               + ++  V G  A +EA LEE+A+L + +   +P +  +Y   Y  R +       WR
Sbjct  748  LRAEILSDEVGGEIAEIEAVLEEAAELVNESEQKNPSYYSTYKIWYVLRRQ---ADGSWR  804

Query  53   IVEGAV  36
              EG V
Sbjct  805  FCEGEV  810



>ref|XP_003533291.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Glycine max]
 gb|KHM99724.1| Plastid division protein CDP1, chloroplastic [Glycine soja]
Length=812

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M    AE++VR+WQ IK++ALGP H +  L+++LD  ML  W   A    +   +W + L
Sbjct  681  MPVEEAETIVRQWQTIKAEALGPCHEVNCLAQVLDESMLAQWKGLANAAKERSCYWRFLL  740

Query  230  QNLTIDSVTVSVDGR---RAIVEATLEESAQLTDAAHPEH  120
              L+I    +  DG     A +EA LEE+++L D +  ++
Sbjct  741  LKLSIIRADILSDGNGDDMAEIEALLEEASELVDGSQQKN  780



>ref|XP_009392238.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=784

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 5/111 (5%)
 Frame = -1

Query  443  SKVEVSEEVPR--MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAA  270
            S V    +V R  M    AE+LV++WQ+IK++ALGP H+++ L  IL   +L  W + A 
Sbjct  638  SAVAAGTQVHRRQMSIEEAEALVKQWQDIKAEALGPSHQIQLLPNILSESILLKWEELAN  697

Query  269  EIAQHGWFWDYTLQNLTIDSVTVSVDG---RRAIVEATLEESAQLTDAAHP  126
                   FW + L   +I    +  DG     A +EA LEE+A+L D + P
Sbjct  698  SAKARSCFWKFVLLQTSILHAKIVSDGGDDEMAEIEAVLEEAAELVDDSEP  748



>ref|XP_009392236.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392237.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=830

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 5/111 (5%)
 Frame = -1

Query  443  SKVEVSEEVPR--MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAA  270
            S V    +V R  M    AE+LV++WQ+IK++ALGP H+++ L  IL   +L  W + A 
Sbjct  684  SAVAAGTQVHRRQMSIEEAEALVKQWQDIKAEALGPSHQIQLLPNILSESILLKWEELAN  743

Query  269  EIAQHGWFWDYTLQNLTIDSVTVSVDG---RRAIVEATLEESAQLTDAAHP  126
                   FW + L   +I    +  DG     A +EA LEE+A+L D + P
Sbjct  744  SAKARSCFWKFVLLQTSILHAKIVSDGGDDEMAEIEAVLEEAAELVDDSEP  794



>ref|WP_011143470.1| hypothetical protein [Gloeobacter violaceus]
 ref|NP_926427.1| hypothetical protein glr3481 [Gloeobacter violaceus PCC 7421]
 dbj|BAC91422.1| glr3481 [Gloeobacter violaceus PCC 7421]
Length=626

 Score = 66.6 bits (161),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 66/130 (51%), Gaps = 6/130 (5%)
 Frame = -1

Query  416  PRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDY  237
            P  +A+ A ++++ WQ  K QALGP+HR  ++  +L G   +VW  +  +  Q G +W +
Sbjct  500  PPTDAQIA-AMLKNWQTAKQQALGPEHRTAQMQTMLTGSPQRVWQQKVEQSRQAGEYWKF  558

Query  236  TLQNLTIDSVTVSVDGR--RAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGKS  63
            +L++L I+ V    D R  R  V A + E A L          SY   Y  RY L    +
Sbjct  559  SLKDLKIEQV---ADRRPDRVAVTAQVTEVANLYTDNQLRPSRSYDRPYRVRYSLVKAPA  615

Query  62   GWRIVEGAVL  33
            GWRI E  VL
Sbjct  616  GWRIEEMKVL  625



>ref|WP_015147268.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Oscillatoria acuminata]
 gb|AFY80618.1| DnaJ-class molecular chaperone with C-terminal Zn finger domain 
[Oscillatoria acuminata PCC 6304]
Length=763

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 73/143 (51%), Gaps = 5/143 (3%)
 Frame = -1

Query  458  VSIGPSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTD  279
            ++  P+  E+    P  EA  A+ +++KW  IKS ALG  H++E+L EIL    L +W  
Sbjct  624  IATQPTPEELGATGPINEA-IAQGILQKWFTIKSAALGSTHQVEQLPEILMDPALSLWQR  682

Query  278  RAAEIAQHGWFWDYTLQNLTIDSVTVS-VDGRRAIVEATLEESAQLTDAAHPEHddsyst  102
            RA    Q  W+W+Y   N+    V +S  D  RA VEA + E+A+L +    +  ++   
Sbjct  683  RAEAARQENWYWEYD-HNIQETGVEMSPTDPNRATVEAQVSETARLFENG--QLSNTRDD  739

Query  101  tytTRYELSCGKSGWRIVEGAVL  33
                +Y+L      WRI +  +L
Sbjct  740  NLRVQYQLVREGGQWRIRDWVIL  762



>ref|XP_002514511.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47911.1| conserved hypothetical protein [Ricinus communis]
Length=788

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 52/95 (55%), Gaps = 3/95 (3%)
 Frame = -1

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M A  AE LV++WQ +K++ALGP H ++ LSE+LD  ML  W            +W + 
Sbjct  683  QMPAEEAEGLVKQWQALKAEALGPSHHVDSLSEVLDESMLAQWQALGNAAKARPCYWRFV  742

Query  233  LQNLTIDSVTVSVDG---RRAIVEATLEESAQLTD  138
            L  L++    + +D      A +E  LEE+A+L D
Sbjct  743  LLQLSVLQADILLDDYGVEMAEIEVLLEEAAELVD  777



>ref|XP_008811229.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Phoenix dactylifera]
Length=826

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 61/106 (58%), Gaps = 3/106 (3%)
 Frame = -1

Query  446  PSKVEVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAE  267
            P+    +    +M A  AE+LV++WQ+IK++ALGP+++++ L EIL   ML  W D A  
Sbjct  683  PAAAGTTPHREQMAAEEAEALVKQWQDIKAEALGPNYQIQALPEILAETMLSKWQDLAHS  742

Query  266  IAQHGWFWDYTLQNLTI--DSVTVSVDGRR-AIVEATLEESAQLTD  138
                  FW + L +L+I    +   V G   A +EA LEE+A+L D
Sbjct  743  AKARSCFWRFVLLHLSILRAEMVSDVSGSEIAEIEAVLEEAAELVD  788



>ref|XP_009145823.1| PREDICTED: plastid division protein CDP1, chloroplastic [Brassica 
rapa]
Length=807

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LVR+W+NIK++ALGP H++  L E+LD  ML  W   A        +W + L NL I
Sbjct  680  AEELVRQWENIKAEALGPTHQVYSLPEVLDEAMLIQWQTLAQTAKAKSCYWRFVLLNLEI  739

Query  215  DSVTVSVDG  189
                +S DG
Sbjct  740  LQAHISTDG  748



>emb|CDX99260.1| BnaC05g33750D [Brassica napus]
Length=805

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LVR+W+NIK++ALGP H++  L E+LD  ML  W   A        +W + L NL I
Sbjct  678  AEELVRQWENIKAEALGPTHQVYSLPEVLDEAMLVQWQTLAQTAKAKSCYWRFVLLNLEI  737

Query  215  DSVTVSVDG  189
                +S DG
Sbjct  738  LQAHISTDG  746



>emb|CBI35272.3| unnamed protein product [Vitis vinifera]
Length=822

 Score = 64.3 bits (155),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 67/133 (50%), Gaps = 24/133 (18%)
 Frame = -1

Query  611  ITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDD-GSSVTADVVSIGPSKV  435
            IT K+K L+VK+T              K L NR+D   L+     +++++ + ++  S +
Sbjct  646  ITYKLKKLLVKVT--------------KQLRNRSDGGNLQSSGLAANLSSSMAAVDRSPM  691

Query  434  EVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQH  255
             + E         AE LV++WQ  K+QALGP H+++ LSE+LD  ML  W   A      
Sbjct  692  PMQE---------AEMLVKQWQAAKAQALGPSHQIDSLSEVLDDSMLVQWQALADAARLK  742

Query  254  GWFWDYTLQNLTI  216
              FW + L  L++
Sbjct  743  SCFWRFVLLQLSV  755



>ref|XP_002269313.2| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X1 [Vitis vinifera]
Length=824

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 67/133 (50%), Gaps = 24/133 (18%)
 Frame = -1

Query  611  ITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDD-GSSVTADVVSIGPSKV  435
            IT K+K L+VK+T              K L NR+D   L+     +++++ + ++  S +
Sbjct  648  ITYKLKKLLVKVT--------------KQLRNRSDGGNLQSSGLAANLSSSMAAVDRSPM  693

Query  434  EVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQH  255
             + E         AE LV++WQ  K+QALGP H+++ LSE+LD  ML  W   A      
Sbjct  694  PMQE---------AEMLVKQWQAAKAQALGPSHQIDSLSEVLDDSMLVQWQALADAARLK  744

Query  254  GWFWDYTLQNLTI  216
              FW + L  L++
Sbjct  745  SCFWRFVLLQLSV  757



>gb|EPS72583.1| hypothetical protein M569_02168, partial [Genlisea aurea]
Length=782

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 4/130 (3%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M +  AE+LV++WQ  K++ALGP+H +  L ++L+G ML  W   A        FW + L
Sbjct  651  MSSEDAEALVKRWQESKAKALGPEHDIPGLVDVLEGSMLLQWEALADAAKSRSCFWRFVL  710

Query  230  QNLTI-DSVTVSVDGRR-AIVEATLEESAQLTDAAHPEHddsystty--tTRYELSCGKS  63
              L+I  + T   DG   A +EA LEE+A+L    H     + +       RY L     
Sbjct  711  LRLSIVQAETWKEDGGEVAEIEAVLEEAAELVVVDHQNQLTNPTYCSPYRIRYLLKKRDG  770

Query  62   GWRIVEGAVL  33
             WR  +  +L
Sbjct  771  SWRFCQAQIL  780



>ref|XP_010663916.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X2 [Vitis vinifera]
Length=706

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 67/133 (50%), Gaps = 24/133 (18%)
 Frame = -1

Query  611  ITEKIKDLVVKITSAGVAVGLLTLIGLKFLSNRADSSILRKDD-GSSVTADVVSIGPSKV  435
            IT K+K L+VK+T              K L NR+D   L+     +++++ + ++  S +
Sbjct  530  ITYKLKKLLVKVT--------------KQLRNRSDGGNLQSSGLAANLSSSMAAVDRSPM  575

Query  434  EVSEEVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQH  255
             + E         AE LV++WQ  K+QALGP H+++ LSE+LD  ML  W   A      
Sbjct  576  PMQE---------AEMLVKQWQAAKAQALGPSHQIDSLSEVLDDSMLVQWQALADAARLK  626

Query  254  GWFWDYTLQNLTI  216
              FW + L  L++
Sbjct  627  SCFWRFVLLQLSV  639



>ref|XP_006296994.1| hypothetical protein CARUB_v10012988mg [Capsella rubella]
 gb|EOA29892.1| hypothetical protein CARUB_v10012988mg [Capsella rubella]
Length=821

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LVR+W+NIK++ALGP H++  LSE+LDG ML  W   A        +W + L +L I
Sbjct  695  AEELVRQWENIKAEALGPTHQVYSLSEVLDGSMLVQWQTLAETAKAKSCYWRFVLLHLEI  754

Query  215  DSVTVSVDG  189
                +  DG
Sbjct  755  LRAHIFEDG  763



>ref|XP_010940348.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=833

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 10/102 (10%)
 Frame = -1

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKV-------WTDRAAEIAQH  255
            +M    AE+LV++WQ+IK++ALGP+++++ LSEIL   ML         W D A      
Sbjct  694  QMAVEEAEALVKQWQDIKAEALGPNYQIQALSEILAETMLSKFSFFGGQWQDLAHSAKAR  753

Query  254  GWFWDYTLQNLTIDSVTVSVD---GRRAIVEATLEESAQLTD  138
              FW + L +L+I    +  D      A +EA LEE+A+L D
Sbjct  754  SCFWRFVLLDLSILRAEIVSDESGSEIAEIEAVLEEAAELVD  795



>gb|KHG12616.1| Plastid division CDP1, chloroplastic -like protein [Gossypium 
arboreum]
Length=868

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 69/136 (51%), Gaps = 12/136 (9%)
 Frame = -1

Query  581  KITSAGVAVG---LLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPR  411
            +I + G+ V    LL L  ++F+    + S  R    S + A   S+  S  EV  +  +
Sbjct  647  RIKAVGIGVKIKKLLDLAKVQFM----NPSEARNSRTSCLPA---SLSTSITEV--DTKQ  697

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M    AE+LVR+WQ IK++ALGP+H+++ LSE LD  ML  W   A        +W + L
Sbjct  698  MSVEEAEALVRQWQAIKAEALGPNHQVDTLSEALDESMLIQWQALADMAKTRCCYWRFVL  757

Query  230  QNLTIDSVTVSVDGRR  183
              LTI    V +D  R
Sbjct  758  LQLTILRADVLLDIHR  773



>ref|WP_015172812.1| heat shock protein DnaJ domain-containing protein [Geitlerinema 
sp. PCC 7407]
 gb|AFY67248.1| heat shock protein DnaJ domain protein [Geitlerinema sp. PCC 
7407]
Length=754

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 69/140 (49%), Gaps = 3/140 (2%)
 Frame = -1

Query  446  PSKVEVSEEVPR-MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAA  270
            P +++ + E P  + A  A++++  W   KS ALG +H  ++L++IL    L  W  RA 
Sbjct  615  PPELQAASESPADLNADMAKAVINAWLAAKSSALGEEHSRDRLAQILVNPALAEWEQRAI  674

Query  269  EIAQHGWFWDYTLQNLTIDSVTVSV-DGRRAIVEATLEESAQLTDAAHPEHddsysttyt  93
               + GW W Y    L+++SV VS  D  +A VEA + E A   +        SY     
Sbjct  675  AAERDGWHWKYQ-HELSVESVQVSPNDSNQASVEAQVREKADFYEQGTLNAASSYDDNLR  733

Query  92   TRYELSCGKSGWRIVEGAVL  33
             RY+L   +  WRI +  VL
Sbjct  734  VRYDLVRQEGEWRIQDMVVL  753



>ref|XP_005851700.1| hypothetical protein CHLNCDRAFT_132987 [Chlorella variabilis]
 gb|EFN59598.1| hypothetical protein CHLNCDRAFT_132987 [Chlorella variabilis]
Length=776

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 62/132 (47%), Gaps = 9/132 (7%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            A  LV++W ++K++A+GP H + +L+++LD  ML      AA+ A  GW+W+       +
Sbjct  645  AAKLVKEWLSVKAEAMGPRHTVARLAQVLDEPMLSAVLSEAADAAASGWYWNIRPHKSKV  704

Query  215  DSVTVSV-----DGRRAIVEATLEESAQLTDA----AHPEHddsysttytTRYELSCGKS  63
            DS+  S       G    V ATL+ESA+L  A             +      Y L     
Sbjct  705  DSLDASSFSAADGGGHVSVLATLDESAELWGADGEQGESYKTTYQAGGVVVEYTLVYSGG  764

Query  62   GWRIVEGAVLKS  27
            GW+I    VL S
Sbjct  765  GWKIASALVLSS  776



>ref|XP_010546464.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=828

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LVR+W+N+K++ALGP+H+++ LSE+LD  ML  W   A        +W + L  L I
Sbjct  698  AEDLVRQWENVKAEALGPNHQIDSLSEVLDESMLVQWQTLAQTAKARSCYWRFVLLQLKI  757

Query  215  DSVTVSVDG  189
                V  +G
Sbjct  758  LQAHVLPNG  766



>ref|XP_010546465.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=797

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LVR+W+N+K++ALGP+H+++ LSE+LD  ML  W   A        +W + L  L I
Sbjct  667  AEDLVRQWENVKAEALGPNHQIDSLSEVLDESMLVQWQTLAQTAKARSCYWRFVLLQLKI  726

Query  215  DSVTVSVDG  189
                V  +G
Sbjct  727  LQAHVLPNG  735



>gb|KJB46137.1| hypothetical protein B456_007G350000 [Gossypium raimondii]
 gb|KJB46138.1| hypothetical protein B456_007G350000 [Gossypium raimondii]
 gb|KJB46139.1| hypothetical protein B456_007G350000 [Gossypium raimondii]
Length=829

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -1

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M    AE+LVR+WQ IK++ALGP+H+++ LSE LD  ML  W   A        +W + 
Sbjct  697  QMSVEEAEALVRQWQAIKAEALGPNHQVDTLSEALDESMLIQWQALADMAKARCCYWRFV  756

Query  233  LQNLTIDSVTVSVDGRR  183
            L  LTI    + +D  R
Sbjct  757  LLQLTILRADILLDIHR  773



>gb|AFK45889.1| unknown [Lotus japonicus]
Length=181

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 63/121 (52%), Gaps = 9/121 (7%)
 Frame = -1

Query  551  LLTLIGLKFLSNRADSSILRKDDGSSVTADVVSIGPSKVEVSEEVPRMEARFAESLVRKW  372
            +L+ + + FL +R+D+   R D  ++ ++   SI   + +       M    AE+L+R+W
Sbjct  13   ILSRVKIHFL-HRSDAG-FRSDLHTAHSSSSFSIKVYRRQ-------MPVEEAETLIRQW  63

Query  371  QNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSVTVSVD  192
            Q IK++ALGP H +  L+E+LD  ML  W   A    +    W + L  L++  V +  D
Sbjct  64   QEIKAEALGPSHEVNSLAEVLDEPMLAQWQALADAAKEKSCHWRFLLLKLSVLRVDILSD  123

Query  191  G  189
            G
Sbjct  124  G  124



>gb|AAL66980.1| unknown protein [Arabidopsis thaliana]
Length=819

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+   AE LVR+W+N+K++ALGP H++  LSE+LD  ML  W   A        +W + L
Sbjct  688  MDTEEAEELVRQWENVKAEALGPTHQVYSLSEVLDESMLVQWQTLAQTAEAKSCYWRFVL  747

Query  230  QNLTIDSVTVSVDG  189
             +L +    +  DG
Sbjct  748  LHLEVLQAHIFEDG  761



>ref|NP_188549.2| plastid division protein CDP1 [Arabidopsis thaliana]
 sp|Q8VY16.2|CDP1_ARATH RecName: Full=Plastid division protein CDP1, chloroplastic; AltName: 
Full=ARC6-homolog protein; AltName: Full=Protein CHLOROPLAST 
DIVISION SITE POSITIONING 1; Short=AtCDP1; AltName: 
Full=Protein PARALOG OF ARC6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76203.1| plastid division protein CDP1 [Arabidopsis thaliana]
Length=819

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -1

Query  410  MEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTL  231
            M+   AE LVR+W+N+K++ALGP H++  LSE+LD  ML  W   A        +W + L
Sbjct  688  MDTEEAEELVRQWENVKAEALGPTHQVYSLSEVLDESMLVQWQTLAQTAEAKSCYWRFVL  747

Query  230  QNLTIDSVTVSVDG  189
             +L +    +  DG
Sbjct  748  LHLEVLQAHIFEDG  761



>gb|AGY57578.1| DNA polymerase III subunits gamma and tau [Gloeobacter kilaueensis 
JS1]
Length=625

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -1

Query  386  LVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTIDSV  207
            +++ WQ  K QALGP+H+  ++  +L G   ++W DRA +  Q G  W Y L+ L ID V
Sbjct  508  ILQDWQQAKQQALGPEHQTARMQALLTGNTQQIWRDRAEQTRQAGEHWKYRLKQLKIDEV  567



>ref|XP_007152546.1| hypothetical protein PHAVU_004G139200g [Phaseolus vulgaris]
 gb|ESW24540.1| hypothetical protein PHAVU_004G139200g [Phaseolus vulgaris]
Length=811

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE++VR+WQ IK++ALGP H +  L+++LD  ML  W   A    +   +W + L  L+I
Sbjct  685  AETIVRQWQTIKAEALGPSHEVNCLAKVLDESMLAQWKGLANAAKERSCYWRFLLLKLSI  744

Query  215  DSVTVSVDGRRA  180
                +  DG  A
Sbjct  745  VRADILSDGNGA  756



>ref|WP_016873793.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=781

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 67/132 (51%), Gaps = 3/132 (2%)
 Frame = -1

Query  422  EVPRMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFW  243
            E P  EA  AE +++ W + K+ ALGP+H ++ L EIL G  L  W   A +      + 
Sbjct  646  EGPLTEATAAE-VIQTWLSTKAAALGPNHEIDSLKEILVGSALSQWLQVAQKEQAENRYR  704

Query  242  DYTLQNLTIDSVTVS-VDGRRAIVEATLEESAQLTDAAHPEHddsysttytTRYELSCGK  66
             Y    L ++S+  S +D   A V+A++ E+AQ  +        SY+ T   RY L    
Sbjct  705  KYE-HRLKVESLETSPIDKNYAAVQASVTEAAQFYENGQINQRKSYNETVRVRYSLIRQA  763

Query  65   SGWRIVEGAVLK  30
            +GWRI E +V+ 
Sbjct  764  NGWRIREMSVIN  775



>ref|XP_006406529.1| hypothetical protein EUTSA_v10020089mg [Eutrema salsugineum]
 gb|ESQ47982.1| hypothetical protein EUTSA_v10020089mg [Eutrema salsugineum]
Length=806

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LVR+W+NIK++ALGP H++  L E+LD  ML  W   A        +W + L +L I
Sbjct  680  AEELVRQWENIKAEALGPTHQVYSLPEVLDESMLVQWRTLAQTAKAKSCYWRFVLLHLEI  739

Query  215  DSVTVSVDG  189
                +  DG
Sbjct  740  LQAHIFPDG  748



>ref|XP_007029351.1| ARC6-like protein isoform 2, partial [Theobroma cacao]
 gb|EOY09853.1| ARC6-like protein isoform 2, partial [Theobroma cacao]
Length=573

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -1

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M    AE+LVR+WQ IK++ALGP H++  LSE LD  ML  W   A        +W + 
Sbjct  492  QMSVEEAEALVRQWQAIKAEALGPSHQVNSLSEALDESMLIQWKALADMARARCCYWRFV  551

Query  233  LQNLTIDSVTVSVD  192
            L  LTI    + +D
Sbjct  552  LLQLTILRADILLD  565



>ref|XP_007029350.1| ARC6-like protein isoform 1 [Theobroma cacao]
 gb|EOY09852.1| ARC6-like protein isoform 1 [Theobroma cacao]
Length=829

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -1

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M    AE+LVR+WQ IK++ALGP H++  LSE LD  ML  W   A        +W + 
Sbjct  697  QMSVEEAEALVRQWQAIKAEALGPSHQVNSLSEALDESMLIQWKALADMARARCCYWRFV  756

Query  233  LQNLTIDSVTVSVD  192
            L  LTI    + +D
Sbjct  757  LLQLTILRADILLD  770



>ref|XP_010466049.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010466050.1| PREDICTED: plastid division protein CDP1, chloroplastic isoform 
X2 [Camelina sativa]
Length=823

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LVR+W+NIK++ALGP H++  LSE+LD  ML  W   A        +W + L +L I
Sbjct  697  AEELVRQWENIKAEALGPTHQIYSLSEVLDESMLVQWQTLAETAKAKSSYWRFVLLHLEI  756

Query  215  DSVTVSVDG  189
                   DG
Sbjct  757  LQAHTFEDG  765



>ref|XP_006406528.1| hypothetical protein EUTSA_v10020089mg [Eutrema salsugineum]
 gb|ESQ47981.1| hypothetical protein EUTSA_v10020089mg [Eutrema salsugineum]
Length=716

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LVR+W+NIK++ALGP H++  L E+LD  ML  W   A        +W + L +L I
Sbjct  590  AEELVRQWENIKAEALGPTHQVYSLPEVLDESMLVQWRTLAQTAKAKSCYWRFVLLHLEI  649

Query  215  DSVTVSVDG  189
                +  DG
Sbjct  650  LQAHIFPDG  658



>ref|XP_010487843.1| PREDICTED: plastid division protein CDP1, chloroplastic-like 
[Camelina sativa]
Length=826

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = -1

Query  395  AESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYTLQNLTI  216
            AE LVR+W+NIK++ALGP H++  LS++LD  ML  W   A        +W + L +L I
Sbjct  700  AEELVRQWENIKAEALGPTHQIYSLSDVLDESMLVQWQTLAETAKAKSCYWRFVLLHLEI  759

Query  215  DSVTVSVDG  189
                +  DG
Sbjct  760  LQAHMFEDG  768



>ref|XP_002318349.1| cell division family protein [Populus trichocarpa]
 gb|EEE96569.1| cell division family protein [Populus trichocarpa]
Length=886

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -1

Query  413  RMEARFAESLVRKWQNIKSQALGPDHRLEKLSEILDGQMLKVWTDRAAEIAQHGWFWDYT  234
            +M    AE+LV+ WQ IK++ALGP H++  LSE+LD  ML  W   A        +W + 
Sbjct  747  QMPVEEAEALVKHWQAIKAEALGPGHQVHSLSEVLDESMLAQWQALADAAKAQSSYWRFV  806

Query  233  LQNLTIDSVTVSVDG  189
            L  L+I    +  DG
Sbjct  807  LLQLSILQAHIFSDG  821



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2104487967200