BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038D20

Length=911
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614692.1|  PREDICTED: uncharacterized protein LOC104107561    358   6e-118   Nicotiana tomentosiformis
ref|XP_006363989.1|  PREDICTED: uncharacterized protein LOC102601007    355   4e-117   Solanum tuberosum [potatoes]
ref|XP_009780705.1|  PREDICTED: uncharacterized protein LOC104229716    354   2e-116   Nicotiana sylvestris
ref|XP_004235367.1|  PREDICTED: uncharacterized protein LOC101248757    348   2e-114   Solanum lycopersicum
ref|XP_010091765.1|  hypothetical protein L484_019353                   348   7e-114   Morus notabilis
ref|XP_009355996.1|  PREDICTED: uncharacterized protein LOC103946...    339   2e-110   Pyrus x bretschneideri [bai li]
ref|XP_009355995.1|  PREDICTED: uncharacterized protein LOC103946...    339   2e-110   Pyrus x bretschneideri [bai li]
ref|XP_008375017.1|  PREDICTED: uncharacterized protein LOC103438...    339   2e-110   
ref|XP_008375019.1|  PREDICTED: uncharacterized protein LOC103438...    339   2e-110   
ref|XP_008356700.1|  PREDICTED: uncharacterized protein LOC103420...    338   3e-110   
ref|XP_008356699.1|  PREDICTED: uncharacterized protein LOC103420...    338   3e-110   
ref|XP_011073153.1|  PREDICTED: uncharacterized protein LOC105158192    337   8e-110   Sesamum indicum [beniseed]
gb|EYU21849.1|  hypothetical protein MIMGU_mgv1a007186mg                335   4e-109   Erythranthe guttata [common monkey flower]
emb|CDO98647.1|  unnamed protein product                                335   6e-109   Coffea canephora [robusta coffee]
ref|XP_007036962.1|  Uncharacterized protein isoform 2                  335   8e-109   
gb|KHG11329.1|  Alanine--tRNA ligase                                    332   9e-108   Gossypium arboreum [tree cotton]
ref|XP_006493269.1|  PREDICTED: uncharacterized protein LOC102611...    329   8e-107   Citrus sinensis [apfelsine]
emb|CBI35458.3|  unnamed protein product                                328   3e-106   Vitis vinifera
ref|XP_011047792.1|  PREDICTED: uncharacterized protein LOC105142042    328   3e-106   Populus euphratica
ref|XP_010069444.1|  PREDICTED: uncharacterized protein LOC104456368    328   4e-106   Eucalyptus grandis [rose gum]
ref|XP_006441318.1|  hypothetical protein CICLE_v10020337mg             327   4e-106   Citrus clementina [clementine]
ref|XP_008393456.1|  PREDICTED: uncharacterized protein LOC103455...    327   7e-106   
ref|XP_008393457.1|  PREDICTED: uncharacterized protein LOC103455...    327   8e-106   
ref|XP_009360039.1|  PREDICTED: uncharacterized protein LOC103950...    327   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_009360040.1|  PREDICTED: uncharacterized protein LOC103950...    327   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_008466989.1|  PREDICTED: uncharacterized protein LOC103504355    326   1e-105   Cucumis melo [Oriental melon]
gb|KDO47166.1|  hypothetical protein CISIN_1g014467mg                   326   1e-105   Citrus sinensis [apfelsine]
ref|XP_006374245.1|  hypothetical protein POPTR_0015s05360g             323   2e-105   
gb|AAK30572.1|AF346660_1  unknown                                       320   2e-105   Brassica napus [oilseed rape]
gb|KJB53076.1|  hypothetical protein B456_008G292100                    325   3e-105   Gossypium raimondii
ref|XP_006374246.1|  hypothetical protein POPTR_0015s05360g             324   8e-105   
ref|XP_002267281.3|  PREDICTED: uncharacterized protein LOC100262899    324   1e-104   Vitis vinifera
ref|XP_010241168.1|  PREDICTED: uncharacterized protein LOC104585831    323   2e-104   Nelumbo nucifera [Indian lotus]
gb|KDP30111.1|  hypothetical protein JCGZ_18399                         323   2e-104   Jatropha curcas
gb|KHG07714.1|  Ribosomal L11 methyltransferase                         319   5e-104   Gossypium arboreum [tree cotton]
ref|XP_007036961.1|  Uncharacterized protein isoform 1                  323   6e-104   
ref|XP_002885230.1|  predicted protein                                  322   7e-104   
gb|AAL32564.1|  Unknown protein                                         322   8e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566588.1|  uncharacterized protein                               322   8e-104   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01343.1|  hypothetical protein                                   322   8e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137518.1|  PREDICTED: uncharacterized protein LOC101203627    321   1e-103   Cucumis sativus [cucumbers]
ref|NP_001078173.1|  uncharacterized protein                            321   1e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CDX95820.1|  BnaC05g35710D                                          320   2e-103   
emb|CDX92162.1|  BnaA05g22450D                                          320   3e-103   
ref|XP_010465837.1|  PREDICTED: uncharacterized protein LOC104746127    320   4e-103   Camelina sativa [gold-of-pleasure]
ref|XP_006297794.1|  hypothetical protein CARUB_v10013829mg             318   1e-102   Capsella rubella
ref|XP_002317709.1|  hypothetical protein POPTR_0012s03930g             317   2e-102   Populus trichocarpa [western balsam poplar]
ref|XP_009145975.1|  PREDICTED: uncharacterized protein LOC103869650    318   2e-102   Brassica rapa
ref|NP_175278.1|  uncharacterized protein                               318   2e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009408547.1|  PREDICTED: uncharacterized protein LOC103990...    316   9e-102   
emb|CAL07981.1|  hypothetical protein                                   311   1e-101   Platanus x hispanica [London plane tree]
gb|KGN64195.1|  hypothetical protein Csa_1G042990                       322   1e-101   Cucumis sativus [cucumbers]
ref|XP_009408539.1|  PREDICTED: uncharacterized protein LOC103990...    315   2e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002894114.1|  hypothetical protein ARALYDRAFT_473985             316   2e-101   
emb|CDX75937.1|  BnaC03g40200D                                          315   2e-101   
ref|XP_010461662.1|  PREDICTED: uncharacterized protein LOC104742...    316   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010500371.1|  PREDICTED: uncharacterized protein LOC104777762    315   2e-101   Camelina sativa [gold-of-pleasure]
dbj|BAJ34170.1|  unnamed protein product                                315   2e-101   Eutrema halophilum
ref|XP_002533448.1|  conserved hypothetical protein                     314   3e-101   
ref|XP_011003767.1|  PREDICTED: uncharacterized protein LOC105110429    314   4e-101   Populus euphratica
gb|KFK39108.1|  hypothetical protein AALP_AA3G202000                    315   5e-101   Arabis alpina [alpine rockcress]
ref|XP_010479269.1|  PREDICTED: uncharacterized protein LOC104758146    315   5e-101   Camelina sativa [gold-of-pleasure]
ref|XP_011464472.1|  PREDICTED: uncharacterized protein LOC101299...    314   6e-101   Fragaria vesca subsp. vesca
ref|XP_004299503.1|  PREDICTED: uncharacterized protein LOC101299...    314   6e-101   Fragaria vesca subsp. vesca
ref|XP_006406690.1|  hypothetical protein EUTSA_v10020677mg             316   6e-101   
ref|XP_009414790.1|  PREDICTED: uncharacterized protein LOC103995...    313   1e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414789.1|  PREDICTED: uncharacterized protein LOC103995...    313   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006306266.1|  hypothetical protein CARUB_v10012116mg             313   2e-100   Capsella rubella
gb|KJB30250.1|  hypothetical protein B456_005G134400                    313   3e-100   Gossypium raimondii
ref|XP_006374243.1|  hypothetical protein POPTR_0015s05360g             313   3e-100   
ref|XP_008798412.1|  PREDICTED: uncharacterized protein LOC103713309    312   3e-100   Phoenix dactylifera
ref|XP_008240405.1|  PREDICTED: uncharacterized protein LOC103338912    312   4e-100   Prunus mume [ume]
ref|XP_007209930.1|  hypothetical protein PRUPE_ppa004570mg             314   6e-100   
ref|XP_010271178.1|  PREDICTED: uncharacterized protein LOC104607271    311   7e-100   Nelumbo nucifera [Indian lotus]
ref|XP_006393405.1|  hypothetical protein EUTSA_v10011507mg             311   1e-99    Eutrema salsugineum [saltwater cress]
ref|XP_010936872.1|  PREDICTED: uncharacterized protein LOC105056391    310   2e-99    Elaeis guineensis
ref|XP_010487675.1|  PREDICTED: uncharacterized protein LOC104765624    310   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010549033.1|  PREDICTED: uncharacterized protein LOC104820...    310   2e-99    Tarenaya hassleriana [spider flower]
ref|XP_010549034.1|  PREDICTED: uncharacterized protein LOC104820...    310   3e-99    Tarenaya hassleriana [spider flower]
emb|CDX82345.1|  BnaA03g34760D                                          308   9e-99    
emb|CDY58279.1|  BnaCnng32840D                                          308   2e-98    Brassica napus [oilseed rape]
gb|AFK42768.1|  unknown                                                 307   3e-98    Lotus japonicus
ref|XP_009135549.1|  PREDICTED: uncharacterized protein LOC103859727    307   3e-98    Brassica rapa
ref|XP_010505920.1|  PREDICTED: uncharacterized protein LOC104782624    306   5e-98    Camelina sativa [gold-of-pleasure]
ref|XP_004981974.1|  PREDICTED: uncharacterized protein LOC101781...    304   4e-97    Setaria italica
ref|XP_004981973.1|  PREDICTED: uncharacterized protein LOC101781...    304   5e-97    Setaria italica
ref|XP_009145005.1|  PREDICTED: uncharacterized protein LOC103868678    302   2e-96    Brassica rapa
gb|KFK36092.1|  hypothetical protein AALP_AA4G076400                    301   1e-95    Arabis alpina [alpine rockcress]
gb|AGV54799.1|  hypothetical protein                                    299   4e-95    Phaseolus vulgaris [French bean]
ref|XP_003530975.1|  PREDICTED: uncharacterized protein LOC100793300    298   1e-94    Glycine max [soybeans]
gb|ACF87802.1|  unknown                                                 298   1e-94    Zea mays [maize]
ref|NP_001143815.1|  uncharacterized protein LOC100276591               298   2e-94    Zea mays [maize]
ref|XP_010687245.1|  PREDICTED: uncharacterized protein LOC104901374    297   3e-94    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ85118.1|  predicted protein                                      296   8e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004503251.1|  PREDICTED: uncharacterized protein LOC101489103    295   1e-93    Cicer arietinum [garbanzo]
ref|XP_006580389.1|  PREDICTED: uncharacterized protein LOC100817...    295   2e-93    Glycine max [soybeans]
gb|KHN43658.1|  hypothetical protein glysoja_027724                     293   2e-93    Glycine soja [wild soybean]
ref|XP_003525180.1|  PREDICTED: uncharacterized protein LOC100817...    294   2e-93    Glycine max [soybeans]
gb|ABF98565.1|  expressed protein                                       292   2e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003528983.1|  PREDICTED: uncharacterized protein LOC100777...    294   2e-93    Glycine max [soybeans]
gb|ACU24516.1|  unknown                                                 294   2e-93    Glycine max [soybeans]
gb|AFK36208.1|  unknown                                                 294   4e-93    Medicago truncatula
gb|ACJ84884.1|  unknown                                                 294   5e-93    Medicago truncatula
gb|EPS73872.1|  hypothetical protein M569_00881                         293   6e-93    Genlisea aurea
ref|XP_003534126.1|  PREDICTED: uncharacterized protein LOC100802...    292   2e-92    Glycine max [soybeans]
gb|EAY91660.1|  hypothetical protein OsI_13299                          291   3e-92    Oryza sativa Indica Group [Indian rice]
gb|KEH26747.1|  plant/T1N15-5 protein                                   291   8e-92    Medicago truncatula
ref|XP_003560595.1|  PREDICTED: uncharacterized protein LOC100829350    290   1e-91    Brachypodium distachyon [annual false brome]
ref|XP_006650499.1|  PREDICTED: uncharacterized protein LOC102715191    287   2e-91    
ref|NP_001051084.1|  Os03g0717900                                       291   2e-91    
ref|XP_004513343.1|  PREDICTED: uncharacterized protein LOC101494...    289   5e-91    
ref|NP_001169730.1|  hypothetical protein                               287   2e-90    Zea mays [maize]
ref|XP_006849427.1|  hypothetical protein AMTR_s00024p00021530          287   5e-90    
ref|XP_007160560.1|  hypothetical protein PHAVU_002G331900g             284   2e-89    Phaseolus vulgaris [French bean]
tpg|DAA51043.1|  TPA: hypothetical protein ZEAMMB73_539342              273   5e-88    
gb|EMT10781.1|  hypothetical protein F775_30852                         283   9e-88    
ref|XP_007152648.1|  hypothetical protein PHAVU_004G147200g             270   7e-84    Phaseolus vulgaris [French bean]
gb|EYU24493.1|  hypothetical protein MIMGU_mgv1a007418mg                269   1e-83    Erythranthe guttata [common monkey flower]
gb|ABR17692.1|  unknown                                                 267   2e-82    Picea sitchensis
gb|AFK35334.1|  unknown                                                 259   3e-82    Lotus japonicus
ref|XP_010939981.1|  PREDICTED: uncharacterized protein LOC105058679    265   1e-81    
ref|XP_010661178.1|  PREDICTED: uncharacterized protein LOC100245...    259   5e-80    
emb|CAN79123.1|  hypothetical protein VITISV_030635                     258   2e-79    Vitis vinifera
ref|XP_002273280.1|  PREDICTED: uncharacterized protein LOC100245...    258   2e-79    Vitis vinifera
gb|ADE77481.1|  unknown                                                 254   1e-77    Picea sitchensis
ref|XP_002304357.2|  hypothetical protein POPTR_0003s09600g             233   2e-71    
ref|XP_010461665.1|  PREDICTED: uncharacterized protein LOC104742360    230   2e-71    Camelina sativa [gold-of-pleasure]
ref|XP_011028101.1|  PREDICTED: uncharacterized protein LOC105128231    233   2e-69    Populus euphratica
gb|KDP30713.1|  hypothetical protein JCGZ_15541                         232   4e-69    Jatropha curcas
ref|XP_010261560.1|  PREDICTED: uncharacterized protein LOC104600354    232   4e-69    Nelumbo nucifera [Indian lotus]
ref|XP_008466020.1|  PREDICTED: uncharacterized protein LOC103503...    229   7e-69    
emb|CAN68920.1|  hypothetical protein VITISV_039448                     226   4e-68    Vitis vinifera
ref|XP_006471483.1|  PREDICTED: uncharacterized protein LOC102623998    228   9e-68    Citrus sinensis [apfelsine]
ref|XP_008466019.1|  PREDICTED: uncharacterized protein LOC103503...    228   1e-67    Cucumis melo [Oriental melon]
ref|XP_004136206.1|  PREDICTED: uncharacterized protein LOC101213975    227   3e-67    Cucumis sativus [cucumbers]
ref|XP_010919980.1|  PREDICTED: uncharacterized protein LOC105043949    226   9e-67    
ref|XP_002276652.1|  PREDICTED: uncharacterized protein LOC100260823    225   1e-66    Vitis vinifera
ref|XP_009373461.1|  PREDICTED: uncharacterized protein LOC103962488    224   2e-66    Pyrus x bretschneideri [bai li]
gb|KJB21160.1|  hypothetical protein B456_003G185600                    224   3e-66    Gossypium raimondii
ref|XP_011081424.1|  PREDICTED: uncharacterized protein LOC105164476    224   3e-66    Sesamum indicum [beniseed]
ref|XP_007040722.1|  Uncharacterized protein TCM_016604                 223   7e-66    
ref|XP_008373529.1|  PREDICTED: uncharacterized protein LOC103436859    223   9e-66    
ref|XP_008238169.1|  PREDICTED: uncharacterized protein LOC103336834    223   1e-65    Prunus mume [ume]
ref|XP_010055250.1|  PREDICTED: uncharacterized protein LOC104443499    222   2e-65    
gb|KHG08376.1|  Beta-casein                                             222   2e-65    Gossypium arboreum [tree cotton]
ref|XP_004300191.1|  PREDICTED: uncharacterized protein LOC101292798    222   2e-65    Fragaria vesca subsp. vesca
ref|XP_008800079.1|  PREDICTED: uncharacterized protein LOC103714...    221   4e-65    Phoenix dactylifera
gb|KCW71713.1|  hypothetical protein EUGRSUZ_E00224                     223   4e-65    Eucalyptus grandis [rose gum]
ref|XP_002518989.1|  conserved hypothetical protein                     221   5e-65    Ricinus communis
ref|XP_008800078.1|  PREDICTED: uncharacterized protein LOC103714...    220   6e-65    
ref|XP_008800077.1|  PREDICTED: uncharacterized protein LOC103714...    220   2e-64    Phoenix dactylifera
ref|XP_009145204.1|  PREDICTED: uncharacterized protein LOC103868901    218   1e-63    Brassica rapa
emb|CDP11681.1|  unnamed protein product                                217   1e-63    Coffea canephora [robusta coffee]
ref|XP_003534296.1|  PREDICTED: uncharacterized protein LOC100802337    217   2e-63    Glycine max [soybeans]
emb|CDY35549.1|  BnaA05g16370D                                          216   3e-63    Brassica napus [oilseed rape]
emb|CDY29940.1|  BnaC05g28960D                                          216   4e-63    Brassica napus [oilseed rape]
ref|XP_006415245.1|  hypothetical protein EUTSA_v10007794mg             216   6e-63    Eutrema salsugineum [saltwater cress]
gb|KFK44959.1|  hypothetical protein AALP_AA1G325800                    214   3e-62    Arabis alpina [alpine rockcress]
ref|XP_009413223.1|  PREDICTED: uncharacterized protein LOC103994...    213   5e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413222.1|  PREDICTED: uncharacterized protein LOC103994...    213   5e-62    
gb|KHN40428.1|  hypothetical protein glysoja_000926                     213   1e-61    Glycine soja [wild soybean]
ref|XP_009804854.1|  PREDICTED: uncharacterized protein LOC104250017    212   2e-61    Nicotiana sylvestris
gb|ACN34329.1|  unknown                                                 206   2e-61    Zea mays [maize]
ref|XP_004245960.1|  PREDICTED: uncharacterized protein LOC101262445    210   6e-61    
gb|EYU43718.1|  hypothetical protein MIMGU_mgv1a007450mg                210   7e-61    Erythranthe guttata [common monkey flower]
gb|EMS68345.1|  hypothetical protein TRIUR3_07699                       210   8e-61    Triticum urartu
ref|XP_006352932.1|  PREDICTED: uncharacterized protein LOC102595128    210   8e-61    Solanum tuberosum [potatoes]
ref|XP_007158234.1|  hypothetical protein PHAVU_002G135300g             210   1e-60    Phaseolus vulgaris [French bean]
ref|XP_010540738.1|  PREDICTED: uncharacterized protein LOC104814412    209   1e-60    Tarenaya hassleriana [spider flower]
dbj|BAJ87444.1|  predicted protein                                      209   2e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001053731.1|  Os04g0595100                                       209   2e-60    
ref|XP_004976664.1|  PREDICTED: uncharacterized protein LOC101761297    209   2e-60    Setaria italica
ref|NP_001242537.1|  uncharacterized protein LOC100810147               209   3e-60    
ref|XP_002448446.1|  hypothetical protein SORBIDRAFT_06g027240          209   3e-60    Sorghum bicolor [broomcorn]
gb|EEC77902.1|  hypothetical protein OsI_17223                          209   3e-60    Oryza sativa Indica Group [Indian rice]
ref|XP_009607216.1|  PREDICTED: uncharacterized protein LOC104101473    208   4e-60    Nicotiana tomentosiformis
gb|EMT04061.1|  hypothetical protein F775_32804                         207   5e-60    
ref|XP_010677383.1|  PREDICTED: uncharacterized protein LOC104893042    207   1e-59    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006653725.1|  PREDICTED: uncharacterized protein LOC102702753    207   1e-59    Oryza brachyantha
ref|NP_001145533.1|  uncharacterized protein LOC100278968               206   2e-59    Zea mays [maize]
gb|AFW59314.1|  hypothetical protein ZEAMMB73_007794                    206   2e-59    
ref|XP_004253444.1|  PREDICTED: uncharacterized protein LOC101265814    202   3e-59    Solanum lycopersicum
ref|XP_010461033.1|  PREDICTED: uncharacterized protein LOC104741810    205   5e-59    Camelina sativa [gold-of-pleasure]
ref|XP_006854071.1|  hypothetical protein AMTR_s00048p00111750          205   5e-59    Amborella trichopoda
ref|XP_010499760.1|  PREDICTED: uncharacterized protein LOC104777247    205   6e-59    Camelina sativa [gold-of-pleasure]
ref|XP_002890970.1|  hypothetical protein ARALYDRAFT_473397             205   6e-59    Arabidopsis lyrata subsp. lyrata
ref|XP_004512464.1|  PREDICTED: uncharacterized protein LOC101507671    205   7e-59    Cicer arietinum [garbanzo]
gb|EPS63452.1|  hypothetical protein M569_11331                         203   7e-59    Genlisea aurea
ref|XP_003612708.1|  hypothetical protein MTR_5g028020                  205   8e-59    Medicago truncatula
ref|XP_010478637.1|  PREDICTED: uncharacterized protein LOC104757587    204   2e-58    Camelina sativa [gold-of-pleasure]
ref|XP_006307539.1|  hypothetical protein CARUB_v10009166mg             203   1e-57    
ref|NP_564389.1|  uncharacterized protein                               201   3e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002981973.1|  hypothetical protein SELMODRAFT_233832             198   5e-57    
ref|XP_010240349.1|  PREDICTED: uncharacterized protein LOC104585415    199   2e-56    Brachypodium distachyon [annual false brome]
ref|XP_002982952.1|  hypothetical protein SELMODRAFT_234120             196   3e-56    
ref|XP_007036963.1|  Uncharacterized protein isoform 3                  193   7e-56    
emb|CBI33818.3|  unnamed protein product                                192   7e-54    Vitis vinifera
gb|ABR16101.1|  unknown                                                 190   5e-53    Picea sitchensis
gb|KDO57188.1|  hypothetical protein CISIN_1g036217mg                   179   2e-51    Citrus sinensis [apfelsine]
ref|XP_011018702.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    179   1e-50    Populus euphratica
ref|XP_002977160.1|  hypothetical protein SELMODRAFT_106276             176   2e-48    
ref|XP_002965311.1|  hypothetical protein SELMODRAFT_82738              174   5e-48    
emb|CAN66177.1|  hypothetical protein VITISV_005141                     163   2e-46    Vitis vinifera
dbj|BAD94862.1|  hypothetical protein                                   155   2e-43    Arabidopsis thaliana [mouse-ear cress]
gb|AFK47814.1|  unknown                                                 154   4e-43    Lotus japonicus
ref|XP_006437251.1|  hypothetical protein CICLE_v10031774mg             160   5e-43    
gb|KDO46606.1|  hypothetical protein CISIN_1g015579mg                   159   8e-43    Citrus sinensis [apfelsine]
gb|KDO46604.1|  hypothetical protein CISIN_1g015579mg                   159   1e-42    Citrus sinensis [apfelsine]
gb|KDO46603.1|  hypothetical protein CISIN_1g015579mg                   158   2e-42    Citrus sinensis [apfelsine]
gb|KDO46602.1|  hypothetical protein CISIN_1g015579mg                   158   3e-42    Citrus sinensis [apfelsine]
ref|NP_001031154.1|  uncharacterized protein                            149   9e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007049654.1|  F21O3.2 protein                                    158   3e-41    
dbj|BAH56904.1|  AT1G48450                                              146   4e-41    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185170.1|  uncharacterized protein                            146   5e-41    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006484801.1|  PREDICTED: uncharacterized protein LOC102613099    157   7e-41    Citrus sinensis [apfelsine]
ref|XP_006437252.1|  hypothetical protein CICLE_v10031774mg             157   8e-41    Citrus clementina [clementine]
ref|XP_002531072.1|  conserved hypothetical protein                     157   1e-40    Ricinus communis
gb|KDO46600.1|  hypothetical protein CISIN_1g015579mg                   156   2e-40    Citrus sinensis [apfelsine]
gb|KDO46601.1|  hypothetical protein CISIN_1g015579mg                   156   2e-40    Citrus sinensis [apfelsine]
gb|KJB42555.1|  hypothetical protein B456_007G157400                    155   3e-40    Gossypium raimondii
gb|KHG02769.1|  Phosphoserine aminotransferase                          154   9e-40    Gossypium arboreum [tree cotton]
ref|XP_007209264.1|  hypothetical protein PRUPE_ppa007392mg             152   1e-39    
ref|XP_010069618.1|  PREDICTED: uncharacterized protein LOC104456510    153   3e-39    Eucalyptus grandis [rose gum]
gb|KDP45280.1|  hypothetical protein JCGZ_15145                         152   8e-39    Jatropha curcas
ref|XP_010274079.1|  PREDICTED: uncharacterized protein LOC104609452    152   8e-39    Nelumbo nucifera [Indian lotus]
ref|XP_002303068.2|  hypothetical protein POPTR_0002s24910g             148   2e-37    Populus trichocarpa [western balsam poplar]
ref|XP_010247844.1|  PREDICTED: uncharacterized protein LOC104590798    147   3e-37    Nelumbo nucifera [Indian lotus]
ref|XP_002272171.1|  PREDICTED: uncharacterized protein LOC100251038    146   5e-37    Vitis vinifera
ref|XP_006368347.1|  hypothetical protein POPTR_0001s01860g             141   1e-36    
ref|XP_006367000.1|  PREDICTED: uncharacterized protein LOC102582294    145   3e-36    Solanum tuberosum [potatoes]
ref|XP_011024597.1|  PREDICTED: uncharacterized protein LOC105125729    144   5e-36    Populus euphratica
emb|CBI40011.3|  unnamed protein product                                132   6e-36    Vitis vinifera
ref|XP_004290164.1|  PREDICTED: uncharacterized protein LOC101305809    142   2e-35    Fragaria vesca subsp. vesca
ref|XP_010908555.1|  PREDICTED: uncharacterized protein LOC105034...    141   2e-35    
ref|XP_010908554.1|  PREDICTED: uncharacterized protein LOC105034...    141   6e-35    Elaeis guineensis
ref|XP_004247039.1|  PREDICTED: uncharacterized protein LOC101262953    140   8e-35    Solanum lycopersicum
ref|XP_006432689.1|  hypothetical protein CICLE_v10003247mg             133   2e-34    
ref|XP_010100787.1|  hypothetical protein L484_015816                   138   4e-34    Morus notabilis
ref|XP_009587865.1|  PREDICTED: uncharacterized protein LOC104085515    138   5e-34    Nicotiana tomentosiformis
gb|KFK38188.1|  hypothetical protein AALP_AA3G080700                    138   5e-34    Arabis alpina [alpine rockcress]
ref|XP_011089045.1|  PREDICTED: uncharacterized protein LOC105170122    137   1e-33    Sesamum indicum [beniseed]
ref|XP_008776305.1|  PREDICTED: uncharacterized protein LOC103696450    137   1e-33    Phoenix dactylifera
ref|XP_009763079.1|  PREDICTED: uncharacterized protein LOC104215037    137   2e-33    Nicotiana sylvestris
ref|XP_003520988.1|  PREDICTED: uncharacterized protein LOC100793365    137   2e-33    Glycine max [soybeans]
gb|KHN40722.1|  hypothetical protein glysoja_049851                     136   3e-33    Glycine soja [wild soybean]
ref|XP_006599165.1|  PREDICTED: uncharacterized protein LOC100804253    136   3e-33    Glycine max [soybeans]
ref|XP_006848511.1|  hypothetical protein AMTR_s00013p00260550          137   3e-33    Amborella trichopoda
ref|XP_010547130.1|  PREDICTED: uncharacterized protein LOC104818981    135   4e-33    Tarenaya hassleriana [spider flower]
ref|XP_006407850.1|  hypothetical protein EUTSA_v10020977mg             134   2e-32    Eutrema salsugineum [saltwater cress]
gb|KHN21277.1|  hypothetical protein glysoja_038588                     132   3e-32    Glycine soja [wild soybean]
ref|XP_007134152.1|  hypothetical protein PHAVU_010G023700g             133   3e-32    Phaseolus vulgaris [French bean]
ref|XP_009349111.1|  PREDICTED: uncharacterized protein LOC103940675    132   5e-32    Pyrus x bretschneideri [bai li]
ref|XP_004170841.1|  PREDICTED: uncharacterized protein LOC101230760    129   7e-32    
ref|XP_010685095.1|  PREDICTED: uncharacterized protein LOC104899578    132   9e-32    Beta vulgaris subsp. vulgaris [field beet]
emb|CDP03929.1|  unnamed protein product                                132   1e-31    Coffea canephora [robusta coffee]
ref|XP_002884641.1|  hypothetical protein ARALYDRAFT_896892             131   1e-31    Arabidopsis lyrata subsp. lyrata
ref|XP_008458049.1|  PREDICTED: uncharacterized protein LOC103497590    131   2e-31    Cucumis melo [Oriental melon]
ref|NP_566302.1|  uncharacterized protein                               130   2e-31    Arabidopsis thaliana [mouse-ear cress]
gb|EYU39191.1|  hypothetical protein MIMGU_mgv1a013058mg                127   3e-31    Erythranthe guttata [common monkey flower]
ref|XP_004510240.1|  PREDICTED: uncharacterized protein LOC101489146    130   4e-31    Cicer arietinum [garbanzo]
ref|XP_006602471.1|  PREDICTED: uncharacterized protein LOC100794...    129   6e-31    Glycine max [soybeans]
ref|XP_004149773.1|  PREDICTED: uncharacterized protein LOC101209314    130   6e-31    Cucumis sativus [cucumbers]
ref|XP_008382586.1|  PREDICTED: uncharacterized protein LOC103445364    129   7e-31    
ref|XP_007201792.1|  hypothetical protein PRUPE_ppa007244mg             129   7e-31    Prunus persica
ref|XP_009793974.1|  PREDICTED: uncharacterized protein LOC104240787    129   8e-31    Nicotiana sylvestris
ref|XP_008244677.1|  PREDICTED: uncharacterized protein LOC103342802    129   9e-31    Prunus mume [ume]
ref|XP_007140787.1|  hypothetical protein PHAVU_008G142100g             129   1e-30    Phaseolus vulgaris [French bean]
ref|XP_009147087.1|  PREDICTED: uncharacterized protein LOC103870681    128   1e-30    Brassica rapa
ref|XP_010451051.1|  PREDICTED: uncharacterized protein LOC104733110    128   2e-30    Camelina sativa [gold-of-pleasure]
ref|XP_010464350.1|  PREDICTED: uncharacterized protein LOC104744916    128   2e-30    Camelina sativa [gold-of-pleasure]
emb|CDY28064.1|  BnaC05g44660D                                          128   2e-30    Brassica napus [oilseed rape]
gb|KHN10952.1|  hypothetical protein glysoja_026687                     127   3e-30    Glycine soja [wild soybean]
ref|XP_006586216.1|  PREDICTED: uncharacterized protein LOC102662413    127   4e-30    Glycine max [soybeans]
ref|XP_003626951.1|  hypothetical protein MTR_8g012420                  127   6e-30    Medicago truncatula
ref|XP_010486277.1|  PREDICTED: uncharacterized protein LOC104764444    127   6e-30    Camelina sativa [gold-of-pleasure]
ref|XP_006297949.1|  hypothetical protein CARUB_v10013990mg             127   6e-30    Capsella rubella
gb|ABR26180.1|  unknown                                                 119   7e-30    Oryza sativa Indica Group [Indian rice]
ref|XP_009596731.1|  PREDICTED: uncharacterized protein LOC104092768    127   8e-30    Nicotiana tomentosiformis
ref|XP_009372204.1|  PREDICTED: uncharacterized protein LOC103961392    126   8e-30    Pyrus x bretschneideri [bai li]
ref|XP_010552027.1|  PREDICTED: uncharacterized protein LOC104822482    125   2e-29    
emb|CDY24630.1|  BnaA05g30290D                                          124   4e-29    
ref|XP_008372537.1|  PREDICTED: uncharacterized protein LOC103435886    124   4e-29    
ref|XP_001420115.1|  predicted protein                                  119   1e-28    
gb|AGT16908.1|  hypothetical protein SHCRBa_217_A17_F_90                122   2e-28    
gb|AGT15907.1|  hypothetical protein SHCRBa_013_F04_R_50                122   2e-28    
gb|AGT16547.1|  hypothetical protein SHCRBa_093_N12_F_10                122   3e-28    
emb|CEF99337.1|  Protein of unknown function DUF760                     119   3e-28    
gb|AGT16639.1|  Protein of unknown function DUF760                      122   3e-28    
gb|ACF84114.1|  unknown                                                 122   5e-28    
ref|XP_008676966.1|  PREDICTED: uncharacterized protein LOC100276...    122   5e-28    
ref|NP_001143759.1|  uncharacterized protein LOC100276521               121   5e-28    
ref|XP_004979240.1|  PREDICTED: uncharacterized protein LOC101761319    121   5e-28    
ref|XP_009124377.1|  PREDICTED: uncharacterized protein LOC103849349    121   6e-28    
emb|CDY60823.1|  BnaAnng17260D                                          120   1e-27    
emb|CDY34905.1|  BnaA01g32360D                                          120   1e-27    
ref|XP_003577586.1|  PREDICTED: uncharacterized protein LOC100826589    120   2e-27    
gb|EMS63859.1|  hypothetical protein TRIUR3_07220                       115   1e-26    
ref|XP_007510107.1|  predicted protein                                  115   9e-26    
gb|ACU18333.1|  unknown                                                 111   1e-25    
ref|XP_005649890.1|  DUF760-domain-containing protein                   114   2e-25    
ref|XP_009151658.1|  PREDICTED: uncharacterized protein LOC103874970    113   3e-25    
gb|EMT02013.1|  hypothetical protein F775_06929                         111   5e-25    
emb|CDX85350.1|  BnaC07g26610D                                          112   5e-25    
ref|XP_008341108.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...    112   7e-25    
ref|NP_199670.1|  uncharacterized protein                               111   1e-24    
gb|KFK31332.1|  hypothetical protein AALP_AA6G098300                    111   1e-24    
ref|XP_006280743.1|  hypothetical protein CARUB_v10026712mg             110   2e-24    
ref|XP_002863907.1|  hypothetical protein ARALYDRAFT_917767             110   3e-24    
emb|CDY19857.1|  BnaC09g31230D                                          105   3e-24    
dbj|BAK05587.1|  predicted protein                                      110   3e-24    
ref|XP_002863048.1|  hypothetical protein ARALYDRAFT_920669             110   4e-24    
ref|XP_006395162.1|  hypothetical protein EUTSA_v10004513mg             109   5e-24    
ref|XP_006662927.1|  PREDICTED: uncharacterized protein LOC102711023    109   6e-24    
gb|ABA93505.2|  expressed protein                                       107   2e-23    
ref|NP_001067848.2|  Os11g0456100                                       107   2e-23    
ref|XP_002503881.1|  predicted protein                                  105   5e-23    
ref|XP_005849975.1|  hypothetical protein CHLNCDRAFT_141875             109   8e-23    
gb|AEW07482.1|  hypothetical protein 0_2478_01                        96.7    2e-21    
ref|XP_010271747.1|  PREDICTED: uncharacterized protein LOC104607751  70.1    5e-19    
ref|XP_004240629.1|  PREDICTED: uncharacterized protein LOC101262317  94.0    1e-18    
dbj|BAD94536.1|  hypothetical protein                                 86.3    2e-17    
ref|XP_004492297.1|  PREDICTED: uncharacterized protein LOC101488500  84.7    3e-15    
ref|XP_003055064.1|  predicted protein                                74.3    2e-14    
ref|XP_001691046.1|  predicted protein                                82.8    2e-14    
gb|KEH22562.1|  DUF760 family protein                                 80.1    9e-14    
ref|XP_002948306.1|  hypothetical protein VOLCADRAFT_88515            77.8    1e-12    
dbj|BAF63502.1|  hypothetical protein                                 71.6    4e-12    
gb|AAP45168.2|  hypothetical protein SBB1_14t00001                    71.6    5e-12    
ref|XP_011399310.1|  WD repeat-containing protein 89-like protein     73.2    4e-11    
gb|KIY96176.1|  hypothetical protein MNEG_11787                       72.0    6e-11    
ref|XP_002444902.1|  hypothetical protein SORBIDRAFT_07g001113        63.5    1e-09    
ref|XP_010445948.1|  PREDICTED: uncharacterized protein LOC104728696  63.2    4e-08    
gb|EPS72664.1|  hypothetical protein M569_02093                       55.5    9e-07    
emb|CDY40232.1|  BnaA09g35140D                                        56.6    4e-06    
ref|XP_003081567.1|  unnamed protein product                          43.9    6e-06    
gb|EYU39226.1|  hypothetical protein MIMGU_mgv1a0220162mg             53.5    1e-05    
gb|EYU24492.1|  hypothetical protein MIMGU_mgv1a012902mg              54.3    3e-05    
gb|EYU39189.1|  hypothetical protein MIMGU_mgv1a022366mg              50.4    1e-04    
ref|WP_015145832.1|  hypothetical protein                             50.1    2e-04    
ref|WP_019494359.1|  hypothetical protein                             49.7    3e-04    
ref|WP_008198760.1|  hypothetical protein                             49.3    3e-04    
ref|WP_026087356.1|  hypothetical protein                             48.9    5e-04    
ref|WP_026087770.1|  hypothetical protein                             48.9    5e-04    
ref|WP_030006382.1|  hypothetical protein                             48.5    7e-04    
ref|WP_022605854.1|  protein of unknown function (DUF760)             48.5    7e-04    



>ref|XP_009614692.1| PREDICTED: uncharacterized protein LOC104107561 [Nicotiana tomentosiformis]
Length=421

 Score =   358 bits (918),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 186/246 (76%), Positives = 202/246 (82%), Gaps = 7/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPAI+ PS   SG IDT PS+D++  RLHS EA EMIQNHL+LILGNR   NS+V QI+K
Sbjct  176  VPAISPPSSEPSGRIDTWPSQDDKFERLHSAEANEMIQNHLALILGNRLGDNSAVAQISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGG------Dssdt  481
             RVGQVYAASVMYGYFLKRVDQRFQLEK MKVLPQG+D EDS I+QVGG      D SDT
Sbjct  236  FRVGQVYAASVMYGYFLKRVDQRFQLEKTMKVLPQGVDDEDSSIRQVGGEEIRSGDRSDT  295

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
            S   + SHPE+ SW  G  G+ GFG  +KPSRLR YVMSFDGETLQRYATIRSKEAI II
Sbjct  296  SFGVTQSHPELSSWSAGSAGTGGFGHGIKPSRLRNYVMSFDGETLQRYATIRSKEAIGII  355

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRPEI ITPQGT+DSSKDEL+KISF  L RLVLEAVTFGSFLWDVES VDSR
Sbjct  356  EKHTEALFGRPEIVITPQGTVDSSKDELLKISFGGLSRLVLEAVTFGSFLWDVESYVDSR  415

Query  120  YHFVAH  103
            YHFVA+
Sbjct  416  YHFVAN  421


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA +R+KALEEILYALVVQKFMDA+V
Sbjct  146  EVKANDRKKALEEILYALVVQKFMDANV  173



>ref|XP_006363989.1| PREDICTED: uncharacterized protein LOC102601007 [Solanum tuberosum]
Length=421

 Score =   355 bits (912),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 181/246 (74%), Positives = 202/246 (82%), Gaps = 7/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPAI+  S   SG IDT PS+D++L  LHSPEA EMIQNHLSLILG+R   NS+V QI+K
Sbjct  176  VPAISPSSSEPSGRIDTWPSQDDKLEHLHSPEANEMIQNHLSLILGSRLGDNSAVAQISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGD------ssdt  481
            LRVGQVYAAS+MYGYFL+RVDQRFQLEK+MKVLPQG+D EDS IQQV G+      S  +
Sbjct  236  LRVGQVYAASIMYGYFLRRVDQRFQLEKSMKVLPQGVDDEDSSIQQVAGEDISGDRSDTS  295

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
               ++ +HPE+ SW  GG    GFG  +KPSRLR YVMSFDGETLQRYATIRS+EAI +I
Sbjct  296  FRSTTQTHPELTSWSAGGASPGGFGQGIKPSRLRNYVMSFDGETLQRYATIRSREAIGMI  355

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRPEI ITPQGTIDSSKDELIKISF  LRRLVLEAVTFGSFLWDVES VDSR
Sbjct  356  EKHTEALFGRPEIVITPQGTIDSSKDELIKISFGGLRRLVLEAVTFGSFLWDVESYVDSR  415

Query  120  YHFVAH  103
            YHFVA+
Sbjct  416  YHFVAN  421


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+K LEEILYALVVQKFMDA+V
Sbjct  146  EVKANERKKTLEEILYALVVQKFMDANV  173



>ref|XP_009780705.1| PREDICTED: uncharacterized protein LOC104229716 [Nicotiana sylvestris]
 ref|XP_009780706.1| PREDICTED: uncharacterized protein LOC104229716 [Nicotiana sylvestris]
Length=421

 Score =   354 bits (908),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/246 (75%), Positives = 202/246 (82%), Gaps = 7/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPAI+ PS   SG +DT PS+D++   LHS EA EMIQNHL+LILG+R   NS+V QI+K
Sbjct  176  VPAISPPSSEPSGRVDTWPSQDDKFEHLHSAEANEMIQNHLALILGSRLGDNSAVAQISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGG------Dssdt  481
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MKVLPQG+D ED   +QVGG      D SDT
Sbjct  236  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKVLPQGVDDEDGSFRQVGGEEIRSGDRSDT  295

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
            S R + SHPE+ SW  G  G+ GFG  +KPSRLR YVMSFDGETLQRYATIRSKEAI II
Sbjct  296  SSRVTQSHPELSSWSAGSAGTGGFGHGIKPSRLRNYVMSFDGETLQRYATIRSKEAIGII  355

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRPEI ITPQGT+DSSKDEL+KISF  LRRLVLEAVTFGSFLWDVES VDSR
Sbjct  356  EKHTEALFGRPEIVITPQGTVDSSKDELLKISFGGLRRLVLEAVTFGSFLWDVESYVDSR  415

Query  120  YHFVAH  103
            YHFVA+
Sbjct  416  YHFVAN  421


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA +R+KALEEILYALVVQKFMDA+V
Sbjct  146  EVKANDRKKALEEILYALVVQKFMDANV  173



>ref|XP_004235367.1| PREDICTED: uncharacterized protein LOC101248757 [Solanum lycopersicum]
Length=421

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 178/246 (72%), Positives = 201/246 (82%), Gaps = 7/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPAI+  S   SG IDT PS+D++L  LHS EA EMIQNHLSLILG+R   +S+V QI+K
Sbjct  176  VPAISPSSSEPSGRIDTWPSQDDKLEHLHSAEANEMIQNHLSLILGSRLGDDSAVAQISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGD------ssdt  481
            LRVGQVYAAS+MYGYFL+RVDQRFQLEK+MKVLP G+D EDS IQQV G+      S  +
Sbjct  236  LRVGQVYAASIMYGYFLRRVDQRFQLEKSMKVLPPGVDNEDSSIQQVAGEDISGDRSDTS  295

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
               ++ +HPE+ SW  GG+   GFG  +KPSRLR YVMSFDGETLQRYATIRS+EAI +I
Sbjct  296  FRSTTQTHPELTSWSAGGVSPGGFGQGIKPSRLRNYVMSFDGETLQRYATIRSREAIGMI  355

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRPEI ITPQGTIDSSKDELIKISF  LRRLVLEAVTFGSFLWDVES VDSR
Sbjct  356  EKHTEALFGRPEIVITPQGTIDSSKDELIKISFGGLRRLVLEAVTFGSFLWDVESYVDSR  415

Query  120  YHFVAH  103
            YHFVA+
Sbjct  416  YHFVAN  421


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+K LEEILYALVVQKFMDA+V
Sbjct  146  EVKANERKKTLEEILYALVVQKFMDANV  173



>ref|XP_010091765.1| hypothetical protein L484_019353 [Morus notabilis]
 gb|EXB45128.1| hypothetical protein L484_019353 [Morus notabilis]
Length=431

 Score =   348 bits (892),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 178/243 (73%), Positives = 204/243 (84%), Gaps = 7/243 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+I + + + SG +D+ PS+DE+L +LHSPEAYEMIQNHL+LILGNR   ++SV QI+K
Sbjct  188  VPSIETSASDPSGCVDSWPSQDEKLEQLHSPEAYEMIQNHLALILGNRLGDSTSVAQISK  247

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-----ts  478
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  LD +D+ +QQ  GD S       S
Sbjct  248  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNTLDGDDTNVQQAVGDDSRPLGGGES  307

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
             +++PSHPEV SW  GG    GFG  MKPSRLRTYVMSFDGETLQRYATIRSKEA++IIE
Sbjct  308  FQAAPSHPEVSSWA-GGTSPGGFGHGMKPSRLRTYVMSFDGETLQRYATIRSKEAVSIIE  366

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGRPEI ITPQGT+DSSKDELIKISF+ L+RLVLEAVTFGSFLWDVES VD+RY
Sbjct  367  KHTEALFGRPEIVITPQGTVDSSKDELIKISFAGLKRLVLEAVTFGSFLWDVESYVDARY  426

Query  117  HFV  109
            HFV
Sbjct  427  HFV  429


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  158  EVKANERRKALEEILYALVVQKFMDANV  185



>ref|XP_009355996.1| PREDICTED: uncharacterized protein LOC103946898 isoform X2 [Pyrus 
x bretschneideri]
Length=428

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/246 (72%), Positives = 201/246 (82%), Gaps = 8/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAIT  + + SG +D+ PS++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+K
Sbjct  184  VPAITPTASDPSGRVDSWPSQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISK  243

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQ-QVG-----GDssdt  481
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +  EDS IQ  VG     G   DT
Sbjct  244  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDVRPGGGEDT  303

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
                +PSHPEV SW  GG+ S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++II
Sbjct  304  LQAGAPSHPEVSSWA-GGISSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSII  362

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRP+I ITPQGT+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSR
Sbjct  363  EKHTEALFGRPDIVITPQGTVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSR  422

Query  120  YHFVAH  103
            YHFVA+
Sbjct  423  YHFVAN  428


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILY LVVQKFMDA+V
Sbjct  154  EVKATERRKALEEILYTLVVQKFMDANV  181



>ref|XP_009355995.1| PREDICTED: uncharacterized protein LOC103946898 isoform X1 [Pyrus 
x bretschneideri]
Length=429

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/246 (72%), Positives = 201/246 (82%), Gaps = 8/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAIT  + + SG +D+ PS++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+K
Sbjct  185  VPAITPTASDPSGRVDSWPSQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISK  244

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQ-QVG-----GDssdt  481
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +  EDS IQ  VG     G   DT
Sbjct  245  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDVRPGGGEDT  304

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
                +PSHPEV SW  GG+ S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++II
Sbjct  305  LQAGAPSHPEVSSWA-GGISSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSII  363

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRP+I ITPQGT+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSR
Sbjct  364  EKHTEALFGRPDIVITPQGTVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSR  423

Query  120  YHFVAH  103
            YHFVA+
Sbjct  424  YHFVAN  429


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILY LVVQKFMDA+V
Sbjct  155  EVKATERRKALEEILYTLVVQKFMDANV  182



>ref|XP_008375017.1| PREDICTED: uncharacterized protein LOC103438262 isoform X1 [Malus 
domestica]
 ref|XP_008375018.1| PREDICTED: uncharacterized protein LOC103438262 isoform X1 [Malus 
domestica]
Length=429

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 199/246 (81%), Gaps = 8/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAIT  +   SG +D+ PS++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+K
Sbjct  185  VPAITPTASYPSGQVDSWPSQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISK  244

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQ-QVG-----GDssdt  481
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +  EDS IQ  VG     G   DT
Sbjct  245  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDT  304

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
                + SHPEV SW  GG+ S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++II
Sbjct  305  LQAGASSHPEVSSWA-GGISSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSII  363

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRP+I ITPQGT+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSR
Sbjct  364  EKHTEALFGRPDIVITPQGTVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSR  423

Query  120  YHFVAH  103
            YHFVA+
Sbjct  424  YHFVAN  429


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILY LVVQKFMDA+V
Sbjct  155  EVKATERRKALEEILYTLVVQKFMDANV  182



>ref|XP_008375019.1| PREDICTED: uncharacterized protein LOC103438262 isoform X2 [Malus 
domestica]
 ref|XP_008375020.1| PREDICTED: uncharacterized protein LOC103438262 isoform X2 [Malus 
domestica]
Length=428

 Score =   339 bits (869),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 199/246 (81%), Gaps = 8/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAIT  +   SG +D+ PS++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+K
Sbjct  184  VPAITPTASYPSGQVDSWPSQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISK  243

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQ-QVG-----GDssdt  481
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +  EDS IQ  VG     G   DT
Sbjct  244  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDT  303

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
                + SHPEV SW  GG+ S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++II
Sbjct  304  LQAGASSHPEVSSWA-GGISSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSII  362

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRP+I ITPQGT+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSR
Sbjct  363  EKHTEALFGRPDIVITPQGTVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSR  422

Query  120  YHFVAH  103
            YHFVA+
Sbjct  423  YHFVAN  428


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILY LVVQKFMDA+V
Sbjct  154  EVKATERRKALEEILYTLVVQKFMDANV  181



>ref|XP_008356700.1| PREDICTED: uncharacterized protein LOC103420417 isoform X2 [Malus 
domestica]
Length=428

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 199/246 (81%), Gaps = 8/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAIT  +   SG +D+ PS++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+K
Sbjct  184  VPAITPTASYPSGQVDSWPSQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISK  243

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQ-QVG-----GDssdt  481
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +  EDS IQ  VG     G   DT
Sbjct  244  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDT  303

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
                + SHPEV SW  GG+ S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++II
Sbjct  304  LQAGASSHPEVSSWA-GGISSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSII  362

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRP+I ITPQGT+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSR
Sbjct  363  EKHTEALFGRPDIVITPQGTVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSR  422

Query  120  YHFVAH  103
            YHFVA+
Sbjct  423  YHFVAN  428


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILY LVVQKFMDA+V
Sbjct  154  EVKATERRKALEEILYTLVVQKFMDANV  181



>ref|XP_008356699.1| PREDICTED: uncharacterized protein LOC103420417 isoform X1 [Malus 
domestica]
Length=429

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 199/246 (81%), Gaps = 8/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAIT  +   SG +D+ PS++E+L +LHSPEAYEMIQNHLSLILGNR  ++ S  QI+K
Sbjct  185  VPAITPTASYPSGQVDSWPSQNEKLEQLHSPEAYEMIQNHLSLILGNRLGDSTSLAQISK  244

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQ-QVG-----GDssdt  481
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +  EDS IQ  VG     G   DT
Sbjct  245  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPSAMGPEDSDIQTSVGQDMRPGGGEDT  304

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
                + SHPEV SW  GG+ S GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++II
Sbjct  305  LQAGASSHPEVSSWA-GGISSGGFGNAIKPSRLRTYVMSFDGETLHRYATIRSREAVSII  363

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRP+I ITPQGT+DSSKD+ IKISF  LRRLVLEAVTFGSFLWDVES VDSR
Sbjct  364  EKHTEALFGRPDIVITPQGTVDSSKDDHIKISFGGLRRLVLEAVTFGSFLWDVESYVDSR  423

Query  120  YHFVAH  103
            YHFVA+
Sbjct  424  YHFVAN  429


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILY LVVQKFMDA+V
Sbjct  155  EVKATERRKALEEILYTLVVQKFMDANV  182



>ref|XP_011073153.1| PREDICTED: uncharacterized protein LOC105158192 [Sesamum indicum]
Length=421

 Score =   337 bits (864),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 178/247 (72%), Positives = 203/247 (82%), Gaps = 10/247 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +P IT  S ++SG +D+ PS+D++L  LHSPEAYEMIQNHL+LILGNR  ++NS  QI+K
Sbjct  177  IPTITPSSPDNSGRVDSWPSQDDKLESLHSPEAYEMIQNHLALILGNRLGDSNSVAQISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV-------GGDssd  484
            LRVGQVYAASVMYGYFL+RVDQRFQLEK+MKVLPQ +D E++ I+QV        GD S+
Sbjct  237  LRVGQVYAASVMYGYFLRRVDQRFQLEKSMKVLPQSIDNEENHIEQVIADDMRPSGDYSN  296

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             SLR+   HPEV SW   G    G    +KPSRLRTYVMSFDGETLQRYATIRSKEAI+I
Sbjct  297  ESLRNPQPHPEVSSW--SGGLGAGGFGRIKPSRLRTYVMSFDGETLQRYATIRSKEAISI  354

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITP+GT+DSSKDELIKISF  LRRLVLEAVTFGSFLWDVES VDS
Sbjct  355  IEKHTEALFGRPEIVITPEGTVDSSKDELIKISFGGLRRLVLEAVTFGSFLWDVESYVDS  414

Query  123  RYHFVAH  103
            RYHFVA+
Sbjct  415  RYHFVAN  421


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  147  EVKANERRKALEEILYALVVQKFMDANV  174



>gb|EYU21849.1| hypothetical protein MIMGU_mgv1a007186mg [Erythranthe guttata]
Length=416

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 198/242 (82%), Gaps = 5/242 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VP IT  S + SG +DT PS+DE+L RLHS EAYEMIQNHL+LILGNR +++NS  +I+K
Sbjct  177  VPTITPSSPDKSGRVDTWPSQDEKLERLHSTEAYEMIQNHLALILGNRLADSNSLAEISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD-KEDSGIQQV-GGDssdtslrs  469
            LRVGQVYAASVMYGYFLKR+DQRFQLEK MKVLPQG    E   I+QV   D  D+   +
Sbjct  237  LRVGQVYAASVMYGYFLKRIDQRFQLEKTMKVLPQGTTVNEYENIEQVIADDKKDSVRSA  296

Query  468  spSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  289
              SHPE  ++   G+G   F   +KPSRLRTYVMSFDGETLQRYATIRSKEAI+IIEKHT
Sbjct  297  QNSHPEASTF-SSGIGGMSFAG-VKPSRLRTYVMSFDGETLQRYATIRSKEAISIIEKHT  354

Query  288  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            EALFGRPEI+ITPQGT+DSSKDELIKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  355  EALFGRPEIAITPQGTVDSSKDELIKISFGGLKRLVLEAVTFGSFLWDVESFVDSRYHFV  414

Query  108  AH  103
            A+
Sbjct  415  AN  416


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADVP  824
            EVKA ERR+ALEEILYALVVQKFMD ++P
Sbjct  147  EVKANERREALEEILYALVVQKFMDVNIP  175



>emb|CDO98647.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   335 bits (859),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 176/248 (71%), Positives = 202/248 (81%), Gaps = 10/248 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P+I  PS + SG +D  PS +E+L RLHS EAYEMIQNHL+LILGNR   +SSV QI+K
Sbjct  178  IPSI-GPSLDPSGQVDKWPSHEEKLERLHSHEAYEMIQNHLALILGNRVADSSSVAQISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKED-SGIQQV-------GGDss  487
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+M++LP+G D    S  Q++       G D +
Sbjct  237  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMRILPRGSDDGVLSNTQEMVGQEDGPGTDVA  296

Query  486  dtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAIN  307
              + R++ SHPEV SW  GG+ + GFG  MK SRLRTYVMSFDGETLQRYATIRSKEA++
Sbjct  297  ANTFRTAQSHPEVSSWSAGGVSAGGFGHGMKSSRLRTYVMSFDGETLQRYATIRSKEAVS  356

Query  306  IIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVD  127
            IIEKHTEALFGRPEI ITP+GT+DSSKDELIKISF  LRRLVLEAVTFGSFLWDVES VD
Sbjct  357  IIEKHTEALFGRPEIVITPEGTVDSSKDELIKISFGGLRRLVLEAVTFGSFLWDVESHVD  416

Query  126  SRYHFVAH  103
            SRYHFVA+
Sbjct  417  SRYHFVAN  424


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYAL+VQKFMDA V
Sbjct  148  EVKANERRKALEEILYALIVQKFMDASV  175



>ref|XP_007036962.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY21463.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=428

 Score =   335 bits (858),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 199/243 (82%), Gaps = 7/243 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPA+T  S + SG +D  PS++++L  LHSPEAYEMIQNHL+LILGNR   ++SV QI+K
Sbjct  185  VPAMTPSSTDPSGRVDMWPSEEDKLELLHSPEAYEMIQNHLALILGNRLGDSTSVAQISK  244

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDssdt----s  478
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP   + E+SG++Q VG D        S
Sbjct  245  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNASNGEESGVEQSVGEDMGTAGLGDS  304

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
             ++  SHPEV SW  GG+   GFG  +KP RLRTYVMSFDGETLQ++A IRSKEA++IIE
Sbjct  305  YKAVSSHPEVSSW-SGGISPGGFGHGIKPCRLRTYVMSFDGETLQKFAAIRSKEAVSIIE  363

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGRPEI ITPQGT+DSSKDELIKISF+ L+RLVLEAVTFGSFLWDVES VDSRY
Sbjct  364  KHTEALFGRPEIVITPQGTVDSSKDELIKISFNGLKRLVLEAVTFGSFLWDVESYVDSRY  423

Query  117  HFV  109
            HFV
Sbjct  424  HFV  426


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+KALEEILYALVVQKFMDA+V
Sbjct  155  EVKANERKKALEEILYALVVQKFMDANV  182



>gb|KHG11329.1| Alanine--tRNA ligase [Gossypium arboreum]
 gb|KHG12308.1| Alanine--tRNA ligase [Gossypium arboreum]
Length=428

 Score =   332 bits (851),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 173/243 (71%), Positives = 200/243 (82%), Gaps = 8/243 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPAITS S + SG +DT PS++++L +LHS EA+EMIQNHL+LILGNR   ++SV QI+K
Sbjct  186  VPAITS-SADPSGRVDTWPSQEDKLEQLHSAEAHEMIQNHLALILGNRLGDSTSVAQISK  244

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-----ts  478
            LRVGQVYAASVMYGYFL+RVDQRFQLEK MKVLP   D + S I+Q  GD +       S
Sbjct  245  LRVGQVYAASVMYGYFLRRVDQRFQLEKTMKVLPSASDGDKSSIEQTVGDDTRPSGLGDS  304

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
             +++ SH EV SW  GG+   GFG+ +KPSRLRTYVMSFDGETLQRYA+IRSKEA+ IIE
Sbjct  305  YQAASSHAEVSSW-SGGISPGGFGSGIKPSRLRTYVMSFDGETLQRYASIRSKEAVGIIE  363

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGRPEI+ITPQGT+DSS DELIKISF  L+RLVLEAVTFGSFLWDVES VDSRY
Sbjct  364  KHTEALFGRPEIAITPQGTVDSSNDELIKISFGGLKRLVLEAVTFGSFLWDVESFVDSRY  423

Query  117  HFV  109
            HFV
Sbjct  424  HFV  426


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER++ALEEILYALVVQKFMDA++
Sbjct  156  EVKANERKRALEEILYALVVQKFMDANI  183



>ref|XP_006493269.1| PREDICTED: uncharacterized protein LOC102611948 isoform X1 [Citrus 
sinensis]
 ref|XP_006493270.1| PREDICTED: uncharacterized protein LOC102611948 isoform X2 [Citrus 
sinensis]
Length=418

 Score =   329 bits (844),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 176/242 (73%), Positives = 199/242 (82%), Gaps = 6/242 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P+IT  S +SSG +DT  S+DE L +LHS EAYEMIQNHL+LILGNR   ++SV QI+K
Sbjct  176  IPSITPSSSDSSGRVDTWLSQDENLEQLHSSEAYEMIQNHLALILGNRLGDSTSVAQISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdt----sl  475
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+LP   D E SGIQQV GD + T    S 
Sbjct  236  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKILPDASDVEASGIQQVVGDVTPTGAEGSH  295

Query  474  rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
             +  SHPEV S+  GG+   GFG  +K SRLRTYVMSFDGETLQRYATIRSKEA++IIEK
Sbjct  296  EALSSHPEVSSF-SGGVSPGGFGHGIKASRLRTYVMSFDGETLQRYATIRSKEAVSIIEK  354

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYH  115
            HTEALFGRPEI +TPQGT+DSS DE IKISF+ L+RLVLEAVTFGSFLWDVES VDSRYH
Sbjct  355  HTEALFGRPEIVVTPQGTVDSSNDEQIKISFAGLKRLVLEAVTFGSFLWDVESYVDSRYH  414

Query  114  FV  109
            FV
Sbjct  415  FV  416


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  146  EVKANERRKALEEILYALVVQKFMDANV  173



>emb|CBI35458.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 173/238 (73%), Positives = 192/238 (81%), Gaps = 6/238 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P I+S S +SS  +DT PS+D +L +LHSPEAYEMIQNHL+LILGNR   ++SV QI+K
Sbjct  176  IPTISSSSSDSSDRVDTWPSQDGKLEQLHSPEAYEMIQNHLALILGNRLGDSTSVAQISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  LD +   +Q+   DS  T      
Sbjct  236  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPHALDGDKGSVQEAFDDSVQTVKS---  292

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
             HPEV SW  GG    GFG  +KPSRLR YVMSFD ETLQRYATIRSKEA++IIEKHTEA
Sbjct  293  -HPEVSSWA-GGFTPGGFGHGIKPSRLRNYVMSFDAETLQRYATIRSKEAVSIIEKHTEA  350

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFGRPEI ITPQGTIDSSKDELIKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  351  LFGRPEIIITPQGTIDSSKDELIKISFGGLKRLVLEAVTFGSFLWDVESFVDSRYHFV  408


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+KALEEILYALVVQKFMDA+V
Sbjct  146  EVKANERKKALEEILYALVVQKFMDANV  173



>ref|XP_011047792.1| PREDICTED: uncharacterized protein LOC105142042 [Populus euphratica]
Length=418

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 193/243 (79%), Gaps = 9/243 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P I   S  SSG +D+ PS+DE+L +LHSPEAYEMIQNHL+LILGNR   ++ V QI+K
Sbjct  177  IPTIAPSSTESSGQVDSWPSQDEKLEQLHSPEAYEMIQNHLTLILGNRVGDSTVVAQISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDss----dts  478
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK LP G+D+ +S I + VG D        S
Sbjct  237  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKTLPNGVDERESDIHKAVGQDVKPGGRGLS  296

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
             ++  SHPE +S   GG+   GFG  +K SRLR YVMSFDGETLQRYATIRSKEA++IIE
Sbjct  297  YQALSSHPEAIS---GGISPGGFGNGLKASRLRNYVMSFDGETLQRYATIRSKEAVSIIE  353

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGRPEI ITPQGTID+SKDEL+KIS   L+RL LEAVTFGSFLWDVES VDSRY
Sbjct  354  KHTEALFGRPEIVITPQGTIDTSKDELVKISLGGLKRLALEAVTFGSFLWDVESYVDSRY  413

Query  117  HFV  109
            HFV
Sbjct  414  HFV  416


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  147  EVKANERRKALEEILYALVVQKFMDANV  174



>ref|XP_010069444.1| PREDICTED: uncharacterized protein LOC104456368 [Eucalyptus grandis]
 gb|KCW57801.1| hypothetical protein EUGRSUZ_H00558 [Eucalyptus grandis]
Length=423

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 171/244 (70%), Positives = 200/244 (82%), Gaps = 9/244 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P+I + S+  SG +D  P ++E L +LHSPEAYEMIQNHL+LILGNR   N+SV QI+K
Sbjct  180  IPSINTSSE-PSGRVDGWPIQEEMLEQLHSPEAYEMIQNHLALILGNRMGDNNSVAQISK  238

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKED-SGIQQVGG-----Dssdt  481
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP   D ++ + +QQV G     D+ D 
Sbjct  239  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPSASDDDEVNNVQQVVGEDRKPDTGDD  298

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
            + ++  SHPEV SW  GG+   GFG+ +KPSRLRTYVMSFDGETLQRYATIRSKEA++II
Sbjct  299  TFQTVQSHPEVSSW-SGGVSPGGFGSGIKPSRLRTYVMSFDGETLQRYATIRSKEAVSII  357

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRPEI ITP+GT+DSS+DE IKISF  L+RLVLEAVTFGSFLWDVES VDSR
Sbjct  358  EKHTEALFGRPEIVITPEGTVDSSRDEHIKISFGGLKRLVLEAVTFGSFLWDVESFVDSR  417

Query  120  YHFV  109
            YHFV
Sbjct  418  YHFV  421


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  150  EVKANERRKALEEILYALVVQKFMDANV  177



>ref|XP_006441318.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 ref|XP_006441319.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 ref|XP_006441320.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54558.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54559.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
 gb|ESR54560.1| hypothetical protein CICLE_v10020337mg [Citrus clementina]
Length=417

 Score =   327 bits (839),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 199/242 (82%), Gaps = 6/242 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P+IT  S +SSG +DT  S+DE L +LHS EAYEMIQNHL+LILGNR   ++SV QI+K
Sbjct  175  IPSITPSSSDSSGRVDTWLSQDENLEQLHSSEAYEMIQNHLALILGNRLGDSTSVAQISK  234

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdt----sl  475
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+LP   D E+SGIQQV GD + T    S 
Sbjct  235  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKILPDASDVEESGIQQVVGDVTPTGAEGSH  294

Query  474  rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
             +  SHPEV S+  GG+   GFG  +K SRLRTYVMSFDGETLQRYATIRSKEA++IIEK
Sbjct  295  EALSSHPEVSSF-SGGVSPGGFGHGIKASRLRTYVMSFDGETLQRYATIRSKEAVSIIEK  353

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYH  115
            HTEALFGRPEI +TPQGT+DSS D  IKISF+ L+RLVLEAVTFGSFLWDVES VDSRYH
Sbjct  354  HTEALFGRPEIVVTPQGTVDSSNDVQIKISFAGLKRLVLEAVTFGSFLWDVESYVDSRYH  413

Query  114  FV  109
            FV
Sbjct  414  FV  415


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  145  EVKANERRKALEEILYALVVQKFMDANV  172



>ref|XP_008393456.1| PREDICTED: uncharacterized protein LOC103455652 isoform X1 [Malus 
domestica]
Length=432

 Score =   327 bits (839),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 169/246 (69%), Positives = 198/246 (80%), Gaps = 8/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAI+  + + SG +D+ PS+DE+L +LHSPEAYEMI+NHLSLILGNR  ++ S  +I+K
Sbjct  188  VPAISPTASDPSGQVDSWPSQDEKLEQLHSPEAYEMIRNHLSLILGNRLGDSTSLAKISK  247

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VG-----GDssdt  481
            L+VGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +  EDS I + VG     G   + 
Sbjct  248  LKVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGAMGAEDSDIHKSVGEDVRPGSGGEA  307

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
            S   + SHPEV S   GG+   GFG  +K SRLRTYVMSFDGETL RYATIRS+EAI+II
Sbjct  308  SQAGASSHPEVXSLA-GGVSPGGFGNALKHSRLRTYVMSFDGETLHRYATIRSREAISII  366

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRP+I ITPQGT+DSSKD+LIKISF  LRRL+LE+VTFGSFLWDVES VDSR
Sbjct  367  EKHTEALFGRPDIVITPQGTVDSSKDDLIKISFGGLRRLILESVTFGSFLWDVESYVDSR  426

Query  120  YHFVAH  103
            YHFVA+
Sbjct  427  YHFVAN  432


 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  158  EVKATERRKALEEILYALVVQKFMDANV  185



>ref|XP_008393457.1| PREDICTED: uncharacterized protein LOC103455652 isoform X2 [Malus 
domestica]
Length=431

 Score =   327 bits (839),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 169/246 (69%), Positives = 198/246 (80%), Gaps = 8/246 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAI+  + + SG +D+ PS+DE+L +LHSPEAYEMI+NHLSLILGNR  ++ S  +I+K
Sbjct  187  VPAISPTASDPSGQVDSWPSQDEKLEQLHSPEAYEMIRNHLSLILGNRLGDSTSLAKISK  246

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VG-----GDssdt  481
            L+VGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +  EDS I + VG     G   + 
Sbjct  247  LKVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGAMGAEDSDIHKSVGEDVRPGSGGEA  306

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
            S   + SHPEV S   GG+   GFG  +K SRLRTYVMSFDGETL RYATIRS+EAI+II
Sbjct  307  SQAGASSHPEVXSLA-GGVSPGGFGNALKHSRLRTYVMSFDGETLHRYATIRSREAISII  365

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRP+I ITPQGT+DSSKD+LIKISF  LRRL+LE+VTFGSFLWDVES VDSR
Sbjct  366  EKHTEALFGRPDIVITPQGTVDSSKDDLIKISFGGLRRLILESVTFGSFLWDVESYVDSR  425

Query  120  YHFVAH  103
            YHFVA+
Sbjct  426  YHFVAN  431


 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  157  EVKATERRKALEEILYALVVQKFMDANV  184



>ref|XP_009360039.1| PREDICTED: uncharacterized protein LOC103950540 isoform X1 [Pyrus 
x bretschneideri]
Length=431

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 199/246 (81%), Gaps = 9/246 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPAI SP+ + SG +D+ P++DE+L +LHSPEAYEMIQNHLSLILGNR   +SS+ +I+K
Sbjct  188  VPAI-SPTSDPSGQVDSWPTQDEKLEQLHSPEAYEMIQNHLSLILGNRLGDSSSLAKISK  246

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VG-----GDssdt  481
            L++GQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +  +DS I + VG     G   +T
Sbjct  247  LKIGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGAMGAKDSDIHKSVGEDMRPGSGGET  306

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
                  SHPEV S   GG+   GFG  +K SRLRTYVMSFDGETL RYATIRS+EAI+II
Sbjct  307  LQAGVSSHPEVPSLA-GGISPGGFGNALKHSRLRTYVMSFDGETLHRYATIRSREAISII  365

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRP+I ITPQGT+DSSKD+LIKISF  LRRLVLE+VTFGSFLWDVES VDSR
Sbjct  366  EKHTEALFGRPDIVITPQGTVDSSKDDLIKISFGGLRRLVLESVTFGSFLWDVESYVDSR  425

Query  120  YHFVAH  103
            YHFVA+
Sbjct  426  YHFVAN  431


 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  158  EVKATERRKALEEILYALVVQKFMDANV  185



>ref|XP_009360040.1| PREDICTED: uncharacterized protein LOC103950540 isoform X2 [Pyrus 
x bretschneideri]
Length=430

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 199/246 (81%), Gaps = 9/246 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPAI SP+ + SG +D+ P++DE+L +LHSPEAYEMIQNHLSLILGNR   +SS+ +I+K
Sbjct  187  VPAI-SPTSDPSGQVDSWPTQDEKLEQLHSPEAYEMIQNHLSLILGNRLGDSSSLAKISK  245

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VG-----GDssdt  481
            L++GQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +  +DS I + VG     G   +T
Sbjct  246  LKIGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGAMGAKDSDIHKSVGEDMRPGSGGET  305

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
                  SHPEV S   GG+   GFG  +K SRLRTYVMSFDGETL RYATIRS+EAI+II
Sbjct  306  LQAGVSSHPEVPSLA-GGISPGGFGNALKHSRLRTYVMSFDGETLHRYATIRSREAISII  364

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRP+I ITPQGT+DSSKD+LIKISF  LRRLVLE+VTFGSFLWDVES VDSR
Sbjct  365  EKHTEALFGRPDIVITPQGTVDSSKDDLIKISFGGLRRLVLESVTFGSFLWDVESYVDSR  424

Query  120  YHFVAH  103
            YHFVA+
Sbjct  425  YHFVAN  430


 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  157  EVKATERRKALEEILYALVVQKFMDANV  184



>ref|XP_008466989.1| PREDICTED: uncharacterized protein LOC103504355 [Cucumis melo]
Length=422

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/243 (70%), Positives = 188/243 (77%), Gaps = 6/243 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +PAIT  S + SG +DT  + DE L  LHSPEAYEMIQNHL+LILGNR  ++ S VQI+K
Sbjct  178  IPAITPSSSDVSGRVDTWAANDESLEHLHSPEAYEMIQNHLALILGNRVGDSTSVVQISK  237

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd----tsl  475
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MKVLP+  + EDS IQQ  G+        + 
Sbjct  238  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKVLPKASNSEDSIIQQAIGEDVRPYVGENS  297

Query  474  rsspSHPEVVSWPDGGMGS-RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
                 HPE+ SWPD    S  GF   +K SRLR YVM+FDGETLQRYATIRSKEA+ IIE
Sbjct  298  PPVSPHPEITSWPDRDENSIGGFSQGLKASRLRNYVMAFDGETLQRYATIRSKEAVGIIE  357

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGRPEI+ITPQGTID SKDE +KISF  L+ LVLEAVTFGSFLWDVES VDSRY
Sbjct  358  KHTEALFGRPEIAITPQGTIDPSKDEQLKISFGGLKGLVLEAVTFGSFLWDVESYVDSRY  417

Query  117  HFV  109
            HFV
Sbjct  418  HFV  420


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADVP  824
            EVKA ER++ LEEILYALVVQKFMDA+VP
Sbjct  148  EVKANERKQVLEEILYALVVQKFMDANVP  176



>gb|KDO47166.1| hypothetical protein CISIN_1g014467mg [Citrus sinensis]
Length=424

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 175/242 (72%), Positives = 198/242 (82%), Gaps = 6/242 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P+IT  S +SSG +DT  S+DE L +LHS EAYEMIQNHL+LILGNR   ++SV QI+K
Sbjct  182  IPSITPSSSDSSGRVDTWLSQDENLEQLHSSEAYEMIQNHLALILGNRLGDSTSVAQISK  241

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdt----sl  475
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+LP   D E SGIQQV GD + T    S 
Sbjct  242  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKILPDASDVEASGIQQVVGDVTPTGAEGSH  301

Query  474  rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
             +  SHPEV S+  GG+   GFG  +K SRLRTYVMSFDGETLQRYATIRSKEA++IIEK
Sbjct  302  EALSSHPEVSSF-SGGVSPGGFGHGIKASRLRTYVMSFDGETLQRYATIRSKEAVSIIEK  360

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYH  115
            HTEALFGRPEI +TPQGT+DSS D  IKISF+ L+RLVLEAVTFGSFLWDVES VDSRYH
Sbjct  361  HTEALFGRPEIVVTPQGTVDSSNDVQIKISFAGLKRLVLEAVTFGSFLWDVESYVDSRYH  420

Query  114  FV  109
            FV
Sbjct  421  FV  422


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  152  EVKANERRKALEEILYALVVQKFMDANV  179



>ref|XP_006374245.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52042.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=354

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 193/243 (79%), Gaps = 9/243 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P I   S  SSG +DT PS+DE+L +LHSPEAYEMIQNHL+LILGNR   +++V QI+K
Sbjct  113  IPTIGPSSAESSGQVDTWPSQDEKLEQLHSPEAYEMIQNHLTLILGNRVGDSTAVAQISK  172

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDss----dts  478
            LR+GQVYAASVMYGYFLKRVDQRFQLEK MK+LP G+D+ +S I + VG D        S
Sbjct  173  LRIGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNGVDETESDIHKAVGQDVKPGGRGLS  232

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
             ++  SHPE +S   GG+   GFG  +K SRLR YVMSFD ETLQRYATIRSKEA++IIE
Sbjct  233  YQALSSHPEAIS---GGISPGGFGHGLKASRLRNYVMSFDAETLQRYATIRSKEAVSIIE  289

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGRPEI ITPQGTID+SKDE++ IS   L+RL LEAVTFGSFLWDVES VDSRY
Sbjct  290  KHTEALFGRPEIVITPQGTIDTSKDEVVTISLGGLKRLALEAVTFGSFLWDVESYVDSRY  349

Query  117  HFV  109
            HFV
Sbjct  350  HFV  352


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            E KA +RRKALEEILYALVVQKFMDA+V
Sbjct  83   EAKANDRRKALEEILYALVVQKFMDANV  110



>gb|AAK30572.1|AF346660_1 unknown [Brassica napus]
Length=256

 Score =   320 bits (820),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 195/238 (82%), Gaps = 6/238 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+IT  S + SG +DT P+K E+L +LHS E YEMI NHL+LILG R    +SV QI+K
Sbjct  22   VPSITPSSSDPSGRVDTWPTKVEKLEKLHSSEMYEMIHNHLALILGPRMGDLASVAQISK  81

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+L  GLD+  + ++Q      + + ++  
Sbjct  82   LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKLLTGGLDESKTSVEQ----PENVTFKAVS  137

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPEV S+  GG+ ++GFG+E+KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEA
Sbjct  138  SHPEVGSFA-GGVSAKGFGSEIKPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEA  196

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFG+PEI ITP+GT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  197  LFGKPEIVITPEGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  254



>gb|KJB53076.1| hypothetical protein B456_008G292100 [Gossypium raimondii]
Length=411

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 169/245 (69%), Positives = 193/245 (79%), Gaps = 19/245 (8%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPAIT  S+NSSG +DT PS++E+  +LHSPEAYEMIQ+HL+LILGNR N + SV QI+K
Sbjct  176  VPAITPSSKNSSGQVDTWPSQEEKFEQLHSPEAYEMIQSHLALILGNRLNDSKSVAQISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV-------GGDssd  484
            LRVGQVYAASVMYGYFLKRVD+RFQLEK MK+LP G D E S I++         GD   
Sbjct  236  LRVGQVYAASVMYGYFLKRVDERFQLEKTMKILPNGSDSEGSSIEKAVREDIRPAGDYLA  295

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             S      H EV SW      S GFG  +KPSRLRTY+MSFDG+TLQR+ATIRSKEA++I
Sbjct  296  VSS-----HLEVSSW------SGGFGNRIKPSRLRTYLMSFDGDTLQRFATIRSKEAVSI  344

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEK TEALFGRPEI +TPQGT+DSSKDELIKISF  LR+LVLEA+TFGSFLWD ES VDS
Sbjct  345  IEKQTEALFGRPEIVLTPQGTVDSSKDELIKISFGGLRKLVLEAITFGSFLWDGESFVDS  404

Query  123  RYHFV  109
            RYHFV
Sbjct  405  RYHFV  409


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER++ALEEILYALVVQKFMDADV
Sbjct  146  EVKANERKRALEEILYALVVQKFMDADV  173



>ref|XP_006374246.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 ref|XP_006374247.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ABK96147.1| unknown [Populus trichocarpa]
 gb|ERP52043.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52044.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=417

 Score =   324 bits (830),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 166/243 (68%), Positives = 193/243 (79%), Gaps = 9/243 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P I   S  SSG +DT PS+DE+L +LHSPEAYEMIQNHL+LILGNR   +++V QI+K
Sbjct  176  IPTIGPSSAESSGQVDTWPSQDEKLEQLHSPEAYEMIQNHLTLILGNRVGDSTAVAQISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDss----dts  478
            LR+GQVYAASVMYGYFLKRVDQRFQLEK MK+LP G+D+ +S I + VG D        S
Sbjct  236  LRIGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNGVDETESDIHKAVGQDVKPGGRGLS  295

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
             ++  SHPE +S   GG+   GFG  +K SRLR YVMSFD ETLQRYATIRSKEA++IIE
Sbjct  296  YQALSSHPEAIS---GGISPGGFGHGLKASRLRNYVMSFDAETLQRYATIRSKEAVSIIE  352

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGRPEI ITPQGTID+SKDE++ IS   L+RL LEAVTFGSFLWDVES VDSRY
Sbjct  353  KHTEALFGRPEIVITPQGTIDTSKDEVVTISLGGLKRLALEAVTFGSFLWDVESYVDSRY  412

Query  117  HFV  109
            HFV
Sbjct  413  HFV  415


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            E KA +RRKALEEILYALVVQKFMDA+V
Sbjct  146  EAKANDRRKALEEILYALVVQKFMDANV  173



>ref|XP_002267281.3| PREDICTED: uncharacterized protein LOC100262899 [Vitis vinifera]
Length=443

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/243 (71%), Positives = 195/243 (80%), Gaps = 7/243 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P I+S S +SS  +DT PS+D +L +LHSPEAYEMIQNHL+LILGNR   ++SV QI+K
Sbjct  200  IPTISSSSSDSSDRVDTWPSQDGKLEQLHSPEAYEMIQNHLALILGNRLGDSTSVAQISK  259

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-----ts  478
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  LD +   +Q+   D         S
Sbjct  260  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPHALDGDKGSVQEALWDKMTPSGSDDS  319

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
            +++  SHPEV SW  GG    GFG  +KPSRLR YVMSFD ETLQRYATIRSKEA++IIE
Sbjct  320  VQTVKSHPEVSSWA-GGFTPGGFGHGIKPSRLRNYVMSFDAETLQRYATIRSKEAVSIIE  378

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGRPEI ITPQGTIDSSKDELIKISF  L+RLVLEAVTFGSFLWDVES VDSRY
Sbjct  379  KHTEALFGRPEIIITPQGTIDSSKDELIKISFGGLKRLVLEAVTFGSFLWDVESFVDSRY  438

Query  117  HFV  109
            HFV
Sbjct  439  HFV  441


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+KALEEILYALVVQKFMDA+V
Sbjct  170  EVKANERKKALEEILYALVVQKFMDANV  197



>ref|XP_010241168.1| PREDICTED: uncharacterized protein LOC104585831 [Nelumbo nucifera]
Length=424

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/247 (68%), Positives = 195/247 (79%), Gaps = 11/247 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +P I S     SG +DT P++DE+L +LHS EAYEMIQNHL+LILGNR  ++ +  QI+K
Sbjct  181  IPTILS--SKPSGRVDTWPNQDEKLEQLHSSEAYEMIQNHLALILGNRVGDSRTVAQISK  238

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV-------GGDssd  484
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP   D++++ I+QV       GG+  +
Sbjct  239  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPYASDEQETDIEQVMAEQTPSGGEGIE  298

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             S ++  +HPEV SW  G  G  GFG   K S+LRTYVMSFD E LQRYATIRSKEA++I
Sbjct  299  ASSQTEQTHPEVSSWL-GNFGPGGFGHGYKSSKLRTYVMSFDAEMLQRYATIRSKEAVSI  357

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITP GTIDSSKDELI+ISF  L+RLVLEAVTFGSFLWDVES VDS
Sbjct  358  IEKHTEALFGRPEIVITPHGTIDSSKDELIRISFGGLKRLVLEAVTFGSFLWDVESYVDS  417

Query  123  RYHFVAH  103
            RYHFVA+
Sbjct  418  RYHFVAN  424


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMD +V
Sbjct  151  EVKATERRKALEEILYALVVQKFMDGNV  178



>gb|KDP30111.1| hypothetical protein JCGZ_18399 [Jatropha curcas]
Length=431

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 196/245 (80%), Gaps = 14/245 (6%)
 Frame = -3

Query  816  PAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKL  640
            P I   S + S  +DT P +DE+L +LHSPEAYEMIQNHL+LILGN+   +++V QI+KL
Sbjct  190  PTIAPSSADESDRVDTWPGQDEKLKQLHSPEAYEMIQNHLALILGNKIGDSTTVAQISKL  249

Query  639  RVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV--------GGDssd  484
            RVGQVYAASVMYGYFLKRVDQRFQLEK+MK+LP  +D+ED  +QQ         GG+ + 
Sbjct  250  RVGQVYAASVMYGYFLKRVDQRFQLEKSMKILPNVMDEEDDNLQQAAMQDMKSSGGEDAF  309

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             ++ S   HPE +S   GG+   GFG  ++ SRLR+YVMSFDGETLQRYATIRSKEA++I
Sbjct  310  EAMSS---HPEGLSA--GGISPGGFGHGVRASRLRSYVMSFDGETLQRYATIRSKEAVSI  364

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITPQGT+DSSKDEL+KISF  L+RLVLEAVTFGSFLWDVES VDS
Sbjct  365  IEKHTEALFGRPEIVITPQGTVDSSKDELMKISFGGLKRLVLEAVTFGSFLWDVESYVDS  424

Query  123  RYHFV  109
            RYHFV
Sbjct  425  RYHFV  429


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+KALEEILYALVVQKFMDA+V
Sbjct  159  EVKANERKKALEEILYALVVQKFMDANV  186



>gb|KHG07714.1| Ribosomal L11 methyltransferase [Gossypium arboreum]
Length=340

 Score =   319 bits (818),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 192/245 (78%), Gaps = 19/245 (8%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPAIT  S++SSG +DT PS++E+  +LHSPEAYEMIQ+HL+LILGNR N + SV QI+K
Sbjct  105  VPAITPSSKDSSGQVDTWPSQEEKFEQLHSPEAYEMIQSHLALILGNRLNDSKSVAQISK  164

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV-------GGDssd  484
            +RVGQVYAASVMYGYFLKRVD+RFQLEK MK+LP G D E S I++         GD   
Sbjct  165  IRVGQVYAASVMYGYFLKRVDERFQLEKTMKILPNGSDSEGSSIEKAIREDIRPAGDYLV  224

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             S      H EV SW      S GFG  +KPSRLRTY+MSFDG+ LQR+ATIRSKEA++I
Sbjct  225  VSS-----HLEVSSW------SGGFGNRIKPSRLRTYLMSFDGDILQRFATIRSKEAVSI  273

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEK TEALFGRPEI +TPQGT+DSSKDELIKISF  L++LVLEA+TFGSFLWD ES VDS
Sbjct  274  IEKQTEALFGRPEIVLTPQGTVDSSKDELIKISFGGLKKLVLEAITFGSFLWDGESFVDS  333

Query  123  RYHFV  109
            RYHFV
Sbjct  334  RYHFV  338



>ref|XP_007036961.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY21462.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=438

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 194/238 (82%), Gaps = 7/238 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPA+T  S + SG +D  PS++++L  LHSPEAYEMIQNHL+LILGNR   ++SV QI+K
Sbjct  185  VPAMTPSSTDPSGRVDMWPSEEDKLELLHSPEAYEMIQNHLALILGNRLGDSTSVAQISK  244

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDssdt----s  478
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP   + E+SG++Q VG D        S
Sbjct  245  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNASNGEESGVEQSVGEDMGTAGLGDS  304

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
             ++  SHPEV SW  GG+   GFG  +KP RLRTYVMSFDGETLQ++A IRSKEA++IIE
Sbjct  305  YKAVSSHPEVSSW-SGGISPGGFGHGIKPCRLRTYVMSFDGETLQKFAAIRSKEAVSIIE  363

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            KHTEALFGRPEI ITPQGT+DSSKDELIKISF+ L+RLVLEAVTFGSFLWDVES VDS
Sbjct  364  KHTEALFGRPEIVITPQGTVDSSKDELIKISFNGLKRLVLEAVTFGSFLWDVESYVDS  421


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+KALEEILYALVVQKFMDA+V
Sbjct  155  EVKANERKKALEEILYALVVQKFMDANV  182



>ref|XP_002885230.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61489.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=426

 Score =   322 bits (825),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 159/226 (70%), Positives = 189/226 (84%), Gaps = 5/226 (2%)
 Frame = -3

Query  783  GSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVM  607
            G +DT P+K E+L RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVM
Sbjct  203  GRVDTWPTKVEKLERLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVM  262

Query  606  YGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGG  427
            YGYFLKRVDQRFQLEK MK+LP GLD+  + ++Q       T+ ++  SHPEV S+  GG
Sbjct  263  YGYFLKRVDQRFQLEKTMKILPGGLDESKTSVEQT---EEKTTYQAVSSHPEVGSFA-GG  318

Query  426  MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  247
            + ++GFG+E+KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+
Sbjct  319  VSAKGFGSEIKPSRLRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPE  378

Query  246  GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            GT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  379  GTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  424



>gb|AAL32564.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13275.1| unknown protein [Arabidopsis thaliana]
Length=421

 Score =   322 bits (824),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 188/226 (83%), Gaps = 4/226 (2%)
 Frame = -3

Query  783  GSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVM  607
            G +DT P+K E+L RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVM
Sbjct  197  GRVDTWPTKVEKLERLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVM  256

Query  606  YGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGG  427
            YGYFLKRVDQRFQLEK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG
Sbjct  257  YGYFLKRVDQRFQLEKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GG  313

Query  426  MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  247
            + ++GFG+E+KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+
Sbjct  314  VSAKGFGSEIKPSRLRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPE  373

Query  246  GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            GT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  374  GTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  419



>ref|NP_566588.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02703.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM20406.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76008.1| uncharacterized protein AT3G17800 [Arabidopsis thaliana]
Length=421

 Score =   322 bits (824),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 188/226 (83%), Gaps = 4/226 (2%)
 Frame = -3

Query  783  GSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVM  607
            G +DT P+K E+L RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVM
Sbjct  197  GRVDTWPTKVEKLERLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVM  256

Query  606  YGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGG  427
            YGYFLKRVDQRFQLEK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG
Sbjct  257  YGYFLKRVDQRFQLEKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GG  313

Query  426  MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  247
            + ++GFG+E+KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+
Sbjct  314  VSAKGFGSEIKPSRLRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPE  373

Query  246  GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            GT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  374  GTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  419



>dbj|BAF01343.1| hypothetical protein [Arabidopsis thaliana]
Length=421

 Score =   322 bits (824),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 188/226 (83%), Gaps = 4/226 (2%)
 Frame = -3

Query  783  GSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVM  607
            G +DT P+K E+L RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVM
Sbjct  197  GRVDTWPTKVEKLERLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVM  256

Query  606  YGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGG  427
            YGYFLKRVDQRFQLEK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG
Sbjct  257  YGYFLKRVDQRFQLEKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GG  313

Query  426  MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  247
            + ++GFG+E+KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+
Sbjct  314  VSAKGFGSEIKPSRLRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPE  373

Query  246  GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            GT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  374  GTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  419



>ref|XP_004137518.1| PREDICTED: uncharacterized protein LOC101203627 [Cucumis sativus]
 ref|XP_004167487.1| PREDICTED: uncharacterized protein LOC101228590 [Cucumis sativus]
Length=422

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/243 (69%), Positives = 186/243 (77%), Gaps = 6/243 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +PAIT  S + SG +DT  + DE L  LHSPEAYEMIQNHLSLILGNR S++ S VQI+K
Sbjct  178  IPAITPSSSDVSGRVDTWAANDENLEHLHSPEAYEMIQNHLSLILGNRVSDSTSVVQISK  237

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd----tsl  475
            LRVGQVYAASVMYGYFLKRVDQRFQLEK +KVLP+  + EDS IQQ  G+        + 
Sbjct  238  LRVGQVYAASVMYGYFLKRVDQRFQLEKTVKVLPKASNSEDSIIQQAIGEDVRPYVGENS  297

Query  474  rsspSHPEVVSWPDGGMGS-RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
                 HPE+ SWPD    S  G    +K SRLR YVM+FDGETLQRYATIRSKEA+ IIE
Sbjct  298  PPVSPHPEIASWPDHDENSFGGVSQSVKASRLRNYVMAFDGETLQRYATIRSKEAVGIIE  357

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGR EI ITPQGTID SKDE +KISF  L+ LVLEAVTFGSFLWDVES VDSRY
Sbjct  358  KHTEALFGRAEIVITPQGTIDPSKDEQLKISFGGLKGLVLEAVTFGSFLWDVESYVDSRY  417

Query  117  HFV  109
            HFV
Sbjct  418  HFV  420


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADVP  824
            EVKA ER++ LEEILYALVVQKFMDA+VP
Sbjct  148  EVKANERKQVLEEILYALVVQKFMDANVP  176



>ref|NP_001078173.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE76009.1| uncharacterized protein AT3G17800 [Arabidopsis thaliana]
Length=427

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 188/226 (83%), Gaps = 4/226 (2%)
 Frame = -3

Query  783  GSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVM  607
            G +DT P+K E+L RLHSPE YEMI NHL+LILG+R  + NS  QI+KLRVGQVYAASVM
Sbjct  203  GRVDTWPTKVEKLERLHSPEMYEMIHNHLALILGSRMGDLNSVAQISKLRVGQVYAASVM  262

Query  606  YGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGG  427
            YGYFLKRVDQRFQLEK MK+LP G D+  + ++Q  G  + T   +  SHPEV ++  GG
Sbjct  263  YGYFLKRVDQRFQLEKTMKILPGGSDESKTSVEQAEG--TATYQAAVSSHPEVGAFA-GG  319

Query  426  MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  247
            + ++GFG+E+KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+
Sbjct  320  VSAKGFGSEIKPSRLRSYVMSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPE  379

Query  246  GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            GT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  380  GTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  425



>emb|CDX95820.1| BnaC05g35710D [Brassica napus]
Length=415

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 194/238 (82%), Gaps = 6/238 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+IT  S + SG +DT P+K E+L +LHS E YEMI NHL+LILG R    +S+ QI+K
Sbjct  181  VPSITPSSSDPSGRVDTWPTKVEKLEKLHSSEMYEMIHNHLALILGPRMGDLASIAQISK  240

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+LP GLD   + ++Q      + + ++  
Sbjct  241  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKILPGGLDDSKTSVEQ----PENVTFKAVS  296

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPEV S+  GG+ ++GFG+E+KPSRLRTYVMSFD ETLQRYATIRS+E + IIEKHTEA
Sbjct  297  SHPEVGSFA-GGVSAKGFGSEIKPSRLRTYVMSFDSETLQRYATIRSREGVGIIEKHTEA  355

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFG+PEI ITP+GT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  356  LFGKPEIVITPEGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  413



>emb|CDX92162.1| BnaA05g22450D [Brassica napus]
Length=415

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/238 (68%), Positives = 195/238 (82%), Gaps = 6/238 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+IT  S + SG +DT P+K E+L +LHS E YEMI NHL+LILG R    +SV QI+K
Sbjct  181  VPSITPSSSDPSGRVDTWPTKVEKLEKLHSSEMYEMIHNHLALILGPRMGDLASVAQISK  240

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+L  GLD+  + ++Q      + + ++  
Sbjct  241  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKLLTGGLDESKTSVEQ----PENVTFKAVS  296

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPEV S+  GG+ ++GFG+E+KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEA
Sbjct  297  SHPEVGSFA-GGVSAKGFGSEIKPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEA  355

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFG+PEI ITP+GT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  356  LFGKPEIVITPEGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  413



>ref|XP_010465837.1| PREDICTED: uncharacterized protein LOC104746127 [Camelina sativa]
Length=410

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/238 (67%), Positives = 192/238 (81%), Gaps = 9/238 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP++T PS + SG +DT P+K E+L +LHSPE YEMI NHL+LILG+R    +SV QI+K
Sbjct  179  VPSVT-PSSHPSGRVDTWPTKVEKLEQLHSPEMYEMIHNHLALILGSRMGDLASVAQISK  237

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP GLD   + + Q           +  
Sbjct  238  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGGLDDSKTSVDQT------ERPSAVS  291

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPEV ++  GG+ ++GFG+E+KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEA
Sbjct  292  SHPEVGAFA-GGVSAKGFGSEIKPSRLRSYVMSFDAETLQRYATIRSREAVRIIEKHTEA  350

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFG+PEI +TP+GT+DSSKDE I ISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  351  LFGKPEIVLTPEGTVDSSKDEQINISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  408



>ref|XP_006297794.1| hypothetical protein CARUB_v10013829mg [Capsella rubella]
 gb|EOA30692.1| hypothetical protein CARUB_v10013829mg [Capsella rubella]
Length=412

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 196/238 (82%), Gaps = 6/238 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP++T PS + SG +DT P+K E+L +LHSPE YEMI NHL+LILG+R    +SV +I+K
Sbjct  178  VPSVT-PSSDPSGRVDTWPTKVEKLEQLHSPEMYEMIHNHLALILGSRIGDLASVARISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP GLD+ ++ + Q  G  +  ++ S  
Sbjct  237  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGGLDESNASVDQTEGPKTYQAVSS--  294

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
             HPEV S+  GG+ ++GFG+E+KPSRLR+YVMSFD ETLQ+YATIRS+EA+ IIEKHTEA
Sbjct  295  -HPEVGSFA-GGVSAKGFGSEIKPSRLRSYVMSFDAETLQKYATIRSREAVKIIEKHTEA  352

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFG+PEI +TP+GT+DSSKDE I ISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  353  LFGKPEIVLTPEGTVDSSKDEQINISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  410



>ref|XP_002317709.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 ref|XP_006376704.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 gb|ABK95039.1| unknown [Populus trichocarpa]
 gb|EEE95929.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
 gb|ERP54501.1| hypothetical protein POPTR_0012s03930g [Populus trichocarpa]
Length=401

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 186/238 (78%), Gaps = 15/238 (6%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +  + S S + SG +DT PS+DE+L RLHSPEAY+MIQNHL+LILGNR   +++V QINK
Sbjct  176  ISTMASSSTDPSGGVDTRPSQDEKLERLHSPEAYDMIQNHLALILGNRMGDSTAVAQINK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LR GQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +D+ ++ I++V             
Sbjct  236  LRAGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNAVDEGETDIRKV-----------VS  284

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE  S    G+   G G  +K SRLR YVMSFDGETLQRYATIRSKEA+++IEKHTEA
Sbjct  285  SHPEAFS---DGVSPGGLGHGLKASRLRNYVMSFDGETLQRYATIRSKEAVSLIEKHTEA  341

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFGRPEI I  QGTIDSSKDEL+KISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  342  LFGRPEIVIALQGTIDSSKDELVKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  399


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  146  EVKANERRKALEEILYALVVQKFMDANV  173



>ref|XP_009145975.1| PREDICTED: uncharacterized protein LOC103869650 [Brassica rapa]
Length=415

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 194/238 (82%), Gaps = 6/238 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+IT  S + SG +DT P+K E+L +LH  E YEMI NHL+LILG R    +SV QI+K
Sbjct  181  VPSITPSSSDPSGRVDTWPTKVEKLEKLHPSEMYEMIHNHLALILGPRMGDLASVAQISK  240

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+L  GLD+  + ++Q      + + ++  
Sbjct  241  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKLLSGGLDESKTSVEQ----PENVTFKAVS  296

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPEV S+  GG+ ++GFG+E+KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEA
Sbjct  297  SHPEVGSFA-GGVSAKGFGSEIKPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEA  355

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFG+PEI ITP+GT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  356  LFGKPEIVITPEGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  413



>ref|NP_175278.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF79715.1|AC020889_23 T1N15.6 [Arabidopsis thaliana]
 gb|AAL57686.1| At1g48450/T1N15_5 [Arabidopsis thaliana]
 gb|AAN41342.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32293.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=423

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 196/245 (80%), Gaps = 8/245 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+ITS S + SG +DT P+ D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+K
Sbjct  177  VPSITSSSADPSGRVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGD-------ssd  484
            L VGQVYAASVMYGYFLKR+DQRFQLEK M++LP G D+ ++ I+Q G D        ++
Sbjct  237  LGVGQVYAASVMYGYFLKRIDQRFQLEKTMRILPGGSDEGETSIEQAGRDVERNFYEEAE  296

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             + ++  S+ +V S+  G   S GF ++MK SRL+TYVMSFDGETLQRYATIRS+E++ I
Sbjct  297  ETYQAVSSNQDVGSFVGGINASGGFSSDMKQSRLKTYVMSFDGETLQRYATIRSRESVGI  356

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITPQGTIDSSKDE IKISF  L+RLVLEAVTFGSFLWDVES VDS
Sbjct  357  IEKHTEALFGRPEIVITPQGTIDSSKDEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDS  416

Query  123  RYHFV  109
            RYHFV
Sbjct  417  RYHFV  421



>ref|XP_009408547.1| PREDICTED: uncharacterized protein LOC103990949 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   316 bits (810),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 187/240 (78%), Gaps = 6/240 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAI   S + SG +D  P +DE+L RLHS EAYEMI+NHL+LILG R S+ N    I+K
Sbjct  176  VPAICQ-SADPSGKVDQWPPEDEKLERLHSAEAYEMIKNHLALILGQRTSDTNLVAPISK  234

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G D E+S I+Q   D S  S++   
Sbjct  235  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKTLPWGSDVEESAIKQAMIDESVPSVQPEI  294

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
             HPEV SW     G  G    MKP RLR+YVMSFD +TLQR+ATIRSKEA +IIEKHTEA
Sbjct  295  PHPEVSSWSSPSFGQGG----MKPCRLRSYVMSFDSDTLQRHATIRSKEAFSIIEKHTEA  350

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFGRPEI ITP+G IDSSKDELIKISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  351  LFGRPEIVITPEGAIDSSKDELIKISFAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  410



>emb|CAL07981.1| hypothetical protein [Platanus x acerifolia]
Length=273

 Score =   311 bits (797),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/240 (67%), Positives = 188/240 (78%), Gaps = 8/240 (3%)
 Frame = -3

Query  819  VPAIT-SPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQIN  646
            +P I+ S + ++S  + T P ++E+L +LHSPEAYEMIQNHL+LILGNR +N+N+  QI+
Sbjct  35   MPTISPSSATDASTQVGTWPGQEEKLKQLHSPEAYEMIQNHLALILGNRVANSNTVAQIS  94

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDss-----dt  481
            KLRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP   D+E S I+Q   +         
Sbjct  95   KLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPFASDEEKSDIEQSVAEEMRPGGGKA  154

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
            S  +  +HPEV S P G     GFG  +KPSRLRTYVM+FD ETLQ YATIRSKEA+ II
Sbjct  155  SAYAEQTHPEVSSQP-GNFSPGGFGHGIKPSRLRTYVMAFDAETLQSYATIRSKEAVTII  213

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EKHTEALFGRPEI ITPQGTIDSSKDEL++ISF  L+RLVLEAVTFGSFLWDVES VDSR
Sbjct  214  EKHTEALFGRPEIVITPQGTIDSSKDELVRISFGGLKRLVLEAVTFGSFLWDVESYVDSR  273


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDADV
Sbjct  5    EVKANERRKALEEILYALVVQKFMDADV  32



>gb|KGN64195.1| hypothetical protein Csa_1G042990 [Cucumis sativus]
Length=588

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 168/244 (69%), Positives = 186/244 (76%), Gaps = 6/244 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +PAIT  S + SG +DT  + DE L  LHSPEAYEMIQNHLSLILGNR S++ S VQI+K
Sbjct  344  IPAITPSSSDVSGRVDTWAANDENLEHLHSPEAYEMIQNHLSLILGNRVSDSTSVVQISK  403

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrs--  469
            LRVGQVYAASVMYGYFLKRVDQRFQLEK +KVLP+  + EDS IQQ  G+     +    
Sbjct  404  LRVGQVYAASVMYGYFLKRVDQRFQLEKTVKVLPKASNSEDSIIQQAIGEDVRPYVGENS  463

Query  468  --spSHPEVVSWPDGGMGS-RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
                 HPE+ SWPD    S  G    +K SRLR YVM+FDGETLQRYATIRSKEA+ IIE
Sbjct  464  PPVSPHPEIASWPDHDENSFGGVSQSVKASRLRNYVMAFDGETLQRYATIRSKEAVGIIE  523

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGR EI ITPQGTID SKDE +KISF  L+ LVLEAVTFGSFLWDVES VDSRY
Sbjct  524  KHTEALFGRAEIVITPQGTIDPSKDEQLKISFGGLKGLVLEAVTFGSFLWDVESYVDSRY  583

Query  117  HFVA  106
            HFV 
Sbjct  584  HFVV  587


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADVP  824
            EVKA ER++ LEEILYALVVQKFMDA+VP
Sbjct  314  EVKANERKQVLEEILYALVVQKFMDANVP  342



>ref|XP_009408539.1| PREDICTED: uncharacterized protein LOC103990949 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=413

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 187/240 (78%), Gaps = 6/240 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAI   S + SG +D  P +DE+L RLHS EAYEMI+NHL+LILG R S+ N    I+K
Sbjct  179  VPAICQ-SADPSGKVDQWPPEDEKLERLHSAEAYEMIKNHLALILGQRTSDTNLVAPISK  237

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G D E+S I+Q   D S  S++   
Sbjct  238  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKTLPWGSDVEESAIKQAMIDESVPSVQPEI  297

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
             HPEV SW     G  G    MKP RLR+YVMSFD +TLQR+ATIRSKEA +IIEKHTEA
Sbjct  298  PHPEVSSWSSPSFGQGG----MKPCRLRSYVMSFDSDTLQRHATIRSKEAFSIIEKHTEA  353

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFGRPEI ITP+G IDSSKDELIKISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  354  LFGRPEIVITPEGAIDSSKDELIKISFAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  413



>ref|XP_002894114.1| hypothetical protein ARALYDRAFT_473985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70373.1| hypothetical protein ARALYDRAFT_473985 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 197/245 (80%), Gaps = 8/245 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+ITS S + SG +DT P+ D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+K
Sbjct  180  VPSITSSSADPSGRVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISK  239

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sd  484
            L VGQVYAASVMYGYFLKR+DQRFQLEK+M++LP G  + ++ I+Q G ++       ++
Sbjct  240  LGVGQVYAASVMYGYFLKRIDQRFQLEKSMRILPGGSYEGETSIEQAGRETERSFYEEAE  299

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             + ++  S+ EV S+  G   S GF ++MK SRL+TYVMSFDGETLQRYATIRS+EA+ I
Sbjct  300  ETYQAVSSNQEVGSFVGGINASGGFSSDMKQSRLKTYVMSFDGETLQRYATIRSREAVGI  359

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITPQGTIDSSKDE IKISF  L+RLVLEAVTFGSFLWDVES VDS
Sbjct  360  IEKHTEALFGRPEIVITPQGTIDSSKDEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDS  419

Query  123  RYHFV  109
            RYHFV
Sbjct  420  RYHFV  424



>emb|CDX75937.1| BnaC03g40200D [Brassica napus]
Length=414

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 190/240 (79%), Gaps = 12/240 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +P+IT  S + SG +DT P+K E+L +LHSPE YEMI NHL+LILG+R  +  S  QI+K
Sbjct  182  IPSITPSSSDPSGRVDTWPNKVEKLEQLHSPEMYEMIHNHLALILGSRIGDLTSVAQISK  241

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ--GLDKEDSGIQQVGGDssdtslrs  469
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP   G D+  S ++Q            
Sbjct  242  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKLLPGSGGADESKSSVEQ--------PEDV  293

Query  468  spSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  289
            +  HPEV S+  GG+ ++GFG+E+KPSRLRTYVMSFD ETLQRYATIRS+EA+ I+EKHT
Sbjct  294  TSIHPEVGSFA-GGVSAKGFGSEIKPSRLRTYVMSFDSETLQRYATIRSREAVGIVEKHT  352

Query  288  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            EALFG+PEI ITPQGT+DSSK+E IKISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  353  EALFGKPEIVITPQGTVDSSKEEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  412



>ref|XP_010461662.1| PREDICTED: uncharacterized protein LOC104742359 isoform X1 [Camelina 
sativa]
 ref|XP_010461663.1| PREDICTED: uncharacterized protein LOC104742359 isoform X2 [Camelina 
sativa]
 ref|XP_010461664.1| PREDICTED: uncharacterized protein LOC104742359 isoform X3 [Camelina 
sativa]
Length=428

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 195/245 (80%), Gaps = 8/245 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+ITS S + SG +DT P+ D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+K
Sbjct  182  VPSITSSSADPSGRVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISK  241

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sd  484
            L VGQVYAASVMYGYFLKR+DQRFQLEK M++LP G  + ++ I+Q G ++       ++
Sbjct  242  LGVGQVYAASVMYGYFLKRIDQRFQLEKTMRILPGGSYEGETSIEQAGRETERSFYEEAE  301

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             + ++  S+ EV S+  G   S GF +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ I
Sbjct  302  ETYQAVSSNQEVGSFVGGINASGGFSSEMNQSRLKTYVMSFDGETLQRYATIRSREAVGI  361

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITPQGTIDSSKDE IKISF  LRRLVLEAVTFGSFLWDVES VDS
Sbjct  362  IEKHTEALFGRPEILITPQGTIDSSKDEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDS  421

Query  123  RYHFV  109
            RYHFV
Sbjct  422  RYHFV  426



>ref|XP_010500371.1| PREDICTED: uncharacterized protein LOC104777762 [Camelina sativa]
Length=429

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 195/245 (80%), Gaps = 8/245 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+ITS S + SG +DT P+ D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+K
Sbjct  183  VPSITSSSADPSGRVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLAAVAQISK  242

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sd  484
            L VGQVYAASVMYGYFLKR+DQRFQLEK M++LP G  + ++ I+Q G ++       ++
Sbjct  243  LGVGQVYAASVMYGYFLKRIDQRFQLEKTMRILPGGSYEGETSIEQAGRETERSFYEEAE  302

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             + ++  S+ EV S+  G   S GF +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ I
Sbjct  303  ETYQAVSSNQEVGSFVGGINASGGFSSEMNQSRLKTYVMSFDGETLQRYATIRSREAVGI  362

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITPQGTIDSSKDE IKISF  LRRLVLEAVTFGSFLWDVES VDS
Sbjct  363  IEKHTEALFGRPEILITPQGTIDSSKDEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDS  422

Query  123  RYHFV  109
            RYHFV
Sbjct  423  RYHFV  427



>dbj|BAJ34170.1| unnamed protein product [Thellungiella halophila]
Length=419

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/239 (69%), Positives = 196/239 (82%), Gaps = 9/239 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P+I SPS + SG +DT P+K E+L RLHSPE YEMI NHL+LILG+R    SSV QI+K
Sbjct  186  IPSI-SPS-DPSGRVDTWPTKVEKLERLHSPEMYEMIHNHLALILGSRMGDLSSVAQISK  243

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGL-DKEDSGIQQVGGDssdtslrss  466
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP G  D+  + ++Q      D + ++ 
Sbjct  244  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGGSSDESKTSVEQ----PEDMTYKAV  299

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
             SHPEV S+  GG+ ++GFG+E+KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTE
Sbjct  300  SSHPEVGSFA-GGVSAKGFGSEIKPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTE  358

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ALFG+PEI ITPQGT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  359  ALFGKPEIVITPQGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  417



>ref|XP_002533448.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28932.1| conserved hypothetical protein [Ricinus communis]
Length=392

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/240 (67%), Positives = 185/240 (77%), Gaps = 24/240 (10%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+I   S   S  +D  P +DE+L RLHSPEAYEMIQNHL+LILGNR   +++V QI+K
Sbjct  176  VPSIAPASAEPSDPVDMWPRQDEKLERLHSPEAYEMIQNHLALILGNRVGDSTTVAQISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK+LP  +D+ D+                  
Sbjct  236  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKILPSAVDEGDNN-----------------  278

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
                 V+W  G + + GFG  +K SRLR+YVMSFDGETLQRYATIRSKEA++IIEKHTEA
Sbjct  279  -----VAW-SGDVSAGGFGHGIKASRLRSYVMSFDGETLQRYATIRSKEAVSIIEKHTEA  332

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFGRPEI ITPQGT+DSSKDELIKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV +
Sbjct  333  LFGRPEIIITPQGTVDSSKDELIKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFVTN  392


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA+V
Sbjct  146  EVKANERRKALEEILYALVVQKFMDANV  173



>ref|XP_011003767.1| PREDICTED: uncharacterized protein LOC105110429 [Populus euphratica]
Length=401

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/238 (67%), Positives = 186/238 (78%), Gaps = 15/238 (6%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +  I S S++ SG ++T PS+DE+L RLHSPEAY+MIQNHL+LILGNR   +++V QINK
Sbjct  176  ISTIASSSKDPSGGLNTRPSQDEKLERLHSPEAYDMIQNHLALILGNRMGDSTAVAQINK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LR GQVYAASVMYGYFLKRVDQRFQLEK MK+LP  +D+ ++ I++V             
Sbjct  236  LRAGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNAVDEGETDIRKV-----------VS  284

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE  S    G+   G G  +K SRLR YVMSFDGETLQRYATIRSKEA+++IEKHTEA
Sbjct  285  SHPEAFS---DGISPGGSGHGLKASRLRNYVMSFDGETLQRYATIRSKEAVSLIEKHTEA  341

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFGRPEI I  QGT DSSKDEL+KISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  342  LFGRPEIVIALQGTTDSSKDELVKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  399


 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA++
Sbjct  146  EVKANERRKALEEILYALVVQKFMDANI  173



>gb|KFK39108.1| hypothetical protein AALP_AA3G202000 [Arabis alpina]
Length=418

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 194/238 (82%), Gaps = 8/238 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P+I SPS + SG +DT P+K E+L RLHS E YEMI NHL+LILG+R    +SV +I+K
Sbjct  186  IPSI-SPS-DPSGRVDTWPTKVEKLERLHSTEMYEMIHNHLALILGSRMGDLTSVAEISK  243

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP GLD   + ++Q      + + ++  
Sbjct  244  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGGLDDSKTSVEQA----EEVTKKTVS  299

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPEV S+  GG+  +GFG+E+KPSRLRTYVMSFDGETLQ+YATIRS+EA+ IIEKHTEA
Sbjct  300  SHPEVGSFA-GGVSPKGFGSEIKPSRLRTYVMSFDGETLQKYATIRSREAVGIIEKHTEA  358

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFG+PEI I+P GT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  359  LFGKPEIVISPDGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  416



>ref|XP_010479269.1| PREDICTED: uncharacterized protein LOC104758146 [Camelina sativa]
Length=429

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 194/245 (79%), Gaps = 8/245 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+ITS S + SG +DT P+ D +L RLHSPE YEMIQNHLS+IL NR++  + V QI+K
Sbjct  183  VPSITSSSADPSGRVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLTGVAQISK  242

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sd  484
            L VGQVYAASVMYGYFLKR+DQRFQLEK M++LP G  + ++ I+Q G ++       ++
Sbjct  243  LGVGQVYAASVMYGYFLKRIDQRFQLEKTMRILPGGSYEGETSIEQAGRETERSFYEEAE  302

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             + ++  S+ EV S+  G   S GF +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ I
Sbjct  303  ETYQAVSSNQEVGSFVGGINASGGFSSEMNQSRLKTYVMSFDGETLQRYATIRSREAVGI  362

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITPQGTIDSSKDE IKISF  LRRLVLEAVTFGSFLWDVES VDS
Sbjct  363  IEKHTEALFGRPEILITPQGTIDSSKDEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDS  422

Query  123  RYHFV  109
            RYHFV
Sbjct  423  RYHFV  427



>ref|XP_011464472.1| PREDICTED: uncharacterized protein LOC101299089 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=412

 Score =   314 bits (804),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 167/241 (69%), Positives = 193/241 (80%), Gaps = 3/241 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+I   + + SG +D  PS+D++L RLHSPEAYEMIQNHLSLILGNR + ++S+ QI+K
Sbjct  173  VPSIAPAASDPSGRVDAWPSQDDKLERLHSPEAYEMIQNHLSLILGNRLDDSTSLAQISK  232

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDssdtslrss  466
            L+VGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  L  EDS I++ VG D     + +S
Sbjct  233  LKVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGSLGGEDSDIEKAVGEDKRLGGVDNS  292

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
             SHPEV SW  G          +KPSRLRTYVMS DGETLQRYATIRS+EA++IIEKHTE
Sbjct  293  ASHPEVSSWSGGLGSGGFGNL-IKPSRLRTYVMSVDGETLQRYATIRSREAVSIIEKHTE  351

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  106
            ALFGRP+I ITPQGT+DSS DE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV 
Sbjct  352  ALFGRPDIVITPQGTVDSSNDEHIKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFVT  411

Query  105  H  103
            +
Sbjct  412  N  412


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+KALEEILYALVVQKFMDA+V
Sbjct  143  EVKANERKKALEEILYALVVQKFMDANV  170



>ref|XP_004299503.1| PREDICTED: uncharacterized protein LOC101299089 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=413

 Score =   314 bits (804),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 167/241 (69%), Positives = 193/241 (80%), Gaps = 3/241 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+I   + + SG +D  PS+D++L RLHSPEAYEMIQNHLSLILGNR + ++S+ QI+K
Sbjct  174  VPSIAPAASDPSGRVDAWPSQDDKLERLHSPEAYEMIQNHLSLILGNRLDDSTSLAQISK  233

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDssdtslrss  466
            L+VGQVYAASVMYGYFLKRVDQRFQLEK MK+LP  L  EDS I++ VG D     + +S
Sbjct  234  LKVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGSLGGEDSDIEKAVGEDKRLGGVDNS  293

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
             SHPEV SW  G          +KPSRLRTYVMS DGETLQRYATIRS+EA++IIEKHTE
Sbjct  294  ASHPEVSSWSGGLGSGGFGNL-IKPSRLRTYVMSVDGETLQRYATIRSREAVSIIEKHTE  352

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  106
            ALFGRP+I ITPQGT+DSS DE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV 
Sbjct  353  ALFGRPDIVITPQGTVDSSNDEHIKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFVT  412

Query  105  H  103
            +
Sbjct  413  N  413


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+KALEEILYALVVQKFMDA+V
Sbjct  144  EVKANERKKALEEILYALVVQKFMDANV  171



>ref|XP_006406690.1| hypothetical protein EUTSA_v10020677mg [Eutrema salsugineum]
 gb|ESQ48143.1| hypothetical protein EUTSA_v10020677mg [Eutrema salsugineum]
Length=466

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 166/239 (69%), Positives = 196/239 (82%), Gaps = 9/239 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P+I SPS + SG +DT P+K E+L RLHSPE YEMI NHL+LILG+R    SSV QI+K
Sbjct  233  IPSI-SPS-DPSGRVDTWPTKVEKLERLHSPEMYEMIHNHLALILGSRMGDLSSVAQISK  290

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGL-DKEDSGIQQVGGDssdtslrss  466
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP G  D+  + ++Q      D + ++ 
Sbjct  291  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGGSSDESKTSVEQ----PEDMTYKAV  346

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
             SHPEV S+  GG+ ++GFG+E+KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTE
Sbjct  347  SSHPEVGSFA-GGVSAKGFGSEIKPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTE  405

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ALFG+PEI ITPQGT+DSSKDE IKISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  406  ALFGKPEIVITPQGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  464



>ref|XP_009414790.1| PREDICTED: uncharacterized protein LOC103995816 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=407

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 184/240 (77%), Gaps = 2/240 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAI S S + S  +D  P +DE+L RLHSPEAYEMI+NHL+LILG R S++NS   I+K
Sbjct  169  VPAI-SQSTDPSSRVDHWPPQDEKLERLHSPEAYEMIKNHLALILGQRLSDSNSVAPISK  227

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LR+GQVYAASVMYGYFLKRVDQRFQLEK+MK LP G DKE+  I+Q   D S     S  
Sbjct  228  LRIGQVYAASVMYGYFLKRVDQRFQLEKSMKTLPWGSDKEEIAIKQAMPDESRPFTESRI  287

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            S+PE+ SW   G      G   K S LR+YVMSFD +TLQRY TIRSKEA  IIEKHTEA
Sbjct  288  SNPELPSWSSPGFNKGAVGNGAKSSLLRSYVMSFDSDTLQRYVTIRSKEAFTIIEKHTEA  347

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFGRPEI ITPQGTIDSSKDELIKISF  LRRL+LEA+TFGSFLWDVE  VDSRYHFV +
Sbjct  348  LFGRPEIVITPQGTIDSSKDELIKISFGGLRRLILEAITFGSFLWDVEGYVDSRYHFVTN  407



>ref|XP_009414789.1| PREDICTED: uncharacterized protein LOC103995816 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=416

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 184/240 (77%), Gaps = 2/240 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VPAI S S + S  +D  P +DE+L RLHSPEAYEMI+NHL+LILG R S++NS   I+K
Sbjct  178  VPAI-SQSTDPSSRVDHWPPQDEKLERLHSPEAYEMIKNHLALILGQRLSDSNSVAPISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LR+GQVYAASVMYGYFLKRVDQRFQLEK+MK LP G DKE+  I+Q   D S     S  
Sbjct  237  LRIGQVYAASVMYGYFLKRVDQRFQLEKSMKTLPWGSDKEEIAIKQAMPDESRPFTESRI  296

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            S+PE+ SW   G      G   K S LR+YVMSFD +TLQRY TIRSKEA  IIEKHTEA
Sbjct  297  SNPELPSWSSPGFNKGAVGNGAKSSLLRSYVMSFDSDTLQRYVTIRSKEAFTIIEKHTEA  356

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFGRPEI ITPQGTIDSSKDELIKISF  LRRL+LEA+TFGSFLWDVE  VDSRYHFV +
Sbjct  357  LFGRPEIVITPQGTIDSSKDELIKISFGGLRRLILEAITFGSFLWDVEGYVDSRYHFVTN  416



>ref|XP_006306266.1| hypothetical protein CARUB_v10012116mg [Capsella rubella]
 gb|EOA39164.1| hypothetical protein CARUB_v10012116mg [Capsella rubella]
Length=421

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 194/245 (79%), Gaps = 8/245 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+ITS S + SG +DT P+ D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+K
Sbjct  175  VPSITSSSADPSGRVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISK  234

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sd  484
            L VGQVYAASVMYGYFLKR+DQRFQLEK M++LP G    ++ I+Q G ++       ++
Sbjct  235  LGVGQVYAASVMYGYFLKRIDQRFQLEKTMRILPGGSYDGETSIEQAGPETERSFYEEAE  294

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             + ++  S+ EV S+  G   S GF +E+  SRL+TYVMSFDGETLQRYATIRS+EA+ I
Sbjct  295  ETYQAVSSNQEVGSFVGGINASGGFSSEINQSRLKTYVMSFDGETLQRYATIRSREAVGI  354

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITPQGTIDSSKDE IKISF  LRRLVLEAVTFGSFLWDVES VDS
Sbjct  355  IEKHTEALFGRPEILITPQGTIDSSKDEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDS  414

Query  123  RYHFV  109
            RYHFV
Sbjct  415  RYHFV  419



>gb|KJB30250.1| hypothetical protein B456_005G134400 [Gossypium raimondii]
Length=422

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 202/243 (83%), Gaps = 8/243 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPAITS S + SG +DT PS++++L ++HS EA+EMIQNH++LILGNR   ++SV QI+K
Sbjct  180  VPAITS-SADPSGRVDTWPSQEDKLEQIHSAEAHEMIQNHVALILGNRLGESTSVAQISK  238

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-----ts  478
            LRVGQVYAASVMYGYFL+RVDQRFQLE+ MKVLP   D + S I+Q  GD +       S
Sbjct  239  LRVGQVYAASVMYGYFLRRVDQRFQLERTMKVLPSASDDDKSSIEQTVGDDTRPSGLGDS  298

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
             +++ SHPEV SW  GG+ S GFG+ +KPSRLRTYVMSFDGETLQRYA+IRSKEA+ IIE
Sbjct  299  YQAASSHPEVSSW-SGGISSGGFGSGIKPSRLRTYVMSFDGETLQRYASIRSKEAVGIIE  357

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGRPEI+ITPQGT+DSS DELIKISF  L+RLVLEAVTFGSFLWDVES VDSRY
Sbjct  358  KHTEALFGRPEIAITPQGTVDSSNDELIKISFGGLKRLVLEAVTFGSFLWDVESFVDSRY  417

Query  117  HFV  109
            HFV
Sbjct  418  HFV  420


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER++ALEEILYALVVQKFMDA++
Sbjct  150  EVKANERKRALEEILYALVVQKFMDANI  177



>ref|XP_006374243.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 ref|XP_006374244.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52040.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
 gb|ERP52041.1| hypothetical protein POPTR_0015s05360g [Populus trichocarpa]
Length=424

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/238 (68%), Positives = 188/238 (79%), Gaps = 9/238 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P I   S  SSG +DT PS+DE+L +LHSPEAYEMIQNHL+LILGNR   +++V QI+K
Sbjct  176  IPTIGPSSAESSGQVDTWPSQDEKLEQLHSPEAYEMIQNHLTLILGNRVGDSTAVAQISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDss----dts  478
            LR+GQVYAASVMYGYFLKRVDQRFQLEK MK+LP G+D+ +S I + VG D        S
Sbjct  236  LRIGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNGVDETESDIHKAVGQDVKPGGRGLS  295

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
             ++  SHPE +S   GG+   GFG  +K SRLR YVMSFD ETLQRYATIRSKEA++IIE
Sbjct  296  YQALSSHPEAIS---GGISPGGFGHGLKASRLRNYVMSFDAETLQRYATIRSKEAVSIIE  352

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            KHTEALFGRPEI ITPQGTID+SKDE++ IS   L+RL LEAVTFGSFLWDVES VDS
Sbjct  353  KHTEALFGRPEIVITPQGTIDTSKDEVVTISLGGLKRLALEAVTFGSFLWDVESYVDS  410


 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            E KA +RRKALEEILYALVVQKFMDA+V
Sbjct  146  EAKANDRRKALEEILYALVVQKFMDANV  173



>ref|XP_008798412.1| PREDICTED: uncharacterized protein LOC103713309 [Phoenix dactylifera]
 ref|XP_008798421.1| PREDICTED: uncharacterized protein LOC103713309 [Phoenix dactylifera]
Length=418

 Score =   312 bits (800),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/240 (68%), Positives = 187/240 (78%), Gaps = 2/240 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            VP + S S + S  +D  P ++E++ RLHSP+AYEMI+NHL+LILG R  ++NS   I+K
Sbjct  180  VPTL-SQSTDPSERVDQWPPEEEKIERLHSPDAYEMIKNHLALILGQRLGDSNSVAPISK  238

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G D+E+  I+Q   D S  S +   
Sbjct  239  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKSLPWGTDEEEDAIKQAMPDESRPSAQIGN  298

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE            GFG  +KP RLR+YVMSFD ETLQRYAT+RSKEA +IIEKHTEA
Sbjct  299  SHPEASLGSSPSFSQGGFGHNVKPCRLRSYVMSFDSETLQRYATVRSKEAFSIIEKHTEA  358

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFGRPEI ITPQGTIDSSKDELIKISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  359  LFGRPEIVITPQGTIDSSKDELIKISFAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  418


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERR+ALEEILYALVVQKFM+ADV
Sbjct  150  EVKAKERRRALEEILYALVVQKFMEADV  177



>ref|XP_008240405.1| PREDICTED: uncharacterized protein LOC103338912 [Prunus mume]
Length=428

 Score =   312 bits (800),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 170/245 (69%), Positives = 202/245 (82%), Gaps = 7/245 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +PA+T  + + SG +DT PS++++L +LHSPEAYEMIQNHL+LILGNR  ++ S  QI+K
Sbjct  185  IPALTPSASDLSGRVDTWPSEEDKLEQLHSPEAYEMIQNHLALILGNRLGDSASLAQISK  244

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDs----sdts  478
            LRVGQVYAASVMYGYFLKRVDQRFQLEK +K+LP  L  EDS +Q+ VG D      + S
Sbjct  245  LRVGQVYAASVMYGYFLKRVDQRFQLEKTVKILPNALGAEDSNVQKSVGEDMRPGGEEES  304

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
            L++  SHPEV S   GG+G+ GFG  +KPSRLRTYVMSFDGETL RYATIRS+EA++IIE
Sbjct  305  LQAGASHPEVTSS-AGGIGAGGFGNGIKPSRLRTYVMSFDGETLHRYATIRSREAVSIIE  363

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGRP+I ITPQGT+DSSKD+ +KISF  LRRLVLEAVTFGSFLWDVES VDSRY
Sbjct  364  KHTEALFGRPDIVITPQGTVDSSKDDHVKISFGGLRRLVLEAVTFGSFLWDVESYVDSRY  423

Query  117  HFVAH  103
            HFV +
Sbjct  424  HFVTN  428


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILY LVVQKFMDA+V
Sbjct  155  EVKATERRKALEEILYTLVVQKFMDANV  182



>ref|XP_007209930.1| hypothetical protein PRUPE_ppa004570mg [Prunus persica]
 gb|EMJ11129.1| hypothetical protein PRUPE_ppa004570mg [Prunus persica]
Length=502

 Score =   314 bits (805),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 165/245 (67%), Positives = 196/245 (80%), Gaps = 7/245 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +PA+T  + + SG +DT PS++++L +LHSPEAYEMIQNHL+LILG+R  ++ S  QI+K
Sbjct  259  IPALTPSASDLSGRVDTWPSEEDKLEQLHSPEAYEMIQNHLALILGSRLGDSASLAQISK  318

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDs----sdts  478
            LRVGQVYAASVMYGYFLKRVDQRFQLEK +K+LP  L  EDS +Q+ VG D      + S
Sbjct  319  LRVGQVYAASVMYGYFLKRVDQRFQLEKTVKILPNALGAEDSNVQKSVGEDMRPGGEEES  378

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
            L++  SHPEV SW  G          +KPSRLRTYVMSFDGETL RYATIRS+EA++IIE
Sbjct  379  LQAGASHPEVTSWGGGISPGGFGNG-IKPSRLRTYVMSFDGETLHRYATIRSREAVSIIE  437

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KHTEALFGRP+I ITPQGT+DSSKD+ +KISF  LRRLVLEAVTFGSFLWDVES VDSRY
Sbjct  438  KHTEALFGRPDIVITPQGTVDSSKDDHVKISFGGLRRLVLEAVTFGSFLWDVESYVDSRY  497

Query  117  HFVAH  103
            HFV +
Sbjct  498  HFVTN  502


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILY LVVQKFMDA+V
Sbjct  229  EVKATERRKALEEILYTLVVQKFMDANV  256



>ref|XP_010271178.1| PREDICTED: uncharacterized protein LOC104607271 [Nelumbo nucifera]
Length=424

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 165/247 (67%), Positives = 191/247 (77%), Gaps = 11/247 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P I S   + SG +DT P ++++L +LHS EAYEMIQNHL+LILGNR   +S++ QI+K
Sbjct  181  IPTILS--SDPSGPVDTWPDQEKKLEQLHSTEAYEMIQNHLALILGNRVADSSTIAQISK  238

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGD-------ssd  484
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP   D+E    Q V G        SS+
Sbjct  239  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPYASDEESDTEQAVAGQMNPSGNKSSE  298

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             S  +  +HPEV S P G   S GFG  +K SRLRTYVMSFD +TLQRYATIRSKE ++I
Sbjct  299  ASSHAEQTHPEVSSSP-GNFSSGGFGYGVKSSRLRTYVMSFDADTLQRYATIRSKEGVSI  357

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITPQGT+DSSKDE I+ISF  L+RLVLEAVTFGSFLWDVES VD 
Sbjct  358  IEKHTEALFGRPEIVITPQGTVDSSKDEQIRISFGGLKRLVLEAVTFGSFLWDVESYVDL  417

Query  123  RYHFVAH  103
            RYHFVA+
Sbjct  418  RYHFVAN  424


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYAL+VQKFMDA+V
Sbjct  151  EVKANERRKALEEILYALIVQKFMDANV  178



>ref|XP_006393405.1| hypothetical protein EUTSA_v10011507mg [Eutrema salsugineum]
 gb|ESQ30691.1| hypothetical protein EUTSA_v10011507mg [Eutrema salsugineum]
Length=426

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/245 (67%), Positives = 196/245 (80%), Gaps = 8/245 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+I+S S++ SG +DT P++D +L RLHSPE YEMIQNHLS+IL NR    ++V QI+K
Sbjct  180  VPSISSSSKDPSGRVDTWPAQDGELERLHSPEVYEMIQNHLSIILKNRVGDLTTVAQISK  239

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sd  484
            L VGQVYAASVMYGYFLKR+DQRFQLEK MK+LP G D+ ++ I+Q G ++       ++
Sbjct  240  LGVGQVYAASVMYGYFLKRIDQRFQLEKTMKILPGGSDEGETSIEQAGRETERSFYEEAE  299

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             + ++  S+ EV S+  G   S GF +E K SRL+TYVMSFDGETLQRYATIRS+EA+ I
Sbjct  300  ETYQAVSSNREVGSFVGGINASGGFSSETKQSRLKTYVMSFDGETLQRYATIRSREAVGI  359

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITPQGTIDSSKDE IKISF  L+RLVLEAVTFGSFLWDVES VDS
Sbjct  360  IEKHTEALFGRPEIVITPQGTIDSSKDEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDS  419

Query  123  RYHFV  109
            RYHFV
Sbjct  420  RYHFV  424



>ref|XP_010936872.1| PREDICTED: uncharacterized protein LOC105056391 [Elaeis guineensis]
Length=418

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/240 (67%), Positives = 187/240 (78%), Gaps = 2/240 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +PA+ S S + SG +D    ++E+L RLHSP+AYEMI++HL+LILG R  ++NS   I+K
Sbjct  180  IPAL-SQSTDPSGRVDRWAPEEEKLERLHSPDAYEMIKSHLALILGQRLGDSNSVAPISK  238

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G D+E+  I+Q   D S  S +   
Sbjct  239  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKSLPWGTDEEEDAIKQAMPDESRPSAQIGN  298

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE             FG  +KP RLR+YVMSFD ETLQRYAT+RSKEA +IIEKHTEA
Sbjct  299  SHPEASLESSPSFSQGAFGHSIKPCRLRSYVMSFDSETLQRYATVRSKEAFSIIEKHTEA  358

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFGRPEI ITPQGTIDSSKDELIKISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  359  LFGRPEIVITPQGTIDSSKDELIKISFAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  418


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERR+ALEEILYALVVQKFM+ADV
Sbjct  150  EVKAEERRRALEEILYALVVQKFMEADV  177



>ref|XP_010487675.1| PREDICTED: uncharacterized protein LOC104765624 [Camelina sativa]
Length=409

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 183/226 (81%), Gaps = 8/226 (4%)
 Frame = -3

Query  783  GSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVM  607
            G +DT P+K ++L +LHSPE YEMI NHL+LILG+R    +SV QI+KLRVGQVYAASVM
Sbjct  189  GRVDTWPTKVDKLEQLHSPEMYEMIHNHLALILGSRMGDLASVAQISKLRVGQVYAASVM  248

Query  606  YGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGG  427
            YGYFLKRVDQRFQLEK MK+LP GLD   + + Q           +  SHPEV ++  GG
Sbjct  249  YGYFLKRVDQRFQLEKTMKILPGGLDDSKTSVDQT------ERPSAVSSHPEVGAFA-GG  301

Query  426  MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQ  247
            + ++GFG+E+KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI +TP+
Sbjct  302  VSAKGFGSEIKPSRLRSYVMSFDAETLQRYATIRSREAVRIIEKHTEALFGKPEIVLTPE  361

Query  246  GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            GT+DSSKDE I ISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  362  GTVDSSKDEQINISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  407



>ref|XP_010549033.1| PREDICTED: uncharacterized protein LOC104820333 isoform X1 [Tarenaya 
hassleriana]
Length=413

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/239 (71%), Positives = 195/239 (82%), Gaps = 4/239 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+I S S + SG +DT P+++E+L RLHSPEAYEMIQNHL++ILGNR    SSV QI+K
Sbjct  175  VPSIKS-SSDPSGRVDTWPAQEERLERLHSPEAYEMIQNHLTIILGNRLGDPSSVAQISK  233

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVG-GDssdtslrss  466
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP G D+ +  I+Q   G    ++    
Sbjct  234  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGGSDEGEGSIEQSAPGTERISNGDGG  293

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
              HPEV S+  GG+   GFG+ +KPSRLRTYVMSFDGETLQRYATIRS+EA+ IIEKHTE
Sbjct  294  TYHPEVGSF-AGGISGGGFGSGLKPSRLRTYVMSFDGETLQRYATIRSREAVGIIEKHTE  352

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ALFGRPEI ITP+GT+DSS+DE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  353  ALFGRPEIMITPEGTVDSSRDEHIKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  411



>ref|XP_010549034.1| PREDICTED: uncharacterized protein LOC104820333 isoform X2 [Tarenaya 
hassleriana]
Length=412

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 169/239 (71%), Positives = 195/239 (82%), Gaps = 4/239 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+I S S + SG +DT P+++E+L RLHSPEAYEMIQNHL++ILGNR    SSV QI+K
Sbjct  174  VPSIKS-SSDPSGRVDTWPAQEERLERLHSPEAYEMIQNHLTIILGNRLGDPSSVAQISK  232

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVG-GDssdtslrss  466
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP G D+ +  I+Q   G    ++    
Sbjct  233  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGGSDEGEGSIEQSAPGTERISNGDGG  292

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
              HPEV S+  GG+   GFG+ +KPSRLRTYVMSFDGETLQRYATIRS+EA+ IIEKHTE
Sbjct  293  TYHPEVGSF-AGGISGGGFGSGLKPSRLRTYVMSFDGETLQRYATIRSREAVGIIEKHTE  351

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ALFGRPEI ITP+GT+DSS+DE IKISF  L+RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  352  ALFGRPEIMITPEGTVDSSRDEHIKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV  410



>emb|CDX82345.1| BnaA03g34760D [Brassica napus]
Length=406

 Score =   308 bits (789),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 157/238 (66%), Positives = 185/238 (78%), Gaps = 15/238 (6%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +P+IT PS + SG +DT P+K E+L +LHSPE YEMI NHL+LILG+R  +  S  QI+K
Sbjct  181  IPSIT-PSSDPSGRVDTWPTKVEKLEQLHSPEMYEMIHNHLALILGSRIGDLTSVAQISK  239

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASV+YGYFLKRVDQRFQLEK MK+LP     E+   + V             
Sbjct  240  LRVGQVYAASVIYGYFLKRVDQRFQLEKTMKLLPGSGGAEEKQPEDVSS-----------  288

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
             HPEV S+  GG+ ++GFG+E+KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEA
Sbjct  289  -HPEVGSFA-GGVSAKGFGSEIKPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEA  346

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFG+PEI ITPQG +DSS DE IKISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  347  LFGKPEIVITPQGIVDSSNDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  404



>emb|CDY58279.1| BnaCnng32840D [Brassica napus]
Length=425

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 193/245 (79%), Gaps = 9/245 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+ITS S + SG +DT P++D +L +LHSPE YEMIQNHLS+IL NR    S+V QI+K
Sbjct  180  VPSITSSSTDPSGRVDTWPTQDGELEQLHSPEVYEMIQNHLSIILKNREGDLSTVAQISK  239

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sd  484
            L +GQVYAASVMYGYFLKR+DQRFQLEK MK+LP G D+ ++ I+Q G ++       ++
Sbjct  240  LGIGQVYAASVMYGYFLKRIDQRFQLEKTMKILPGGSDEGETSIEQAGRETQRSFYEEAE  299

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
             + ++  S+ EV S+  G   S G  +E K SRL+TYVMSFDGETLQRYATIRS+EA+ I
Sbjct  300  ETYQAVSSNQEVGSFVGGINASGGSSSETKQSRLKTYVMSFDGETLQRYATIRSREAVGI  359

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKHTEALFGRPEI ITPQG IDSSKDE IKISF  L+RLVLEAVTFGSFLWDVES VDS
Sbjct  360  IEKHTEALFGRPEIVITPQG-IDSSKDEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDS  418

Query  123  RYHFV  109
            RYHFV
Sbjct  419  RYHFV  423


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVK  ERRKALEEILYALVVQKFMDA+V
Sbjct  150  EVKEKERRKALEEILYALVVQKFMDANV  177



>gb|AFK42768.1| unknown [Lotus japonicus]
Length=412

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 188/247 (76%), Gaps = 7/247 (3%)
 Frame = -3

Query  834  LMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV  655
             M   +  I S + + +G +D+ P+ DE+L +LHS EAYEMIQNHLSLILGNR+   +S+
Sbjct  166  FMAANISLIPSITPDPTGRVDSWPNDDEKLKQLHSYEAYEMIQNHLSLILGNRAGDLTSI  225

Query  654  -QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd--  484
             QI+KLRVGQVYAASVMYGYFLKRVDQRFQLEK MKVLP     EDS + +   D +   
Sbjct  226  AQISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKVLPNA--AEDSSVHKPVKDDARPG  283

Query  483  --tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  310
               +     SHPE+  W  G +   GFG+ +KP+RLR YVMSFDG+TLQRYATIRSKEA+
Sbjct  284  NGENTSQVMSHPELSPWLGGDVSPGGFGSGIKPTRLRNYVMSFDGDTLQRYATIRSKEAV  343

Query  309  NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            +IIEKHTEALFGRPE +ITP+G IDSSKDE IKISF  L+RLVLEAVTFGSFLWDVES V
Sbjct  344  SIIEKHTEALFGRPEFAITPEGAIDSSKDENIKISFGGLKRLVLEAVTFGSFLWDVESYV  403

Query  129  DSRYHFV  109
            +S YHFV
Sbjct  404  ESSYHFV  410



>ref|XP_009135549.1| PREDICTED: uncharacterized protein LOC103859727 [Brassica rapa]
Length=408

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/238 (65%), Positives = 183/238 (77%), Gaps = 14/238 (6%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +P+IT  S + SG +DT P+K E+L +LHSPE YEMI NHL+LILG+R  +  S  Q +K
Sbjct  182  IPSITPSSSDPSGRVDTWPTKVEKLEQLHSPEMYEMIHNHLALILGSRIGDLTSVAQTSK  241

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASV+YGYFLKRVDQRFQLEK MK+LP     E+   + V             
Sbjct  242  LRVGQVYAASVIYGYFLKRVDQRFQLEKTMKLLPGSGGAEEKQPEDVSS-----------  290

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
             HPEV S+  GG+ ++GFG+E+KPSRLRTYVMSFD ETLQRYATIRS+EA+ IIEKHTEA
Sbjct  291  -HPEVGSFA-GGVSAKGFGSEIKPSRLRTYVMSFDSETLQRYATIRSREAVGIIEKHTEA  348

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFG+PEI ITPQG +DSS DE IKISF  ++RLVLEAVTFGSFLWDVES VD+RY FV
Sbjct  349  LFGKPEIVITPQGIVDSSNDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDARYQFV  406



>ref|XP_010505920.1| PREDICTED: uncharacterized protein LOC104782624 [Camelina sativa]
Length=409

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 182/224 (81%), Gaps = 8/224 (4%)
 Frame = -3

Query  777  IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYG  601
            +DT P+K ++L +LHSPE YEMI NHL+LILG+R    +SV QI+KLRVGQVYAASVMYG
Sbjct  191  VDTWPTKVDKLEQLHSPEMYEMIHNHLALILGSRMGDLASVAQISKLRVGQVYAASVMYG  250

Query  600  YFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMG  421
            YFLKRVDQRFQLEK MK+LP GLD   + + Q           +  SHPEV ++  GG+ 
Sbjct  251  YFLKRVDQRFQLEKTMKILPGGLDDNKTSVDQT------ERPSAVSSHPEVGAFA-GGVS  303

Query  420  SRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGT  241
            ++GFG+E+KPSRLR+YVMSFD ETLQRYATIRS+EA+ IIEKHTEALFG+P+I +TP+GT
Sbjct  304  AKGFGSEIKPSRLRSYVMSFDAETLQRYATIRSREAVRIIEKHTEALFGKPDIVLTPEGT  363

Query  240  IDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +DSSKDE I ISF  ++RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  364  VDSSKDEQINISFGGMKRLVLEAVTFGSFLWDVESHVDARYHFV  407



>ref|XP_004981974.1| PREDICTED: uncharacterized protein LOC101781190 isoform X2 [Setaria 
italica]
Length=410

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 186/240 (78%), Gaps = 2/240 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDT-LPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA+ S S +SSG +D    + +E+L RLHSPEAYEMI+NHL LILG R    +   I+K
Sbjct  172  VPAL-SHSIDSSGRVDQWAETVEERLQRLHSPEAYEMIENHLDLILGQRQGDATIAAISK  230

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G ++ED  + QV    S  S ++S 
Sbjct  231  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKSLPWGSEEEDDALNQVMTTDSMPSTQASS  290

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE+ SW      + G    +KP RLR+YVMSFD +TLQRYAT+RSKEA  IIEKHTEA
Sbjct  291  SHPEMASWTSPNFSTGGPSQSIKPCRLRSYVMSFDSDTLQRYATVRSKEAFGIIEKHTEA  350

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFG+PE+ ITP+GT+DSSKDE I+ISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  351  LFGKPEVVITPEGTVDSSKDEHIRISFAGLRRLILEAVTFGSFLWDVESFVDSRYHFVTN  410



>ref|XP_004981973.1| PREDICTED: uncharacterized protein LOC101781190 isoform X1 [Setaria 
italica]
Length=411

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 186/240 (78%), Gaps = 2/240 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDT-LPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA+ S S +SSG +D    + +E+L RLHSPEAYEMI+NHL LILG R    +   I+K
Sbjct  173  VPAL-SHSIDSSGRVDQWAETVEERLQRLHSPEAYEMIENHLDLILGQRQGDATIAAISK  231

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G ++ED  + QV    S  S ++S 
Sbjct  232  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKSLPWGSEEEDDALNQVMTTDSMPSTQASS  291

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE+ SW      + G    +KP RLR+YVMSFD +TLQRYAT+RSKEA  IIEKHTEA
Sbjct  292  SHPEMASWTSPNFSTGGPSQSIKPCRLRSYVMSFDSDTLQRYATVRSKEAFGIIEKHTEA  351

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFG+PE+ ITP+GT+DSSKDE I+ISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  352  LFGKPEVVITPEGTVDSSKDEHIRISFAGLRRLILEAVTFGSFLWDVESFVDSRYHFVTN  411



>ref|XP_009145005.1| PREDICTED: uncharacterized protein LOC103868678 [Brassica rapa]
 emb|CDY23684.1| BnaA05g17450D [Brassica napus]
Length=407

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/241 (67%), Positives = 188/241 (78%), Gaps = 9/241 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+ITS    SSG +DT P++D +L +LHSPE YEMIQNHLS+IL NR    S+V QI+K
Sbjct  170  VPSITS----SSGRVDTWPTQDGELEQLHSPEVYEMIQNHLSIILKNREGDLSTVAQISK  225

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            L VGQVYAASVMYGYFLKR+DQRFQLEK MK+LP G D+ ++ I+Q G ++  +    + 
Sbjct  226  LGVGQVYAASVMYGYFLKRIDQRFQLEKTMKILPGGSDEGETSIEQAGRETERSFYEEAE  285

Query  462  SHPEVVSWPD--GGM-GSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
               + VS     GG+  S G  +E K SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKH
Sbjct  286  ETYQAVSSNQEVGGINASGGSSSETKQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKH  345

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            TEALFGRPEI ITPQG IDSSKDE +KISF  L+RLVLEAVTFGSFLWDVES VDSRYHF
Sbjct  346  TEALFGRPEIVITPQG-IDSSKDEHMKISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHF  404

Query  111  V  109
            V
Sbjct  405  V  405


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVK  ERRKALEEILYALVVQKFMDA+V
Sbjct  140  EVKEKERRKALEEILYALVVQKFMDANV  167



>gb|KFK36092.1| hypothetical protein AALP_AA4G076400 [Arabis alpina]
Length=424

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/246 (67%), Positives = 190/246 (77%), Gaps = 9/246 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+I+S S +SSG +DT P+ D +L RLHSPE YEMIQNHLS+IL NR    S+V QI+K
Sbjct  177  VPSISSSSADSSGRVDTWPTVDGELERLHSPEVYEMIQNHLSIILKNRVGDLSTVAQISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrs--  469
            L VGQVYAASVMYGYFLKR+DQRFQLEK MK+LP   D+ ++ I+Q G ++  +      
Sbjct  237  LGVGQVYAASVMYGYFLKRIDQRFQLEKTMKILPGWSDEGETSIEQAGRETERSRSYEEA  296

Query  468  ------spSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAIN  307
                    S+ EV S+  G   S GF ++MK SRL+TYVMSFDGETLQRYATIRS+EA+ 
Sbjct  297  EETYEAVSSNQEVGSFVGGINASGGFSSDMKQSRLKTYVMSFDGETLQRYATIRSREAVG  356

Query  306  IIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVD  127
            IIEKHTEALFGRPEI ITPQGTIDSS DE IKISF  L+RLVLEAVTFGSFLWDVES VD
Sbjct  357  IIEKHTEALFGRPEIMITPQGTIDSSNDEHIKISFHGLKRLVLEAVTFGSFLWDVESHVD  416

Query  126  SRYHFV  109
            SRYHFV
Sbjct  417  SRYHFV  422



>gb|AGV54799.1| hypothetical protein [Phaseolus vulgaris]
Length=409

 Score =   299 bits (765),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 190/248 (77%), Gaps = 8/248 (3%)
 Frame = -3

Query  834  LMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV  655
             M   +  I S + N SG +D+ PS+D +L  LHSPEAYEMIQNHL+LILG+R   ++SV
Sbjct  162  FMDADISLIPSLTPNQSGRVDSWPSEDGKLEELHSPEAYEMIQNHLALILGSRLGDSTSV  221

Query  654  -QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd--  484
             QI+K+RVGQVYAAS+MYGYFLKRV QR+QLEK MK+LP     E++ IQQ   D S   
Sbjct  222  AQISKIRVGQVYAASIMYGYFLKRVVQRYQLEKTMKILPNV--AEENSIQQTVIDESRIS  279

Query  483  --tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  310
               S     SHPE+ + P G + SRGFG   K SRLRTYVMSFD +TLQRYAT+RSKE++
Sbjct  280  GGMSPSHVMSHPEISNLPGGSISSRGFGYGSKVSRLRTYVMSFDTDTLQRYATLRSKESL  339

Query  309  NIIEKHTEALFGRP-EISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESS  133
            ++IEKHTEALFGRP EI +TP+G IDSSKDE IKISF SL+RLVLEAVTFGSFLWDVES 
Sbjct  340  SLIEKHTEALFGRPDEIVVTPEGVIDSSKDESIKISFGSLKRLVLEAVTFGSFLWDVESY  399

Query  132  VDSRYHFV  109
            VD+RYHFV
Sbjct  400  VDARYHFV  407


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+ ALEEILYALVVQKFMDAD+
Sbjct  140  EVKAKERKTALEEILYALVVQKFMDADI  167



>ref|XP_003530975.1| PREDICTED: uncharacterized protein LOC100793300 [Glycine max]
 gb|KHN00132.1| hypothetical protein glysoja_028660 [Glycine soja]
Length=404

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 185/246 (75%), Gaps = 6/246 (2%)
 Frame = -3

Query  834  LMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV  655
             M   +  I S + + SG +D  P++D +L  LHS EAYEMIQNHL+LILGNR+   +S+
Sbjct  159  FMDANISLIPSVTPDLSGKVDLWPNEDGKLELLHSHEAYEMIQNHLALILGNRAGDLTSI  218

Query  654  -QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDss---  487
             +I+K RVGQVYAASVMYGYFL+RVDQRFQLEK MKVLP   +KE+S  Q    ++    
Sbjct  219  AEISKFRVGQVYAASVMYGYFLRRVDQRFQLEKTMKVLPNATEKENSAHQTTMDNARPSI  278

Query  486  dtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAIN  307
            +       SHPEV +WP G +   GFG  +K +RLR YVMSFDG+TLQRYATIRSKEA++
Sbjct  279  EEDTSQVMSHPEVSTWPGGDVRPGGFGYGVKATRLRNYVMSFDGDTLQRYATIRSKEAVS  338

Query  306  IIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVD  127
            IIEKHTEALFGRPEI +TP+G +  SKDE IKISF  L++LVLEAVTFGSFLWDVES VD
Sbjct  339  IIEKHTEALFGRPEIVVTPEGAV--SKDENIKISFGGLKKLVLEAVTFGSFLWDVESYVD  396

Query  126  SRYHFV  109
            SRYHFV
Sbjct  397  SRYHFV  402


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA++
Sbjct  137  EVKANERRKALEEILYALVVQKFMDANI  164



>gb|ACF87802.1| unknown [Zea mays]
 tpg|DAA51042.1| TPA: hypothetical protein ZEAMMB73_539342 [Zea mays]
Length=423

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 183/238 (77%), Gaps = 2/238 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDT-LPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA+ S S + SG +D    + +E+L RLHS EAYEMI+NHL+LILG R    +   I+K
Sbjct  185  VPAL-SRSTDPSGRVDQWAETVEEKLQRLHSHEAYEMIENHLTLILGQRQGDATIAAISK  243

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK LP G ++EDS + QV       S ++S 
Sbjct  244  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKGLPWGSEEEDSALNQVMMTDLMPSAQTSS  303

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE+ SW      + G    +KP RLR+YVMSFD +TLQRYAT+RSKEA  IIEKHTEA
Sbjct  304  SHPEMGSWTAPAFSTGGPSQSIKPCRLRSYVMSFDSDTLQRYATVRSKEAFGIIEKHTEA  363

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFG+PEI ITP+GT+DSSKDE I+ISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV
Sbjct  364  LFGKPEIVITPEGTLDSSKDEHIRISFAGLRRLILEAVTFGSFLWDVESFVDSRYHFV  421



>ref|NP_001143815.1| uncharacterized protein LOC100276591 [Zea mays]
 gb|ACG35630.1| hypothetical protein [Zea mays]
Length=424

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 182/238 (76%), Gaps = 2/238 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDT-LPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA+ S S + SG +D    + +E L RLHS EAYEMI+NHL+LILG R    +   I+K
Sbjct  186  VPAL-SRSTDPSGRVDQWAETVEENLQRLHSHEAYEMIENHLTLILGQRQGDATIAAISK  244

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK LP G ++EDS + QV       S ++S 
Sbjct  245  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKGLPWGSEEEDSALNQVMMTDLMPSAQTSS  304

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE+ SW      + G    +KP RLR+YVMSFD +TLQRYAT+RSKEA  IIEKHTEA
Sbjct  305  SHPEMGSWTAPAFSTGGPSQSIKPCRLRSYVMSFDSDTLQRYATVRSKEAFGIIEKHTEA  364

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFG+PEI ITP+GT+DSSKDE I+ISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV
Sbjct  365  LFGKPEIVITPEGTLDSSKDEHIRISFAGLRRLILEAVTFGSFLWDVESFVDSRYHFV  422



>ref|XP_010687245.1| PREDICTED: uncharacterized protein LOC104901374 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010687246.1| PREDICTED: uncharacterized protein LOC104901374 [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 184/235 (78%), Gaps = 8/235 (3%)
 Frame = -3

Query  792  NSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAA  616
            N++  +D  PS DE+L  +HSPEAYEMIQNHL+LILGNRS  ++SV QI+KLRVGQVYAA
Sbjct  185  NATDRVDVWPSLDEKLVEVHSPEAYEMIQNHLALILGNRSGDSTSVAQISKLRVGQVYAA  244

Query  615  SVMYGYFLKRVDQRFQLEKNMKVLPQGLD-KEDSGIQQVGG-----DssdtslrsspSHP  454
            SVM+GYFLKR+DQRFQLEK MK+LP+ +D +E+  + + GG     DS+      +  HP
Sbjct  245  SVMFGYFLKRIDQRFQLEKAMKILPEQMDARENELMIEDGGSMASEDSTSYYQDHAQVHP  304

Query  453  EVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFG  274
            EV S+   G+   GF   +KPSRLR+YVM+FD ETL +YATIRSKEA+ IIEKHTEALFG
Sbjct  305  EVSSF-TSGINDGGFDQGVKPSRLRSYVMAFDAETLAKYATIRSKEAVTIIEKHTEALFG  363

Query  273  RPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +P+I +T QGTID S+DE IKI FS LRRLVLEAVTFGSFLWDVES VDSR+H V
Sbjct  364  KPDIVLTAQGTIDPSRDEHIKIGFSGLRRLVLEAVTFGSFLWDVESYVDSRHHLV  418



>dbj|BAJ85118.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score =   296 bits (757),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 180/240 (75%), Gaps = 3/240 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDE-QLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA++     SSG +D      E +L RLHS EAYEMI+NHL+LILG R    +   I+K
Sbjct  171  VPALSHSIDTSSGRVDQWAEHVEGKLERLHSHEAYEMIENHLNLILGQRQADGTVAAISK  230

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVD+RFQLEK+MK LP G   ED  + QV    S  S ++  
Sbjct  231  LRVGQVYAASVMYGYFLKRVDKRFQLEKSMKSLPWG--SEDDTLNQVMTTDSRPSDQTYS  288

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPEV SW    + + G G  +KPSRLR+YVMSFD +TLQ YATIRSK A  IIEKHTEA
Sbjct  289  SHPEVESWTSPDLSAGGLGQSVKPSRLRSYVMSFDSDTLQTYATIRSKVAFGIIEKHTEA  348

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFG+PEI ITP+GT+DSSKDE ++ISFS LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  349  LFGKPEIVITPEGTVDSSKDEYVRISFSGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  408



>ref|XP_004503251.1| PREDICTED: uncharacterized protein LOC101489103 [Cicer arietinum]
Length=401

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/241 (65%), Positives = 188/241 (78%), Gaps = 8/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P+IT    + SG +D+ P++  +L +LHS EAYEMIQNHL+LILGNR+   +SV QI+K
Sbjct  163  IPSITP---DPSGRVDSWPNEYGKLEQLHSTEAYEMIQNHLALILGNRAGDLTSVAQISK  219

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs---sdtslr  472
            LRVGQVYAASVMYGYFLKRVDQRFQLEK++K+LP   + E S  Q +  D+   S+    
Sbjct  220  LRVGQVYAASVMYGYFLKRVDQRFQLEKSIKILPNSAE-ESSVHQTIINDARPHSEVDTS  278

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
               SHPEV +W  G +   GFG+ +KP+RLR YVMSFDG+TLQRYATIRSKEA++IIEKH
Sbjct  279  QVKSHPEVSTWLGGDVSPGGFGSGIKPTRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKH  338

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            TEALFGRPE+ ITP+G ID SKDE IKISF  L+RLVLEAVTFG FLWDVES V+SRY F
Sbjct  339  TEALFGRPEMVITPEGAIDRSKDENIKISFGGLKRLVLEAVTFGCFLWDVESYVESRYQF  398

Query  111  V  109
            V
Sbjct  399  V  399


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILY LVVQKFMDA++
Sbjct  133  EVKANERRKALEEILYTLVVQKFMDANI  160



>ref|XP_006580389.1| PREDICTED: uncharacterized protein LOC100817892 isoform X2 [Glycine 
max]
Length=400

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 187/247 (76%), Gaps = 8/247 (3%)
 Frame = -3

Query  834  LMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV  655
             M   +  I S + + SG +D  P++D +L +LHS EAYEMIQNHLSLILGN++   +SV
Sbjct  155  FMDANISLIPSVTPDLSGKVDLWPNEDGKLEQLHSDEAYEMIQNHLSLILGNKAGDLTSV  214

Query  654  -QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDss---  487
             +I+K RVGQVYAASVMYGYFLKRVDQRFQLEK MKVLP   ++E+ G+ +   D++   
Sbjct  215  AEISKFRVGQVYAASVMYGYFLKRVDQRFQLEKTMKVLPNATEEEN-GVHRNTMDNARPS  273

Query  486  -dtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  310
             +       SHPEV +WP G +   GFG  +K +RLR YVMSFDG+TLQRYA IRSKEA+
Sbjct  274  IEQDTSQVMSHPEVSAWPGGDVSPGGFGYGIKATRLRNYVMSFDGDTLQRYAAIRSKEAV  333

Query  309  NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            +IIEKHTEALFGRPEI +TP+G +  SKDE IKISF  L++LVLEAVTFGSFLWDVES V
Sbjct  334  SIIEKHTEALFGRPEIVVTPEGAV--SKDENIKISFGGLKKLVLEAVTFGSFLWDVESYV  391

Query  129  DSRYHFV  109
            DSRYHFV
Sbjct  392  DSRYHFV  398


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA++
Sbjct  133  EVKANERRKALEEILYALVVQKFMDANI  160



>gb|KHN43658.1| hypothetical protein glysoja_027724, partial [Glycine soja]
Length=370

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/251 (65%), Positives = 187/251 (75%), Gaps = 15/251 (6%)
 Frame = -3

Query  834  LMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV  655
             M   +  I S + N SG +D+ PS+D +L  LHSPEAYEMIQNHL+LILGNR   ++SV
Sbjct  124  FMDANISLIPSLTPNHSGQVDSWPSEDGKLEELHSPEAYEMIQNHLALILGNRLGDSTSV  183

Query  654  -QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV--------  502
             QI+K+RVGQVYAAS+MYGYFLKRV QRFQLEK MK+LP G   E++ IQ          
Sbjct  184  AQISKIRVGQVYAASIMYGYFLKRVVQRFQLEKTMKILPNG--AEENSIQHTVVDDSRIS  241

Query  501  GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRS  322
            GGD     +     HPEV + P GG+ S GFG   K SRLRTYVMSFD ETLQRYATIRS
Sbjct  242  GGDGRSHVMS----HPEVSTLPGGGISSGGFGYGSKVSRLRTYVMSFDSETLQRYATIRS  297

Query  321  KEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDV  142
            KEA++IIEKHTEALFGRPEI +TP+G IDS  D+ IKISF  L+RLVLEA+TFGSFLWDV
Sbjct  298  KEALSIIEKHTEALFGRPEIVVTPEGVIDSLTDQSIKISFGGLKRLVLEAITFGSFLWDV  357

Query  141  ESSVDSRYHFV  109
            ES VDSRYHFV
Sbjct  358  ESYVDSRYHFV  368


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERR ALEEILYALVVQKFMDA++
Sbjct  102  EVKAKERRTALEEILYALVVQKFMDANI  129



>ref|XP_003525180.1| PREDICTED: uncharacterized protein LOC100817892 isoform X1 [Glycine 
max]
 gb|KHN10526.1| hypothetical protein glysoja_040681 [Glycine soja]
Length=399

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 187/247 (76%), Gaps = 8/247 (3%)
 Frame = -3

Query  834  LMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV  655
             M   +  I S + + SG +D  P++D +L +LHS EAYEMIQNHLSLILGN++   +SV
Sbjct  154  FMDANISLIPSVTPDLSGKVDLWPNEDGKLEQLHSDEAYEMIQNHLSLILGNKAGDLTSV  213

Query  654  -QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDss---  487
             +I+K RVGQVYAASVMYGYFLKRVDQRFQLEK MKVLP   ++E+ G+ +   D++   
Sbjct  214  AEISKFRVGQVYAASVMYGYFLKRVDQRFQLEKTMKVLPNATEEEN-GVHRNTMDNARPS  272

Query  486  -dtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  310
             +       SHPEV +WP G +   GFG  +K +RLR YVMSFDG+TLQRYA IRSKEA+
Sbjct  273  IEQDTSQVMSHPEVSAWPGGDVSPGGFGYGIKATRLRNYVMSFDGDTLQRYAAIRSKEAV  332

Query  309  NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            +IIEKHTEALFGRPEI +TP+G +  SKDE IKISF  L++LVLEAVTFGSFLWDVES V
Sbjct  333  SIIEKHTEALFGRPEIVVTPEGAV--SKDENIKISFGGLKKLVLEAVTFGSFLWDVESYV  390

Query  129  DSRYHFV  109
            DSRYHFV
Sbjct  391  DSRYHFV  397


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA++
Sbjct  132  EVKANERRKALEEILYALVVQKFMDANI  159



>gb|ABF98565.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAG87500.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 185/240 (77%), Gaps = 3/240 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDT-LPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA+ S S +SSG +D    S + +L ++HS EAYEMI+NHL+LILG R    +   I+K
Sbjct  91   VPAL-SHSISSSGRVDQWAESVEGKLEKMHSQEAYEMIENHLALILGQRQADATVAAISK  149

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G ++ED  + QV    S  S ++S 
Sbjct  150  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKTLPWGSEEEDK-LNQVMTTDSRPSPQTST  208

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE+ SW      + G    +KP RLR+YVMSFD ETLQ YATIRSKEA  IIEKHTEA
Sbjct  209  SHPEMASWTSPNFSAGGPSQSVKPCRLRSYVMSFDSETLQSYATIRSKEAFGIIEKHTEA  268

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFG+PEI ITP+GT+DSSKDE ++ISF+ LRRL+LEAVTFGSFLWDVES VD+RYHFVA+
Sbjct  269  LFGKPEIVITPEGTVDSSKDEHVRISFAGLRRLILEAVTFGSFLWDVESFVDTRYHFVAN  328



>ref|XP_003528983.1| PREDICTED: uncharacterized protein LOC100777314 isoform X1 [Glycine 
max]
 ref|XP_006583474.1| PREDICTED: uncharacterized protein LOC100777314 isoform X2 [Glycine 
max]
 ref|XP_006583475.1| PREDICTED: uncharacterized protein LOC100777314 isoform X3 [Glycine 
max]
 ref|XP_006583476.1| PREDICTED: uncharacterized protein LOC100777314 isoform X4 [Glycine 
max]
 gb|KHN25098.1| hypothetical protein glysoja_027512 [Glycine soja]
Length=408

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 187/247 (76%), Gaps = 7/247 (3%)
 Frame = -3

Query  834  LMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV  655
             M   +  I S + N SG +D+ PS+D +L  LHSPEAYEMIQNHL+LILGNR   ++SV
Sbjct  162  FMDASISLIPSLTPNHSGQVDSWPSEDGKLEELHSPEAYEMIQNHLALILGNRLGDSTSV  221

Query  654  -QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdts  478
             QI+K+RVGQVYAAS+MYGYFLKRV QRFQLE+ MK+LP     E++ IQQ   D S   
Sbjct  222  AQISKIRVGQVYAASIMYGYFLKRVVQRFQLERTMKILPNA--TEENSIQQTVVDDSRIR  279

Query  477  ----lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  310
                     SHPEV + P GG+ S GFG   K SRLRTYVMSFD ETLQRYATIRSKEA+
Sbjct  280  GGEGHSHVMSHPEVSTLPGGGISSGGFGYGSKVSRLRTYVMSFDSETLQRYATIRSKEAL  339

Query  309  NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            +IIEKHTEALFGRPEI +TPQG IDSS D+ IKISF  L+RLVLEA+TFGSFLWDVES V
Sbjct  340  SIIEKHTEALFGRPEIVVTPQGVIDSSTDDNIKISFGGLKRLVLEAITFGSFLWDVESYV  399

Query  129  DSRYHFV  109
            DSRYHFV
Sbjct  400  DSRYHFV  406



>gb|ACU24516.1| unknown [Glycine max]
Length=408

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/247 (66%), Positives = 187/247 (76%), Gaps = 7/247 (3%)
 Frame = -3

Query  834  LMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV  655
             M   +  I S + N SG +D+ PS+D +L  LHSPEAYEMIQNHL+LILGNR   ++SV
Sbjct  162  FMDASISLIPSLTPNHSGQVDSWPSEDGKLEELHSPEAYEMIQNHLALILGNRLGDSTSV  221

Query  654  -QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdts  478
             QI+K+RVGQVYAAS+MYGYFLKRV QRFQLE+ MK+LP     E++ IQQ   D S   
Sbjct  222  AQISKIRVGQVYAASIMYGYFLKRVVQRFQLERTMKILPNA--TEENSIQQTVVDDSRIR  279

Query  477  ----lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  310
                     SHPEV + P GG+ S GFG   K SRLRTYVMSFD ETLQRYATIRSKEA+
Sbjct  280  GGEGHSHVMSHPEVSTLPGGGISSGGFGHGSKVSRLRTYVMSFDSETLQRYATIRSKEAL  339

Query  309  NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            +IIEKHTEALFGRPEI +TPQG IDSS D+ IKISF  L+RLVLEA+TFGSFLWDVES V
Sbjct  340  SIIEKHTEALFGRPEIVVTPQGVIDSSTDDNIKISFGGLKRLVLEAITFGSFLWDVESYV  399

Query  129  DSRYHFV  109
            DSRYHFV
Sbjct  400  DSRYHFV  406



>gb|AFK36208.1| unknown [Medicago truncatula]
Length=421

 Score =   294 bits (753),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 184/242 (76%), Gaps = 10/242 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P+IT    ++SG +D+  ++D +L +LHS EAYEMIQNHL+LILGNR+   SSV QI+K
Sbjct  183  IPSITP---DASGRVDSWSNEDGKLEQLHSNEAYEMIQNHLALILGNRAGELSSVAQISK  239

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDss----dtsl  475
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MKVL    D  DS I Q   D +    +   
Sbjct  240  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKVLTSASD--DSSIHQTIVDDARPGSEVDT  297

Query  474  rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
                SHPEV +WP G +   GFG  +KP+RLR YVMSFDG+TLQRYATIRSKEA++IIEK
Sbjct  298  SQVTSHPEVSTWPGGDVSPGGFGYGIKPTRLRNYVMSFDGDTLQRYATIRSKEAVSIIEK  357

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYH  115
            HTEALFGRP + IT +G ID S+DE IKISF  L RLVLEAVTFG FLWDVES VDSRY 
Sbjct  358  HTEALFGRPGMVITHEGGIDYSEDETIKISFGGLMRLVLEAVTFGCFLWDVESYVDSRYR  417

Query  114  FV  109
            FV
Sbjct  418  FV  419



>gb|ACJ84884.1| unknown [Medicago truncatula]
Length=421

 Score =   294 bits (752),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 184/242 (76%), Gaps = 10/242 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P+IT    ++SG +D+  ++D +L +LHS EAYEMIQNHL+LILGNR+   SSV QI+K
Sbjct  183  IPSITP---DASGRVDSWSNEDGKLEQLHSNEAYEMIQNHLALILGNRAGDLSSVAQISK  239

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDss----dtsl  475
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MKVL    D  DS I Q   D +    +   
Sbjct  240  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKVLTSASD--DSSIHQTIVDDARPGSEVDT  297

Query  474  rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
                SHPEV +WP G +   GFG  +KP+RLR YVMSFDG+TLQRYATIRSKEA++IIEK
Sbjct  298  SQVTSHPEVSTWPGGDVSPGGFGYGIKPTRLRNYVMSFDGDTLQRYATIRSKEAVSIIEK  357

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYH  115
            HTEALFGRP + IT +G ID S+DE IKISF  L RLVLEAVTFG FLWDVES VDSRY 
Sbjct  358  HTEALFGRPGMVITHEGGIDYSEDETIKISFGGLMRLVLEAVTFGCFLWDVESYVDSRYR  417

Query  114  FV  109
            FV
Sbjct  418  FV  419



>gb|EPS73872.1| hypothetical protein M569_00881 [Genlisea aurea]
Length=411

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 193/256 (75%), Gaps = 25/256 (10%)
 Frame = -3

Query  834  LMYLXVPAITS--PSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNAN  664
             M   VP  +S  PS +SS   +T PSKD +L ++HS EAYEMIQNHL+LI+GNR S+++
Sbjct  167  FMAANVPLTSSITPSPDSS---NTWPSKDNELKKIHSAEAYEMIQNHLALIIGNRMSDSD  223

Query  663  SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGI---------  511
            +  QI+KLRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LPQG D + S           
Sbjct  224  AIAQISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPQGGDTKASNSIGEEVIASE  283

Query  510  QQVGGDssdtslrsspSHPEVV-SWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYA  334
            ++ GGD S  + +    HPEV  SW   G     FG  +KPSRLRTYVMS DGET+QRYA
Sbjct  284  RRPGGDESFINSQP---HPEVPPSWSSNG---SPFG--IKPSRLRTYVMSLDGETIQRYA  335

Query  333  TIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDE-LIKISFSSLRRLVLEAVTFGS  157
            TIRSKEAI IIEKHTEALFGRPEI +TP+G++DSSKDE  I I F++L+RLVLEAVTFGS
Sbjct  336  TIRSKEAIGIIEKHTEALFGRPEIVLTPEGSVDSSKDEAAITIRFAALKRLVLEAVTFGS  395

Query  156  FLWDVESSVDSRYHFV  109
            FLWDVES VDSRYHFV
Sbjct  396  FLWDVESFVDSRYHFV  411


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADVPXGS  815
            EVKA ERRK LEEILYALVVQKFM A+VP  S
Sbjct  145  EVKANERRKVLEEILYALVVQKFMAANVPLTS  176



>ref|XP_003534126.1| PREDICTED: uncharacterized protein LOC100802697 isoformX1 [Glycine 
max]
 ref|XP_003534127.1| PREDICTED: uncharacterized protein LOC100802697 isoformX2 [Glycine 
max]
 ref|XP_006587458.1| PREDICTED: uncharacterized protein LOC100802697 isoform X3 [Glycine 
max]
Length=414

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/251 (65%), Positives = 187/251 (75%), Gaps = 15/251 (6%)
 Frame = -3

Query  834  LMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV  655
             M   +  I S + N SG +D+ PS+D +L  LHSPEAYEMIQNHL+LILGNR   ++SV
Sbjct  168  FMDANISLIPSLTPNHSGQVDSWPSEDGKLEELHSPEAYEMIQNHLALILGNRLGDSTSV  227

Query  654  -QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV--------  502
             QI+K+RVGQVYAAS+MYGYFLK V QRFQLEK MK+LP G   E++ IQ          
Sbjct  228  AQISKIRVGQVYAASIMYGYFLKWVVQRFQLEKTMKILPNG--AEENSIQHTVVDDSRIS  285

Query  501  GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRS  322
            GGD     +     HPEV + P GG+ S GFG   K SRLRTYVMSFD ETLQRYATIRS
Sbjct  286  GGDGRSHVMS----HPEVSTLPGGGISSGGFGYGSKVSRLRTYVMSFDSETLQRYATIRS  341

Query  321  KEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDV  142
            KEA++IIEKHTEALFGRPEI +TP+G IDS  DE IKISFS L+RLVLEA+TFGSFLWDV
Sbjct  342  KEALSIIEKHTEALFGRPEIVVTPEGVIDSLTDESIKISFSGLKRLVLEAITFGSFLWDV  401

Query  141  ESSVDSRYHFV  109
            ES VDSRYHFV
Sbjct  402  ESYVDSRYHFV  412


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERR ALEEILYALVVQKFMDA++
Sbjct  146  EVKAKERRTALEEILYALVVQKFMDANI  173



>gb|EAY91660.1| hypothetical protein OsI_13299 [Oryza sativa Indica Group]
 gb|EAZ28380.1| hypothetical protein OsJ_12360 [Oryza sativa Japonica Group]
Length=413

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 185/240 (77%), Gaps = 3/240 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDT-LPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA+ S S +SSG +D    S + +L ++HS EAYEMI+NHL+LILG R    +   I+K
Sbjct  176  VPAL-SHSISSSGRVDQWAESVEGKLEKMHSQEAYEMIENHLALILGQRQADATVAAISK  234

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G ++ED  + QV    S  S ++S 
Sbjct  235  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKTLPWGSEEEDK-LNQVMTTDSRPSPQTST  293

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE+ SW      + G    +KP RLR+YVMSFD ETLQ YATIRSKEA  IIEKHTEA
Sbjct  294  SHPEMASWTSPNFSAGGPSQSVKPCRLRSYVMSFDSETLQSYATIRSKEAFGIIEKHTEA  353

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFG+PEI ITP+GT+DSSKDE ++ISF+ LRRL+LEAVTFGSFLWDVES VD+RYHFVA+
Sbjct  354  LFGKPEIVITPEGTVDSSKDEHVRISFAGLRRLILEAVTFGSFLWDVESFVDTRYHFVAN  413



>gb|KEH26747.1| plant/T1N15-5 protein [Medicago truncatula]
Length=418

 Score =   291 bits (744),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 184/242 (76%), Gaps = 10/242 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+IT+   N SG +D+ PS+D +L  LHSPEAYE+IQ+HL+L+LGNRS  + SV QI+K
Sbjct  180  VPSITA---NPSGQVDSWPSEDGKLEDLHSPEAYELIQSHLALLLGNRSGDSKSVAQISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl----  475
            LRVGQVYAASVMYGYFLKRV QRFQLEK +K LP     E++ I Q   D +  +     
Sbjct  237  LRVGQVYAASVMYGYFLKRVVQRFQLEKTIKNLPDA--AEENTISQTLEDETRNAGLEFP  294

Query  474  rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
                SHPEV +W + G+ S     E+  SRLR+Y+MSFD ETLQRYATIRSKEA++IIE 
Sbjct  295  SQVMSHPEVPAWLESGISSGANDQEITVSRLRSYMMSFDIETLQRYATIRSKEAVSIIEN  354

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYH  115
            HTEALFGRPEI ITP+G I+SSKDE+IKI    L+RLVLEAVTFGSFLWDVES VDSRYH
Sbjct  355  HTEALFGRPEIVITPEGKINSSKDEIIKIRIGGLKRLVLEAVTFGSFLWDVESYVDSRYH  414

Query  114  FV  109
            FV
Sbjct  415  FV  416



>ref|XP_003560595.1| PREDICTED: uncharacterized protein LOC100829350 [Brachypodium 
distachyon]
Length=413

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/240 (64%), Positives = 180/240 (75%), Gaps = 4/240 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDE-QLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA+ S S ++SG +D      E +L RLHS EAYEMI+NHL+LILG R    +   I+K
Sbjct  177  VPAL-SHSIDTSGRVDQWAEPTEGKLERLHSHEAYEMIENHLNLILGQRQADATVAAISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G   +D  + QV    S  S  +  
Sbjct  236  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKSLPWG--SQDDALNQVMMTDSRPSTEAYS  293

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE+ SW    + + G G  +KP RLR+YVMSFD +TLQ YATIRSK A  IIEKHTEA
Sbjct  294  SHPEMESWTSSDLSAGGLGQSIKPCRLRSYVMSFDSDTLQSYATIRSKVAFGIIEKHTEA  353

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFG+PEI ITP+GT+DSSKDE ++ISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  354  LFGKPEIVITPEGTVDSSKDEHVRISFAGLRRLILEAVTFGSFLWDVESYVDSRYHFVTN  413



>ref|XP_006650499.1| PREDICTED: uncharacterized protein LOC102715191 [Oryza brachyantha]
Length=327

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 181/240 (75%), Gaps = 4/240 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDT-LPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA+ S S NSSG +D    S + +L +LHS EAYEMI+NHL+LILG R    +   I+K
Sbjct  91   VPAL-SHSINSSGRVDQWAESVEGKLEKLHSQEAYEMIENHLALILGQRQADATVAAISK  149

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVD+RFQLEK+MK LP G   E   + QV    S  S ++S 
Sbjct  150  LRVGQVYAASVMYGYFLKRVDKRFQLEKSMKTLPWG--SEGDMLNQVMTTDSRPSAQTST  207

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE+ SW      + G    +KP RLR+YVMSFD +TLQ YATIRSKEA  IIEKHTEA
Sbjct  208  SHPEMASWTSPNFSAGGPSQSVKPCRLRSYVMSFDSDTLQSYATIRSKEAFGIIEKHTEA  267

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFG+PEI ITP+GT+DSSKDE ++ISF+ LRRL+LEAVTFGSFLWDVES VDSRYHFV +
Sbjct  268  LFGKPEIVITPEGTVDSSKDEHVRISFAGLRRLILEAVTFGSFLWDVESFVDSRYHFVVN  327



>ref|NP_001051084.1| Os03g0717900 [Oryza sativa Japonica Group]
 gb|ABF98564.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12998.1| Os03g0717900 [Oryza sativa Japonica Group]
 dbj|BAG94154.1| unnamed protein product [Oryza sativa Japonica Group]
Length=455

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 185/240 (77%), Gaps = 3/240 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDT-LPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA+ S S +SSG +D    S + +L ++HS EAYEMI+NHL+LILG R    +   I+K
Sbjct  218  VPAL-SHSISSSGRVDQWAESVEGKLEKMHSQEAYEMIENHLALILGQRQADATVAAISK  276

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK+MK LP G ++ED  + QV    S  S ++S 
Sbjct  277  LRVGQVYAASVMYGYFLKRVDQRFQLEKSMKTLPWGSEEEDK-LNQVMTTDSRPSPQTST  335

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPE+ SW      + G    +KP RLR+YVMSFD ETLQ YATIRSKEA  IIEKHTEA
Sbjct  336  SHPEMASWTSPNFSAGGPSQSVKPCRLRSYVMSFDSETLQSYATIRSKEAFGIIEKHTEA  395

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            LFG+PEI ITP+GT+DSSKDE ++ISF+ LRRL+LEAVTFGSFLWDVES VD+RYHFVA+
Sbjct  396  LFGKPEIVITPEGTVDSSKDEHVRISFAGLRRLILEAVTFGSFLWDVESFVDTRYHFVAN  455



>ref|XP_004513343.1| PREDICTED: uncharacterized protein LOC101494659 isoform X1 [Cicer 
arietinum]
 ref|XP_004513344.1| PREDICTED: uncharacterized protein LOC101494659 isoform X2 [Cicer 
arietinum]
Length=418

 Score =   289 bits (739),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 183/247 (74%), Gaps = 7/247 (3%)
 Frame = -3

Query  834  LMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV  655
             M   V  I S   + SG +D+ PS+D +L  LHSPEAYEMIQ+HL+L+LGNR   ++SV
Sbjct  172  FMDADVSLIPSVRPHPSGQVDSWPSEDGKLEELHSPEAYEMIQSHLALLLGNRIGDSASV  231

Query  654  -QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdts  478
             QI+KLRVGQVYAASVMYGYFLKRV QRFQLEK MK+LP    +E+S I Q   D +  +
Sbjct  232  AQISKLRVGQVYAASVMYGYFLKRVVQRFQLEKTMKILPDA--EEESTIGQTMEDETRIA  289

Query  477  l----rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  310
                      HPEV +W   G+ S  FG E   SRLR+Y+MSFD ETLQRYATIRSKE++
Sbjct  290  GLEMPSQVTPHPEVPTWSGSGISSGAFGQETTVSRLRSYMMSFDLETLQRYATIRSKESV  349

Query  309  NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            +IIEKHT+ALFG PEI++T +  I+SSKDE+IKIS   L+RLVLEAVTFGSFLWDVES V
Sbjct  350  SIIEKHTDALFGIPEIAVTAEEKINSSKDEIIKISIGGLKRLVLEAVTFGSFLWDVESYV  409

Query  129  DSRYHFV  109
            DSRYHFV
Sbjct  410  DSRYHFV  416


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKA+EEILY LVVQKFMDADV
Sbjct  150  EVKAKERRKAIEEILYTLVVQKFMDADV  177



>ref|NP_001169730.1| hypothetical protein [Zea mays]
 gb|ACN34695.1| unknown [Zea mays]
 gb|AFW67799.1| hypothetical protein ZEAMMB73_826524 [Zea mays]
Length=416

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/241 (66%), Positives = 182/241 (76%), Gaps = 7/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDE-QLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA+ S S +SSG +D      E +L RLHSPEAYEMI+NHL+LILG R +  +   I+K
Sbjct  177  VPAL-SRSIDSSGRVDQWAETVEGRLQRLHSPEAYEMIENHLALILGQRQSDATIAAISK  235

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK LP G ++ED  + QV    S  S +SS 
Sbjct  236  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKSLPWGSEEEDGALYQVMTTDSMPSAQSSS  295

Query  462  SHPEVVSW---PDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
            SHPE+ SW   PD   G  G    +KP RLR+YVMSFD +TLQRYAT+RSKEA  IIEKH
Sbjct  296  SHPEMGSWTAAPDFNAG--GPSESIKPCRLRSYVMSFDPDTLQRYATVRSKEAFGIIEKH  353

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            TEALFG+ EI +TP GT+ SSKDE I+ISF+ LRRLVLEAVTFGSFLWDVES VDS YHF
Sbjct  354  TEALFGKAEIVVTPGGTVGSSKDEHIRISFAGLRRLVLEAVTFGSFLWDVESFVDSSYHF  413

Query  111  V  109
            V
Sbjct  414  V  414



>ref|XP_006849427.1| hypothetical protein AMTR_s00024p00021530 [Amborella trichopoda]
 gb|ERN11008.1| hypothetical protein AMTR_s00024p00021530 [Amborella trichopoda]
Length=439

 Score =   287 bits (734),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 153/262 (58%), Positives = 189/262 (72%), Gaps = 24/262 (9%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINK  643
            +P+++S   N+S  +DT P++ E+L ++HSPEA +MI+NHL+LILGNR S+ +S  QI+K
Sbjct  179  IPSVSSSPDNTS-KVDTWPNQVEKLEKMHSPEALQMIRNHLALILGNRLSDLSSVAQISK  237

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGD---------s  490
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MKVLP G+D  +  ++QV  D          
Sbjct  238  LRVGQVYAASVMYGYFLKRVDQRFQLEKAMKVLPFGVDSGNLSMEQVLADDSGPKDLNNQ  297

Query  489  sdtslrsspSHPEVVSWPDGGMGSR-------------GFGTEMKPSRLRTYVMSFDGET  349
            +     +  ++    +W +   GS              GFG  +K  +LR+YVMSFD ET
Sbjct  298  TKNLKPNDQAYSGNPTWYEASHGSEQDGVDMGVNFSPGGFGYGLKSYKLRSYVMSFDAET  357

Query  348  LQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAV  169
            LQRYATIRSKE+++IIEKHTEALFGRPE+ ITPQGT+DSSKDE IKISF  L  LVLEAV
Sbjct  358  LQRYATIRSKESVSIIEKHTEALFGRPELRITPQGTVDSSKDENIKISFGGLTTLVLEAV  417

Query  168  TFGSFLWDVESSVDSRYHFVAH  103
            TFGSFLWDVES VDSRYHFV +
Sbjct  418  TFGSFLWDVESYVDSRYHFVTN  439


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEI+YAL+VQKFMDA+V
Sbjct  149  EVKANERRKALEEIIYALIVQKFMDAEV  176



>ref|XP_007160560.1| hypothetical protein PHAVU_002G331900g [Phaseolus vulgaris]
 gb|ESW32554.1| hypothetical protein PHAVU_002G331900g [Phaseolus vulgaris]
Length=405

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/230 (63%), Positives = 176/230 (77%), Gaps = 6/230 (3%)
 Frame = -3

Query  786  SGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASV  610
            SG +D  PS+D +L +LHS EAYEMI+NHLSLILGN+  +  S  +I+K RVGQVYAASV
Sbjct  176  SGKVDLWPSEDGKLEKLHSHEAYEMIENHLSLILGNKVGDLTSIAEISKFRVGQVYAASV  235

Query  609  MYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs---sdtslrsspSHPEVVSW  439
            MYGYFLKRVDQRFQLEK +KVL    ++E+S  Q    ++    +       SHPEV +W
Sbjct  236  MYGYFLKRVDQRFQLEKTVKVLTNETEEENSFHQTTMDNARPGVEEDTSQGTSHPEVFNW  295

Query  438  PDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEIS  259
            P G +   G G  +K +RLR YVMSFDG+TLQRYATIRSKEA++IIEKHTEALFGRPEI 
Sbjct  296  PGGDVSPGGVGYGVKATRLRNYVMSFDGDTLQRYATIRSKEAVSIIEKHTEALFGRPEIV  355

Query  258  ITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +TP+G +  SKDE +KISF  L++LVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  356  VTPEGAV--SKDENVKISFGGLQKLVLEAVTFGSFLWDVESYVDARYHFV  403


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRKALEEILYALVVQKFMDA++
Sbjct  138  EVKANERRKALEEILYALVVQKFMDANI  165



>tpg|DAA51043.1| TPA: hypothetical protein ZEAMMB73_539342 [Zea mays]
Length=204

 Score =   273 bits (699),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = -3

Query  714  MIQNHLSLILGNRSNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQG  535
            MI+NHL+LILG R    +   I+KLRVGQVYAASVMYGYFLKRVDQRFQLEK MK LP G
Sbjct  1    MIENHLTLILGQRQGDATIAAISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKGLPWG  60

Query  534  LDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDG  355
             ++EDS + QV       S ++S SHPE+ SW      + G    +KP RLR+YVMSFD 
Sbjct  61   SEEEDSALNQVMMTDLMPSAQTSSSHPEMGSWTAPAFSTGGPSQSIKPCRLRSYVMSFDS  120

Query  354  ETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLE  175
            +TLQRYAT+RSKEA  IIEKHTEALFG+PEI ITP+GT+DSSKDE I+ISF+ LRRL+LE
Sbjct  121  DTLQRYATVRSKEAFGIIEKHTEALFGKPEIVITPEGTLDSSKDEHIRISFAGLRRLILE  180

Query  174  AVTFGSFLWDVESSVDSRYHFV  109
            AVTFGSFLWDVES VDSRYHFV
Sbjct  181  AVTFGSFLWDVESFVDSRYHFV  202



>gb|EMT10781.1| hypothetical protein F775_30852 [Aegilops tauschii]
Length=493

 Score =   283 bits (723),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 174/233 (75%), Gaps = 3/233 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDE-QLARLHSPEAYEMIQNHLSLILGNRSNANSSVQINK  643
            VPA++     SSG +D      E +L RLHS EAYEMI+NHL+LILG R    +   I+K
Sbjct  220  VPALSHSIDASSGRVDQWAEHVEGKLERLHSHEAYEMIENHLNLILGQRQADGTVAAISK  279

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            LRVGQVYAASVMYGYFLKRVD+RFQLEK+MK LP G   ED  + QV    S  S ++  
Sbjct  280  LRVGQVYAASVMYGYFLKRVDKRFQLEKSMKSLPWG--SEDDALNQVMTTDSRPSDQTYS  337

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
            SHPEV SW    + + G G  +KPSRLR+YVMSFD +TLQ YATIRSK A  IIEKHTEA
Sbjct  338  SHPEVESWTSPDLSAGGLGQSVKPSRLRSYVMSFDSDTLQTYATIRSKVAFGIIEKHTEA  397

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            LFG+PEI ITP+GT+DSSKDE ++ISFS LRRL+LEAVTFGSFLWDVES VDS
Sbjct  398  LFGKPEIVITPEGTVDSSKDEYVRISFSGLRRLILEAVTFGSFLWDVESYVDS  450



>ref|XP_007152648.1| hypothetical protein PHAVU_004G147200g [Phaseolus vulgaris]
 gb|ESW24642.1| hypothetical protein PHAVU_004G147200g [Phaseolus vulgaris]
Length=403

 Score =   270 bits (690),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 172/216 (80%), Gaps = 8/216 (4%)
 Frame = -3

Query  738  LHSPEAYEMIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLE  562
            LHSPEAYEMIQNHL+LILG+R   ++SV QI+K+RVGQVYAAS+MYGYFLKRV QR+QLE
Sbjct  188  LHSPEAYEMIQNHLALILGSRLGDSTSVAQISKIRVGQVYAASIMYGYFLKRVVQRYQLE  247

Query  561  KNMKVLPQGLDKEDSGIQQV----GGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMK  394
            K MK+LP     E++ IQQ      G S   S     SHPE+ + P G + S GFG   K
Sbjct  248  KTMKILPNV--AEENSIQQTVIDESGISGGKSPSHVMSHPEISNLPGGSISSGGFGYGSK  305

Query  393  PSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRP-EISITPQGTIDSSKDEL  217
             SRLRTYVMSFD +TLQRYAT+RSKE+++IIEKHTEALFGRP EI +TP+G IDSSKDE 
Sbjct  306  VSRLRTYVMSFDTDTLQRYATLRSKESLSIIEKHTEALFGRPDEIVVTPEGVIDSSKDES  365

Query  216  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            IKISF SL+RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  366  IKISFGSLKRLVLEAVTFGSFLWDVESYVDARYHFV  401


 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+ ALEEILYALVVQKFMDAD+
Sbjct  146  EVKAKERKTALEEILYALVVQKFMDADI  173



>gb|EYU24493.1| hypothetical protein MIMGU_mgv1a007418mg [Erythranthe guttata]
Length=408

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 166/225 (74%), Gaps = 12/225 (5%)
 Frame = -3

Query  774  DTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR-SNANSSVQINKLRVGQVYAASVMYGY  598
            DT   K+ +L  LHS EAY+MIQ HLSLILG R +++ S  QI+KLRVGQVYAASVMYGY
Sbjct  195  DTWHCKEAELEGLHSTEAYQMIQKHLSLILGKRLADSKSVAQISKLRVGQVYAASVMYGY  254

Query  597  FLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGS  418
            FLKR+DQR QLEK MK+LPQ    E   I+ V   +++  +          S  DG   S
Sbjct  255  FLKRIDQRLQLEKMMKILPQ----EKMDIEHVTYSAAEKRVPMLNE-----SLEDGINLS  305

Query  417  RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  238
            R  G  +  SRLR YVM FDGETLQRYATIRSKEA N+IEKHTEALFGRPEI ITP GTI
Sbjct  306  RFDGINL--SRLRNYVMLFDGETLQRYATIRSKEAFNVIEKHTEALFGRPEIVITPDGTI  363

Query  237  DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
            DSS DELIKISF  LRRLVLEAVTFGSFLWD ES VDSRYHFVA+
Sbjct  364  DSSNDELIKISFGGLRRLVLEAVTFGSFLWDSESYVDSRYHFVAN  408


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ERRK LEEILYALVVQKFMDADV
Sbjct  152  EVKANERRKTLEEILYALVVQKFMDADV  179



>gb|ABR17692.1| unknown [Picea sitchensis]
 gb|ACN40252.1| unknown [Picea sitchensis]
Length=434

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/253 (58%), Positives = 182/253 (72%), Gaps = 19/253 (8%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P I+ P    +G IDT P +D +L  +HS EA+EMI+NHLSL+LGNR   +SS+ QI+K
Sbjct  187  IPCISMPDP-VTGQIDTWPKQDHKLEGVHSSEAFEMIKNHLSLVLGNRLLDSSSIAQISK  245

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl-rss  466
            LRVGQVYAASVMYGYFL+RVDQRFQLEK+MK LP GL++E    Q +G DS      ++ 
Sbjct  246  LRVGQVYAASVMYGYFLRRVDQRFQLEKSMKTLPSGLNEESDAEQTLGSDSKTKGEFQTR  305

Query  465  pSHPEVVSWPDGGMGSRGFGTE------------MKPSRLRTYVMSFDGETLQRYATIRS  322
             S P+V S     M S G  +E            +KP +LR YVMSF+ ETLQRYAT+RS
Sbjct  306  YSSPQVAS---AAMPSIGTPSEPEFNPTVNGRRGVKPCKLRAYVMSFEPETLQRYATMRS  362

Query  321  KEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDV  142
            KE ++IIEKH+EALFGRPE+ +   G++ ++ DE+IKISFS L  LVLEAVTFGSFLWDV
Sbjct  363  KEGVSIIEKHSEALFGRPEVQVV-GGSVAATNDEIIKISFSGLTSLVLEAVTFGSFLWDV  421

Query  141  ESSVDSRYHFVAH  103
            ES VDSRYHFV +
Sbjct  422  ESYVDSRYHFVTN  434



>gb|AFK35334.1| unknown [Lotus japonicus]
Length=207

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = -3

Query  714  MIQNHLSLILGNRSNANSSV-QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ  538
            MI+NHL L+LG+R   +++V QI+K+R GQVYAASVMYGYFLKRV QRFQLEK +K+LP 
Sbjct  1    MIENHLGLLLGSRQGDSTAVAQISKIRAGQVYAASVMYGYFLKRVVQRFQLEKAIKILPN  60

Query  537  GLDKEDSGIQQVGGDssdtsl--rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMS  364
              ++ +S    V             +  HPEV +WP  G+ S  FG     SRL TY+MS
Sbjct  61   AAEENNSHRTIVDDTRVSIEEFPSQAMPHPEVSAWPGSGISSGAFGQGTTVSRLHTYMMS  120

Query  363  FDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRL  184
            FDGETLQRYATIRSKE+++IIEKHTEALFGRP+  ITP+G I+SSKDE+IKISF  L+RL
Sbjct  121  FDGETLQRYATIRSKESVSIIEKHTEALFGRPDAVITPEGKINSSKDEIIKISFGGLKRL  180

Query  183  VLEAVTFGSFLWDVESSVDSRYHFV  109
            VLEAVTFGSFLWDVES VDSRYHFV
Sbjct  181  VLEAVTFGSFLWDVESYVDSRYHFV  205



>ref|XP_010939981.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939982.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939983.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
 ref|XP_010939984.1| PREDICTED: uncharacterized protein LOC105058679 [Elaeis guineensis]
Length=422

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 174/243 (72%), Gaps = 5/243 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDT-LPSKDEQLARLHSPEAYEMIQNHLSLILGN-RSNANSSVQIN  646
            VP++   + N+SG +    PS++E+L  LHSPEAYE+I+NHL+LILG    ++NS   ++
Sbjct  181  VPSLAQLT-NASGKVKQWRPSEEEKLEGLHSPEAYEVIKNHLALILGQGLGDSNSVASVS  239

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGL--DKEDSGIQQVGGDssdtslr  472
            KLRV  VYAASV+YGYFLKRVDQRFQLEK+MK LP G   + E+  ++Q   D S    +
Sbjct  240  KLRVVLVYAASVIYGYFLKRVDQRFQLEKSMKTLPWGSVEENEEDAVKQAMPDESRPLTQ  299

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
               SHP             G G  +KP RLR+Y  +FD + LQRY  +RSKEA +IIEKH
Sbjct  300  IGNSHPVASLGSSPSFNHGGVGHSVKPCRLRSYFKAFDSQMLQRYVKVRSKEAFHIIEKH  359

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            TEALFGRPEI I PQGTIDSSKDE++KISF+ LRRL+LEAVTFGSFLWD ES VD+RYHF
Sbjct  360  TEALFGRPEIVIAPQGTIDSSKDEIVKISFAGLRRLILEAVTFGSFLWDTESYVDTRYHF  419

Query  111  VAH  103
            + +
Sbjct  420  MTN  422



>ref|XP_010661178.1| PREDICTED: uncharacterized protein LOC100245443 isoform X2 [Vitis 
vinifera]
Length=365

 Score =   259 bits (661),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 173/249 (69%), Gaps = 14/249 (6%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P ++  S  SSG +D  PS D  L  LHSPEA EMIQNHL+ ILGNR   ++SV +++K
Sbjct  121  IPRMSPSSLGSSGRVDNWPSLDRDLGELHSPEATEMIQNHLAFILGNRFGDSTSVAKMSK  180

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD------KEDSGIQQVGGDssdt  481
            LRVGQVYAASVMYGYFLKRVD+RFQLEK MK+LP  LD      +E  G+   G D S  
Sbjct  181  LRVGQVYAASVMYGYFLKRVDERFQLEKTMKILPYALDGDKGYVEEAMGMSPFGSDDSVQ  240

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
             + S    PE   W  GG+    FG   KPS L +YV   D ETL RY TIRS EA++II
Sbjct  241  GVES---QPEASCWA-GGLTIGSFGHWKKPSSLGSYVKLIDAETLMRYTTIRSMEAVSII  296

Query  300  EKHTEALFGRPEISITPQ---GTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            +KHT+ALFGR +++I P     T+DSS+DELIK+SF  L+RLVLEA+TFGSFLWDVES V
Sbjct  297  QKHTQALFGRRDVAIIPNIPMWTLDSSEDELIKMSFGGLKRLVLEALTFGSFLWDVESFV  356

Query  129  DSRYHFVAH  103
            DSR HFV +
Sbjct  357  DSRLHFVVN  365



>emb|CAN79123.1| hypothetical protein VITISV_030635 [Vitis vinifera]
Length=411

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 173/249 (69%), Gaps = 14/249 (6%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P ++  S  SSG +D  PS D  L  LHSPEA EMIQNHL+ ILGNR   ++SV +++K
Sbjct  167  IPRMSPSSLGSSGRVDNWPSLDRDLGELHSPEATEMIQNHLAFILGNRFGDSTSVAKMSK  226

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD------KEDSGIQQVGGDssdt  481
            LRVGQVYAASVMYGYFLKRVD+RFQLEK MK+LP  LD      +E  G+   G D S  
Sbjct  227  LRVGQVYAASVMYGYFLKRVDERFQLEKTMKILPYALDGDKGYVEEAMGMSPFGSDDSVQ  286

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
             + S    PE   W  GG+    FG   KPS L +YV   D ETL RY TIRS EA++II
Sbjct  287  GVES---QPEASCWA-GGLTIGSFGHWKKPSSLGSYVKLIDAETLMRYTTIRSMEAVSII  342

Query  300  EKHTEALFGRPEISITPQG---TIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            +KHT+ALFGR +++I P     T+DSS+DELIK+SF  L+RLVLEA+TFGSFLWDVES V
Sbjct  343  QKHTQALFGRRDVAIIPNIPMWTLDSSEDELIKMSFGGLKRLVLEALTFGSFLWDVESFV  402

Query  129  DSRYHFVAH  103
            DSR HFV +
Sbjct  403  DSRLHFVVN  411



>ref|XP_002273280.1| PREDICTED: uncharacterized protein LOC100245443 isoform X1 [Vitis 
vinifera]
Length=411

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 173/249 (69%), Gaps = 14/249 (6%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P ++  S  SSG +D  PS D  L  LHSPEA EMIQNHL+ ILGNR   ++SV +++K
Sbjct  167  IPRMSPSSLGSSGRVDNWPSLDRDLGELHSPEATEMIQNHLAFILGNRFGDSTSVAKMSK  226

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD------KEDSGIQQVGGDssdt  481
            LRVGQVYAASVMYGYFLKRVD+RFQLEK MK+LP  LD      +E  G+   G D S  
Sbjct  227  LRVGQVYAASVMYGYFLKRVDERFQLEKTMKILPYALDGDKGYVEEAMGMSPFGSDDSVQ  286

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
             + S    PE   W  GG+    FG   KPS L +YV   D ETL RY TIRS EA++II
Sbjct  287  GVES---QPEASCWA-GGLTIGSFGHWKKPSSLGSYVKLIDAETLMRYTTIRSMEAVSII  342

Query  300  EKHTEALFGRPEISITPQG---TIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            +KHT+ALFGR +++I P     T+DSS+DELIK+SF  L+RLVLEA+TFGSFLWDVES V
Sbjct  343  QKHTQALFGRRDVAIIPNIPMWTLDSSEDELIKMSFGGLKRLVLEALTFGSFLWDVESFV  402

Query  129  DSRYHFVAH  103
            DSR HFV +
Sbjct  403  DSRLHFVVN  411



>gb|ADE77481.1| unknown [Picea sitchensis]
Length=435

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 177/268 (66%), Gaps = 44/268 (16%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR---SNANSSVQI  649
            +P I+ P+  S G +DT P++D +L  +HS EA EMI+ HLSL+LGNR   S++N+  +I
Sbjct  179  IPTISLPAAGS-GKVDTWPNQDTELEAVHSIEAVEMIKEHLSLVLGNRNAGSDSNTVAEI  237

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrs  469
            +KLRVGQVYAASVMYGYFL+RVD+ FQLEK+MK+LP   ++E    Q             
Sbjct  238  SKLRVGQVYAASVMYGYFLRRVDKHFQLEKSMKMLPFASNEEIDAEQ------------L  285

Query  468  spSHPEV--VSWPDGGMGSRG-------------------------FG-TEMKPSRLRTY  373
            + +HPE+  V+W D      G                         FG    KP +LR Y
Sbjct  286  NSTHPELEGVNWQDNSAVQGGAAIAAAVAAMAGAAGPAGQDFNPIVFGQIGAKPCKLRAY  345

Query  372  VMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSL  193
            VMSFD ETLQRYAT+RSKE +NIIE+H EALFGRPEI ITP G++  +KDE+++ISF+ L
Sbjct  346  VMSFDPETLQRYATMRSKEGVNIIERHAEALFGRPEIHITPDGSMAVTKDEILRISFTGL  405

Query  192  RRLVLEAVTFGSFLWDVESSVDSRYHFV  109
              +VLEAVTFGSFLWDVES VDSRYHFV
Sbjct  406  TSMVLEAVTFGSFLWDVESHVDSRYHFV  433



>ref|XP_002304357.2| hypothetical protein POPTR_0003s09600g [Populus trichocarpa]
 gb|EEE79336.2| hypothetical protein POPTR_0003s09600g [Populus trichocarpa]
Length=250

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 167/238 (70%), Gaps = 6/238 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I SP+ + +G +D  P+++++L  +HSPEA+EMIQ+HLS++LG R      ++VQI+
Sbjct  14   IPKI-SPTSDPTGRVDFWPNQEQKLESVHSPEAFEMIQSHLSIVLGERLVGPLETTVQIS  72

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFL+RVDQR+QLE+ M  LP+G D++ +  +     +      S 
Sbjct  73   KIKLGKLYAASLMYGYFLRRVDQRYQLERAMNTLPKGFDEDRARFEDPSPANRLWDPDSL  132

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
                     PDG     G   E K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T+
Sbjct  133  IRILPDSGEPDGDFTDTG---EEKSYRLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQ  189

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            ALFGRP+I I   G+I+++ DE++ I+FS L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  190  ALFGRPDIRIAGDGSIETANDEVVSITFSGLTMLVLEAVGFGSFLWDAESYVESKYHF  247



>ref|XP_010461665.1| PREDICTED: uncharacterized protein LOC104742360 [Camelina sativa]
Length=176

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 138/174 (79%), Gaps = 7/174 (4%)
 Frame = -3

Query  609  MYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDs-------sdtslrsspSHPE  451
            MYGYFLKR+DQRFQLEK M++LP G  + ++ I+Q G ++       ++ + ++  S+ E
Sbjct  1    MYGYFLKRIDQRFQLEKTMRILPGGSYEGETSIEQAGRETERSFYEEAEETYQAVSSNQE  60

Query  450  VVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGR  271
            V S+  G   S GF +EM  SRL+TYVMSFDGETLQRYATIRS+EA+ IIEKHTEALFGR
Sbjct  61   VGSFVGGINASGGFSSEMNQSRLKTYVMSFDGETLQRYATIRSREAVGIIEKHTEALFGR  120

Query  270  PEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            PEI ITPQGTIDSSKDE IKISF  LRRLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  121  PEILITPQGTIDSSKDEHIKISFKGLRRLVLEAVTFGSFLWDVESHVDSRYHFV  174



>ref|XP_011028101.1| PREDICTED: uncharacterized protein LOC105128231 [Populus euphratica]
Length=413

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 167/238 (70%), Gaps = 6/238 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I SP+ + +G +D  P+++++L  +HSPEA+EMIQ+HLS++LG R      +++QI+
Sbjct  177  IPKI-SPTSDPTGRVDFWPNQEQKLEAVHSPEAFEMIQSHLSIVLGERLVGPLETTIQIS  235

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFL+RVDQR+QLE+ M  LP+G D++ +  +     +      S 
Sbjct  236  KIKLGKLYAASLMYGYFLRRVDQRYQLERTMNTLPKGFDEDRARFEDPSPANRLWDPDSL  295

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
                     PDG     G   E K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T+
Sbjct  296  IRILPNSGDPDGDFTDTG---EEKSYRLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQ  352

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            ALFGRP+I I   G+I+++ DE++ I+FS L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  353  ALFGRPDIRIADDGSIETANDEVVSITFSGLTMLVLEAVGFGSFLWDAESYVESKYHF  410



>gb|KDP30713.1| hypothetical protein JCGZ_15541 [Jatropha curcas]
Length=405

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/253 (48%), Positives = 171/253 (68%), Gaps = 32/253 (13%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I S S + +G +D  P+++++L  +HSPEA+EMIQ+HL+L+LG+R     ++ VQI+
Sbjct  167  IPKI-SASSDPTGRVDFWPNQEQKLESVHSPEAFEMIQSHLTLVLGDRLVGPIDTIVQIS  225

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFL+RVDQRFQLE+ M  LP+G D+     +++  D         
Sbjct  226  KIKLGKLYAASIMYGYFLRRVDQRFQLERTMNTLPKGFDES----RRIYDD---------  272

Query  465  pSHPEVVSW------------PDGGMGSRGF--GTEMKPSRLRTYVMSFDGETLQRYATI  328
               P  V+W             DG     GF   +  K +RLR+YVM  D ETLQRYATI
Sbjct  273  --DPSPVNWFWDSDSLIRIQPDDGDYSDEGFIDTSREKSNRLRSYVMYLDAETLQRYATI  330

Query  327  RSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLW  148
            RSKE +++IEK T+ALFGRP+I +   G+ID++ DE+I ++FS L  LVLEAV FGSFLW
Sbjct  331  RSKEVMSLIEKQTQALFGRPDIRVMEDGSIDTANDEVISMTFSGLTMLVLEAVAFGSFLW  390

Query  147  DVESSVDSRYHFV  109
            D ES V+S+YHF+
Sbjct  391  DAESYVESKYHFL  403



>ref|XP_010261560.1| PREDICTED: uncharacterized protein LOC104600354 [Nelumbo nucifera]
Length=409

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 166/235 (71%), Gaps = 4/235 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I+ PS + +G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG+R     ++ VQI+
Sbjct  171  IPPISVPSSDPTGRVDLWPNQEQKLESVHSPEAFEMIQSHLSLVLGDRLVGPLDTIVQIS  230

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            KL++G++YAAS+MYGYFLKRVDQRFQLE+ MK LP G D ED  ++    ++      S 
Sbjct  231  KLKLGKLYAASIMYGYFLKRVDQRFQLERTMKTLPDGFD-EDQVLKDPAPENQLWDADSL  289

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
                      DG     G G E K  RLR+YVM  D ETLQRYAT+R+KEAI++IEK T+
Sbjct  290  IRISPDDGDSDGDGDILGSG-ETKSYRLRSYVMYLDAETLQRYATVRTKEAISLIEKQTQ  348

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            ALFGRP+I I   G++D+S DE+I ++FS L  LVLEAV FGSFLWD ES V+S+
Sbjct  349  ALFGRPDIRIAEDGSLDTSNDEMIGLTFSGLTMLVLEAVAFGSFLWDAESYVESK  403



>ref|XP_008466020.1| PREDICTED: uncharacterized protein LOC103503577 isoform X2 [Cucumis 
melo]
Length=335

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 169/242 (70%), Gaps = 13/242 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
            +P IT  S + +G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG+R     +S V+++
Sbjct  100  IPKITETS-DPTGRVDFWPNQEQKLESVHSPEAFEMIQSHLSLVLGDRVVGPFSSIVEMS  158

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVDQRFQLE+ MK LP+   K+    + +  +         
Sbjct  159  KIKLGKLYAASIMYGYFLKRVDQRFQLERTMKTLPEAFTKDFD--EPIPANQLWDPDSLI  216

Query  465  pSHPEVVSWPDGGMG-SRGF--GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
               P+     D G G SRG     + K  RLR+YVM  D ETLQRYAT+RSKEAI++IEK
Sbjct  217  RIAPD-----DEGFGDSRGLIDAGDGKSYRLRSYVMYLDSETLQRYATLRSKEAISLIEK  271

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYH  115
             T+ALFG+P+I I   G+ID+  DE+I ++FS L  LVLEAV FGSFLWD ES V+S+Y+
Sbjct  272  QTQALFGKPDIRIAADGSIDTLNDEVISLTFSGLTMLVLEAVAFGSFLWDAESYVESKYN  331

Query  114  FV  109
            F+
Sbjct  332  FI  333



>emb|CAN68920.1| hypothetical protein VITISV_039448 [Vitis vinifera]
Length=299

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 168/239 (70%), Gaps = 7/239 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I++ S +  G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG R     ++ VQI+
Sbjct  64   IPKISATS-DPVGRVDFWPNQEQKLESIHSPEAFEMIQSHLSLVLGERLVGPLDTIVQIS  122

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVD+R+QLE+ MK LP+G ++     +  G  +      S 
Sbjct  123  KIKLGKLYAASIMYGYFLKRVDERYQLERTMKTLPEGFNENRLSFEDPGPANRLWDPDSL  182

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
               P       G + S   G+     RLR+YVM  D ETLQRYATIRSKEAI++IEK T+
Sbjct  183  IRIPADDDDDGGMLDSVEGGS----YRLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQ  238

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ALFG+P++ ++  G++D+S DE++ I+FS L  LVLEAV FGSFLWD E+ V+S+YHF+
Sbjct  239  ALFGKPDVRVSEDGSLDTSNDEVVSITFSGLTMLVLEAVAFGSFLWDSETYVESKYHFL  297



>ref|XP_006471483.1| PREDICTED: uncharacterized protein LOC102623998 [Citrus sinensis]
Length=408

 Score =   228 bits (582),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 173/244 (71%), Gaps = 13/244 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I   S +  G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG R     ++ +QI+
Sbjct  169  IPKIGETS-DPVGRVDFWPNQEQKLESVHSPEAFEMIQSHLSLVLGERLVGPLDTIIQIS  227

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFL+RVDQRFQLE+ MK LP+G D++     +V  +  + S  + 
Sbjct  228  KIKLGKLYAASIMYGYFLRRVDQRFQLERTMKTLPEGFDED-----KVRYEEREPSPMNR  282

Query  465  pSHPE-VVSWP---DGGMGSRGF-GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
               P+ ++  P   DG +G     G E K  RLR+YVM  D ETLQRYATIRSKEAI++I
Sbjct  283  LWDPDSLIRIPPNDDGTVGESFMDGGEGKSYRLRSYVMYLDAETLQRYATIRSKEAISLI  342

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EK T+ALFGRP++ +   G+ID+SKDE+I ++F  L  LVLEAV FGSF+WD ES V+S+
Sbjct  343  EKQTQALFGRPDVRVLEDGSIDTSKDEVISVTFLGLTMLVLEAVAFGSFMWDSESYVESK  402

Query  120  YHFV  109
            Y F+
Sbjct  403  YPFI  406



>ref|XP_008466019.1| PREDICTED: uncharacterized protein LOC103503577 isoform X1 [Cucumis 
melo]
Length=405

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 169/242 (70%), Gaps = 13/242 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
            +P IT  S + +G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG+R     +S V+++
Sbjct  170  IPKITETS-DPTGRVDFWPNQEQKLESVHSPEAFEMIQSHLSLVLGDRVVGPFSSIVEMS  228

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVDQRFQLE+ MK LP+   K+    + +  +         
Sbjct  229  KIKLGKLYAASIMYGYFLKRVDQRFQLERTMKTLPEAFTKDFD--EPIPANQLWDPDSLI  286

Query  465  pSHPEVVSWPDGGMG-SRGF--GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
               P+     D G G SRG     + K  RLR+YVM  D ETLQRYAT+RSKEAI++IEK
Sbjct  287  RIAPD-----DEGFGDSRGLIDAGDGKSYRLRSYVMYLDSETLQRYATLRSKEAISLIEK  341

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYH  115
             T+ALFG+P+I I   G+ID+  DE+I ++FS L  LVLEAV FGSFLWD ES V+S+Y+
Sbjct  342  QTQALFGKPDIRIAADGSIDTLNDEVISLTFSGLTMLVLEAVAFGSFLWDAESYVESKYN  401

Query  114  FV  109
            F+
Sbjct  402  FI  403



>ref|XP_004136206.1| PREDICTED: uncharacterized protein LOC101213975 [Cucumis sativus]
 ref|XP_004163203.1| PREDICTED: uncharacterized LOC101213975 [Cucumis sativus]
 gb|KGN60350.1| hypothetical protein Csa_3G895960 [Cucumis sativus]
Length=405

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 169/242 (70%), Gaps = 13/242 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
            +P IT  S + +G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG+R     +S V+++
Sbjct  170  IPKITETS-DPTGRVDFWPNQEQKLESVHSPEAFEMIQSHLSLVLGDRVVGPFSSIVEMS  228

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVDQRFQLE+ MK LP+   K+    + +  +         
Sbjct  229  KIKLGKLYAASIMYGYFLKRVDQRFQLERTMKTLPEAFTKDFD--EPIPANQLWDPDSLI  286

Query  465  pSHPEVVSWPDGGMG-SRGF--GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
               P+     D G G SRG     + K  RLR+YVM  D ETLQRYAT+RSKEAI++IEK
Sbjct  287  RIAPD-----DEGFGDSRGLIDADDGKSYRLRSYVMYLDSETLQRYATLRSKEAISLIEK  341

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYH  115
             T++LFG+P+I I   G+ID+  DE+I ++FS L  LVLEAV FGSFLWD ES V+S+Y+
Sbjct  342  QTQSLFGKPDIRIAADGSIDTLNDEVISLTFSGLTMLVLEAVAFGSFLWDAESYVESKYN  401

Query  114  FV  109
            F+
Sbjct  402  FI  403



>ref|XP_010919980.1| PREDICTED: uncharacterized protein LOC105043949 [Elaeis guineensis]
Length=404

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 125/241 (52%), Positives = 166/241 (69%), Gaps = 13/241 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
            +PAI SPS + +  +   P+++ +L  +HSP+A EMIQ+HL+LILG R+    N+ VQI+
Sbjct  175  IPAI-SPSSDPNSEVHYWPNQEHKLEAIHSPDALEMIQSHLTLILGERAVGPLNAIVQIS  233

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            KL++G++YAAS+MYGYFLKRVDQRFQLE+ MK LP      D+  Q+V  D     L   
Sbjct  234  KLKLGKLYAASIMYGYFLKRVDQRFQLERTMKTLPT-----DTRQQRVFDDLKPNPLWDL  288

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
             S  ++ S           G + K  RLR+YVM  D E LQRYATIRSKE+I++IEK T+
Sbjct  289  ESMVQISS-----DDDGSDGEDSKSYRLRSYVMYLDAEALQRYATIRSKESISLIEKQTQ  343

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  106
            ALFGRP+I I   G++D+S DEL+ I+FS L  LVLEAV FGSFLW+ ES V+S+YHFV 
Sbjct  344  ALFGRPDIRIAEDGSLDTSNDELVGITFSGLTMLVLEAVAFGSFLWEAESYVESKYHFVT  403

Query  105  H  103
            +
Sbjct  404  N  404



>ref|XP_002276652.1| PREDICTED: uncharacterized protein LOC100260823 [Vitis vinifera]
Length=403

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 168/239 (70%), Gaps = 7/239 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I++ S +  G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG R     ++ VQI+
Sbjct  168  IPKISATS-DPVGRVDFWPNQEQKLESIHSPEAFEMIQSHLSLVLGERLVGPLDTIVQIS  226

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVD+R+QLE+ MK LP+G ++     +  G  +      S 
Sbjct  227  KIKLGKLYAASIMYGYFLKRVDERYQLERTMKTLPEGFNENRLSFEDPGPANRLWDPDSL  286

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
               P       G + S   G+     RLR+YVM  D ETLQRYATIRSKEAI++IEK T+
Sbjct  287  IRIPADDDDDGGMLDSVEGGS----YRLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQ  342

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ALFG+P++ ++  G++D+S DE++ I+FS L  LVLEAV FGSFLWD E+ V+S+YHF+
Sbjct  343  ALFGKPDVRVSEDGSLDTSNDEVVSITFSGLTMLVLEAVAFGSFLWDSETYVESKYHFL  401



>ref|XP_009373461.1| PREDICTED: uncharacterized protein LOC103962488 [Pyrus x bretschneideri]
Length=403

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 166/245 (68%), Gaps = 29/245 (12%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I+  S + +G +D  P+++++L  +HSPEAYEMIQ+HLSL+LG R     +S V+I+
Sbjct  178  IPKISETS-DPTGRVDFWPNQEKKLESVHSPEAYEMIQSHLSLVLGERLVGPLSSMVEIS  236

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVD+RFQLE++M  LP+G   + +   Q+            
Sbjct  237  KIKLGKLYAASIMYGYFLKRVDERFQLERSMNTLPEGFTADPAPANQL------------  284

Query  465  pSHPEVVSW-PDGGM-----GSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
                    W PD  +     G+    ++ K  RLR+YV   D ETLQRYATIRSKEAI++
Sbjct  285  --------WDPDSLIRIAPEGASDSDSDSKSYRLRSYVTYLDAETLQRYATIRSKEAISL  336

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IE  T+ALFG+P+I I   G+ID+S DE+I ++FS L  L+LEAV FGSFLWD E+ V+S
Sbjct  337  IENQTQALFGKPDIRIAADGSIDTSNDEVIALTFSGLTMLILEAVAFGSFLWDAETYVES  396

Query  123  RYHFV  109
            RYHFV
Sbjct  397  RYHFV  401



>gb|KJB21160.1| hypothetical protein B456_003G185600 [Gossypium raimondii]
 gb|KJB21161.1| hypothetical protein B456_003G185600 [Gossypium raimondii]
Length=400

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/249 (49%), Positives = 167/249 (67%), Gaps = 27/249 (11%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P +T  S + +G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG+R     ++ VQI+
Sbjct  165  IPKVTETS-DPTGRVDFWPNQEQKLEFVHSPEAFEMIQSHLSLVLGDRMVGPLSTIVQIS  223

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFL+RVDQRFQLE+ MK LP+   K  +  +              
Sbjct  224  KIKLGKLYAASIMYGYFLRRVDQRFQLERTMKTLPEDFTKSQARFED-------------  270

Query  465  pSHPEVVSW-PDGGM---------GSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKE  316
              +P    W PD  +         G      E K  RLR+YVM  D ETLQRYATIRSKE
Sbjct  271  -PNPGKQLWDPDSLIRIPPHDDDDGGGYGDAEGKQYRLRSYVMYLDSETLQRYATIRSKE  329

Query  315  AINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVES  136
            AI++IEK T+ALFGRP+I I   G++D+S DE++ ++FS L  LVLEAV FGSFLWD ES
Sbjct  330  AISLIEKQTQALFGRPDIRILDDGSLDTSNDEVVSLTFSGLTMLVLEAVAFGSFLWDAES  389

Query  135  SVDSRYHFV  109
             V+S+YHF+
Sbjct  390  YVESKYHFL  398



>ref|XP_011081424.1| PREDICTED: uncharacterized protein LOC105164476 [Sesamum indicum]
Length=408

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 171/241 (71%), Gaps = 10/241 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I++ S + +G +D  P++++QL  +HS EA+EMI +HLSL+LG R     ++ +QI+
Sbjct  172  IPKISTTS-DPTGRVDLWPNQEQQLESVHSAEAFEMILSHLSLVLGERVVGPLDTIIQIS  230

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFL+RVD+R+QLE++M  LP+G      G ++V  +      +  
Sbjct  231  KIKLGKLYAASIMYGYFLRRVDERYQLERSMNTLPEGF-----GEERVRFEEPTPEKQLW  285

Query  465  pSHPEVVSWPDGGMGSR--GFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 +  +PD G G       +E K  +LR+YVM  D ETLQRYATIRSKEAI++IEK 
Sbjct  286  DPDSLIRIYPDEGDGGGIVDSSSEEKSYKLRSYVMYLDAETLQRYATIRSKEAISLIEKQ  345

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFG+P+I++T  G++D+S DEL+ ++FS L  LVLEAVTFGSFLWD E+ V+S+Y F
Sbjct  346  TQALFGQPDITVTQDGSLDASNDELVSLTFSGLTMLVLEAVTFGSFLWDTENYVESKYPF  405

Query  111  V  109
            +
Sbjct  406  I  406



>ref|XP_007040722.1| Uncharacterized protein TCM_016604 [Theobroma cacao]
 gb|EOY25223.1| Uncharacterized protein TCM_016604 [Theobroma cacao]
Length=402

 Score =   223 bits (569),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 169/246 (69%), Gaps = 18/246 (7%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I + S + +G +D  P+++++L  +HSPEA+EMIQ HLSL+LG+R     ++ V+I+
Sbjct  164  IPKIMATS-DPTGRVDFWPNQEQKLESVHSPEAFEMIQGHLSLVLGDRVVGPLSTIVEIS  222

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDS-------GIQQVGGDss  487
            K+++G++YAAS+MYGYFL+RVDQRFQLE+ M+ LP+  +K+ +       G Q    DS 
Sbjct  223  KIKLGKLYAASIMYGYFLRRVDQRFQLERTMRTLPEDFNKDQARFEDPNPGKQMWDPDSW  282

Query  486  dtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAIN  307
                 +  +  +   + D   G        K  RLR+YVM  D ETLQRYATIRS+EAI+
Sbjct  283  IRIPPNDDNDGDGGGYMDTLEG--------KSYRLRSYVMYLDSETLQRYATIRSREAIS  334

Query  306  IIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVD  127
            +IEK T+ALFGRP+I I   G++D+S DE++ I+F+ L  LVLEAV FGSFLWD ES V+
Sbjct  335  LIEKQTQALFGRPDIRILDDGSLDTSNDEVVSITFTGLTMLVLEAVAFGSFLWDAESYVE  394

Query  126  SRYHFV  109
            S+YHF+
Sbjct  395  SKYHFL  400



>ref|XP_008373529.1| PREDICTED: uncharacterized protein LOC103436859 [Malus domestica]
Length=403

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 118/245 (48%), Positives = 164/245 (67%), Gaps = 29/245 (12%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I+  S + +G +D  P+++++L  +HSPEAYEMIQ+HLSL+LG R     +S V+I+
Sbjct  178  IPKISETS-DPTGRVDFWPNQEKKLESVHSPEAYEMIQSHLSLVLGERLVGPLSSMVEIS  236

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVD+RFQLE+ M  LP+G   + +   Q+            
Sbjct  237  KIKLGKLYAASIMYGYFLKRVDERFQLERTMNTLPEGFTADPAPANQL------------  284

Query  465  pSHPEVVSW-PDGGM-----GSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
                    W PD  +     G+    ++ K  RLR+YV   D ETLQRYATIRSKEAI++
Sbjct  285  --------WDPDSLIRIAPEGASDSDSDSKSYRLRSYVTYLDAETLQRYATIRSKEAISL  336

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IE  T+ALFG+P+I I   G+ID+  DE+I ++FS L  L+LEAV FGSFLWD E+ V+S
Sbjct  337  IENQTQALFGKPDIRIAADGSIDAPNDEVIALTFSGLTMLILEAVAFGSFLWDAETYVES  396

Query  123  RYHFV  109
            RYHFV
Sbjct  397  RYHFV  401



>ref|XP_008238169.1| PREDICTED: uncharacterized protein LOC103336834 [Prunus mume]
Length=405

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 164/240 (68%), Gaps = 12/240 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I++ S + +G +D  P ++ +L  +HSPEA EMIQ+HLSL+LG R     +S V+I+
Sbjct  173  IPKISATS-DPTGRVDFWPMQENKLESVHSPEALEMIQSHLSLVLGERLVGPLSSIVEIS  231

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV-GGDssdtslrs  469
            K+++G++YAAS+MYGYFLKRVDQRFQLE+ M  LP G   + +   Q+   DS       
Sbjct  232  KIKLGKLYAASIMYGYFLKRVDQRFQLERTMNTLPDGFTPDAAPANQLWDPDSLIRIPPD  291

Query  468  spSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  289
              S  +  S+ + G        + K  RLR+YVM  D ETLQRYATIRSKEAI++IE  T
Sbjct  292  GGSDGDGGSYMNNG--------DDKSYRLRSYVMYLDAETLQRYATIRSKEAISLIENQT  343

Query  288  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +ALFGRP++ IT  G+ID+S DE+I ++FS L  LVLEAV FGSFLWD E+ ++S YHF+
Sbjct  344  QALFGRPDVRITDDGSIDASNDEVIALTFSGLTMLVLEAVAFGSFLWDAETYIESNYHFL  403



>ref|XP_010055250.1| PREDICTED: uncharacterized protein LOC104443499 [Eucalyptus grandis]
Length=408

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 166/240 (69%), Gaps = 9/240 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P IT+ S + +G +D  P+++E+L  +HSPEA+EMIQ+HLSL++G+R     +S +Q +
Sbjct  173  IPKITATS-DPTGRVDYWPNQEEKLESVHSPEAFEMIQSHLSLVVGDRVVGPLDSIIQSS  231

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFL+RVD+RFQLE+ M  LP+G  +    ++     S      S 
Sbjct  232  KIKLGKLYAASIMYGYFLRRVDERFQLERTMNTLPKGYTENRVRLEDSIPTSPFWDPDSL  291

Query  465  pSHPEVVSWPDGGMGSRGFGTEM-KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  289
               P     PD G G     +E  K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T
Sbjct  292  IRIP-----PDDGDGGSFLDSEEGKLYRLRSYVMYLDPETLQRYATIRSKEAISLIEKQT  346

Query  288  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +ALFGRP+I +   G+ID+S DE+I +S S L  L+LEAV FGSFLWD E+ V+S+Y FV
Sbjct  347  QALFGRPDIRVAEDGSIDTSSDEVISLSVSGLTMLILEAVAFGSFLWDAENFVESKYQFV  406



>gb|KHG08376.1| Beta-casein [Gossypium arboreum]
Length=399

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 164/240 (68%), Gaps = 10/240 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P +T  S + +G +D  P++ ++L  +HSPEA+EMIQ+HLSL+LG+R     ++ VQI+
Sbjct  165  IPKVTETS-DPTGRVDFWPNQ-QKLEFVHSPEAFEMIQSHLSLVLGDRMVGPLSTIVQIS  222

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFL+RVDQRFQLE+ MK LP+   K  +  +            S 
Sbjct  223  KIKLGKLYAASIMYGYFLRRVDQRFQLERTMKTLPEDFTKSQARFEDPNPGKQLWDPDSL  282

Query  465  pSHPEVVSWPDGGMGSRGF-GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  289
               P     P       G+   E K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T
Sbjct  283  IRIP-----PHDDDDGGGYEDAEGKQYRLRSYVMYLDSETLQRYATIRSKEAISLIEKQT  337

Query  288  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +ALFGRP+I I   G++D+S DE++ ++FS L  LVLEAV FGSFLWD ES V+S+YHF+
Sbjct  338  QALFGRPDIQILDDGSLDTSNDEVVSLTFSGLTMLVLEAVAFGSFLWDAESYVESKYHFL  397



>ref|XP_004300191.1| PREDICTED: uncharacterized protein LOC101292798 [Fragaria vesca 
subsp. vesca]
Length=405

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 163/243 (67%), Gaps = 17/243 (7%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR----SNANSSVQ  652
            +P I++ S + +G +D  P+++++L  +HS EA+EMIQ+HLSL+LG R       +S V+
Sbjct  172  IPKISATS-DPTGRVDFWPNQEQKLESVHSSEAFEMIQSHLSLVLGERLVGVGPLSSLVE  230

Query  651  INKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslr  472
            I+K+++G++YAAS+MYGYFLKRVDQRFQLE+ M +LP+          +V  D       
Sbjct  231  ISKIKLGKLYAASIMYGYFLKRVDQRFQLERTMNILPK----------RVTQDPDPAPAN  280

Query  471  sspSHPEVVSWPDGGMGSRGF--GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
                   +   P  G    GF    E K  RLR+YVM  D ETLQRYATIRSKEAI++IE
Sbjct  281  QLWDPDSLFRIPPDGGDEAGFIDKEESKSYRLRSYVMYLDAETLQRYATIRSKEAISLIE  340

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
              T+ALFG+P+I I   G+ID+S DE+I ++FS L  LVLEAV FGSFLWD E+ V+S+Y
Sbjct  341  SQTQALFGKPDIRIAGDGSIDTSNDEVISLTFSGLTMLVLEAVAFGSFLWDAETDVESKY  400

Query  117  HFV  109
            +FV
Sbjct  401  NFV  403



>ref|XP_008800079.1| PREDICTED: uncharacterized protein LOC103714566 isoform X3 [Phoenix 
dactylifera]
Length=372

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 165/240 (69%), Gaps = 13/240 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +PAI SP+ + +  +   P+++++L  +HSP+A +MIQ+HL+LILG R     N+ VQI+
Sbjct  143  IPAI-SPTSDPNSQVHYWPNQEQKLEAIHSPDALDMIQSHLTLILGERVVGPLNTIVQIS  201

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            +L++G++YAAS+MYGYFLKRVDQRFQLE+ MK LP      D+  Q++  D     L   
Sbjct  202  RLKLGKLYAASIMYGYFLKRVDQRFQLERTMKTLPT-----DTRQQRIFDDLKPNPLWDL  256

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
             S  ++ S           G + K  RLR+YVM  D ETLQRYATIRSKE+I++IEK T+
Sbjct  257  ESMVQISS-----DDDGSDGEDSKSYRLRSYVMYLDAETLQRYATIRSKESISLIEKQTQ  311

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  106
            ALFGRP+I I   G++D+S DEL+ I+F+ L  LVLEAV FGS LW+ ES V+S+YHFV 
Sbjct  312  ALFGRPDIRIAEDGSLDTSNDELVGITFTGLTMLVLEAVAFGSILWEAESYVESKYHFVT  371



>gb|KCW71713.1| hypothetical protein EUGRSUZ_E00224 [Eucalyptus grandis]
Length=465

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 166/240 (69%), Gaps = 9/240 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P IT+ S + +G +D  P+++E+L  +HSPEA+EMIQ+HLSL++G+R     +S +Q +
Sbjct  230  IPKITATS-DPTGRVDYWPNQEEKLESVHSPEAFEMIQSHLSLVVGDRVVGPLDSIIQSS  288

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFL+RVD+RFQLE+ M  LP+G  +    ++     S      S 
Sbjct  289  KIKLGKLYAASIMYGYFLRRVDERFQLERTMNTLPKGYTENRVRLEDSIPTSPFWDPDSL  348

Query  465  pSHPEVVSWPDGGMGSRGFGTEM-KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  289
               P     PD G G     +E  K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T
Sbjct  349  IRIP-----PDDGDGGSFLDSEEGKLYRLRSYVMYLDPETLQRYATIRSKEAISLIEKQT  403

Query  288  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +ALFGRP+I +   G+ID+S DE+I +S S L  L+LEAV FGSFLWD E+ V+S+Y FV
Sbjct  404  QALFGRPDIRVAEDGSIDTSSDEVISLSVSGLTMLILEAVAFGSFLWDAENFVESKYQFV  463



>ref|XP_002518989.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43522.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 167/244 (68%), Gaps = 14/244 (6%)
 Frame = -3

Query  825  LXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQ  652
            L +P +++ S + +G +D  P+++++L  +HSPEA+EMI +HL+L+LG R      + VQ
Sbjct  174  LMIPKVSATS-DPTGRVDFWPNQEQKLESVHSPEAFEMILSHLTLVLGERVVGPLETIVQ  232

Query  651  INKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslr  472
            I+K+++G++YAAS+MYGYFL+RVD+RFQLE+ M  LP+  D+      +   D      R
Sbjct  233  ISKIKLGKLYAASIMYGYFLRRVDERFQLERTMNTLPKDYDE-----NRARYDEPSPMNR  287

Query  471  sspSHPEVVSWPDGGMGSRGF--GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
                   +   PD G    GF    E K  RLR+YVM  D ETLQRYATIRSKEA+++IE
Sbjct  288  LWDPDSLIRIQPDNG----GFMDTVEGKSYRLRSYVMYLDVETLQRYATIRSKEAMSLIE  343

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            K T+ALFGRP+I I   G+ID++ DE+I I+FS L  LVLEAV FGSFLW+ ES V+S+Y
Sbjct  344  KQTQALFGRPDIRIAEDGSIDTANDEVISITFSGLTMLVLEAVAFGSFLWEGESYVESKY  403

Query  117  HFVA  106
            HF++
Sbjct  404  HFIS  407



>ref|XP_008800078.1| PREDICTED: uncharacterized protein LOC103714566 isoform X2 [Phoenix 
dactylifera]
Length=390

 Score =   220 bits (561),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 165/240 (69%), Gaps = 13/240 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +PAI SP+ + +  +   P+++++L  +HSP+A +MIQ+HL+LILG R     N+ VQI+
Sbjct  161  IPAI-SPTSDPNSQVHYWPNQEQKLEAIHSPDALDMIQSHLTLILGERVVGPLNTIVQIS  219

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            +L++G++YAAS+MYGYFLKRVDQRFQLE+ MK LP      D+  Q++  D     L   
Sbjct  220  RLKLGKLYAASIMYGYFLKRVDQRFQLERTMKTLP-----TDTRQQRIFDDLKPNPLWDL  274

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
             S  ++ S           G + K  RLR+YVM  D ETLQRYATIRSKE+I++IEK T+
Sbjct  275  ESMVQISS-----DDDGSDGEDSKSYRLRSYVMYLDAETLQRYATIRSKESISLIEKQTQ  329

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  106
            ALFGRP+I I   G++D+S DEL+ I+F+ L  LVLEAV FGS LW+ ES V+S+YHFV 
Sbjct  330  ALFGRPDIRIAEDGSLDTSNDELVGITFTGLTMLVLEAVAFGSILWEAESYVESKYHFVT  389



>ref|XP_008800077.1| PREDICTED: uncharacterized protein LOC103714566 isoform X1 [Phoenix 
dactylifera]
Length=405

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 165/240 (69%), Gaps = 13/240 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +PAI SP+ + +  +   P+++++L  +HSP+A +MIQ+HL+LILG R     N+ VQI+
Sbjct  176  IPAI-SPTSDPNSQVHYWPNQEQKLEAIHSPDALDMIQSHLTLILGERVVGPLNTIVQIS  234

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            +L++G++YAAS+MYGYFLKRVDQRFQLE+ MK LP      D+  Q++  D     L   
Sbjct  235  RLKLGKLYAASIMYGYFLKRVDQRFQLERTMKTLP-----TDTRQQRIFDDLKPNPLWDL  289

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
             S  ++ S           G + K  RLR+YVM  D ETLQRYATIRSKE+I++IEK T+
Sbjct  290  ESMVQISS-----DDDGSDGEDSKSYRLRSYVMYLDAETLQRYATIRSKESISLIEKQTQ  344

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  106
            ALFGRP+I I   G++D+S DEL+ I+F+ L  LVLEAV FGS LW+ ES V+S+YHFV 
Sbjct  345  ALFGRPDIRIAEDGSLDTSNDELVGITFTGLTMLVLEAVAFGSILWEAESYVESKYHFVT  404



>ref|XP_009145204.1| PREDICTED: uncharacterized protein LOC103868901 [Brassica rapa]
Length=401

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 162/241 (67%), Gaps = 7/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  649
            +P I  P+ + +G ID  P+++E+L  +HS EA+EMIQ+HLS +LG+R+     +S VQI
Sbjct  162  IPQI-KPTSDPAGRIDLWPNQEEKLEVIHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQI  220

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-tslr  472
            +K+++G++YAASVMYGYFL+R+DQR+QLE+ M  LP+  DK     ++            
Sbjct  221  SKIKLGKLYAASVMYGYFLRRIDQRYQLERTMNTLPKRPDKTRERYEEPSPPYPLWDPDS  280

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 PE    PD     R  G E     LR+YV   D +TLQRYATIRSKEA+++IEK 
Sbjct  281  LIRIQPEEYD-PDEYAIQRNEG-ESSSYGLRSYVTYLDSDTLQRYATIRSKEAMSLIEKQ  338

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G +D+S DE++ +SFS L  LVLEAVTFGSFLWD ES V+S+YHF
Sbjct  339  TQALFGRPDIRILEDGKLDTSNDEVLSLSFSGLAMLVLEAVTFGSFLWDAESYVESKYHF  398

Query  111  V  109
            +
Sbjct  399  L  399



>emb|CDP11681.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 162/240 (68%), Gaps = 10/240 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P ITS S + +G +D  P+++++L  +HSPEA+EMI +HLSL+LG R     ++ VQI+
Sbjct  169  IPKITSTS-DPAGRVDFWPNQEQKLESVHSPEAFEMILSHLSLVLGERVVGPLDTIVQIS  227

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQ-QVGGDssdtslrs  469
            K+++G++YAAS+MYGYFL+RVD+R+QLE++M  LP+  +K     +    G         
Sbjct  228  KIKLGKLYAASIMYGYFLRRVDERYQLERSMNTLPEKPNKGQPFFRGPTPGKQLWAPESL  287

Query  468  spSHPEVVSWPDGGMGS-RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                P+     D   G     G + K  RLR+YVM  D ETLQRYATIRSKEA+++IEK 
Sbjct  288  IQIPPD-----DADDGEPMDLGGDGKSYRLRSYVMYLDAETLQRYATIRSKEAVSLIEKQ  342

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G++D+S+DE+  ++FS L  LVLEAV FGSFLWD E   +S+YHF
Sbjct  343  TQALFGRPDIRIAEDGSVDASRDEVTSLTFSGLTMLVLEAVAFGSFLWDAEGYAESKYHF  402



>ref|XP_003534296.1| PREDICTED: uncharacterized protein LOC100802337 [Glycine max]
Length=408

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 167/247 (68%), Gaps = 21/247 (9%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I++ S + +G +D  P+++ +L  +HSPEA EMIQ+HLSL+LG+R      + VQI+
Sbjct  171  IPKISATS-DPTGRVDLWPNQELKLEAVHSPEALEMIQSHLSLVLGDRLVGPLQTVVQIS  229

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDS------GIQQVGGDssd  484
            K+++G++YAAS+MYGYFLKRVD+RFQLE++M +LP+   K  S      GI+    DS  
Sbjct  230  KIKLGKLYAASIMYGYFLKRVDERFQLERSMGILPKDFGKAKSYDEPSPGIKLWDPDSLI  289

Query  483  tslrsspSHPEVVSWPDGGMGSRGF--GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  310
            T          V  + D G     +    E K  RLR YVM  D ETLQR AT+RSKEAI
Sbjct  290  T----------VQDYDDEGYNDSDYMDTDEDKSFRLRAYVMQLDAETLQRLATVRSKEAI  339

Query  309  NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            ++IEK T+ALFGRP+I ++  G+I++S DEL+ ++FS L  LVLEA+ FGSFLWD E+ V
Sbjct  340  SLIEKQTQALFGRPDIRVSDDGSIETSNDELLSLTFSGLTMLVLEAIAFGSFLWDKENYV  399

Query  129  DSRYHFV  109
            +S+Y F+
Sbjct  400  ESKYPFL  406



>emb|CDY35549.1| BnaA05g16370D [Brassica napus]
Length=402

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 160/241 (66%), Gaps = 6/241 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  649
            +P I  P+ + +G ID  P+++E+L  +HS EA+EMIQ+HLS +LG+R+     +S VQI
Sbjct  162  IPQI-KPTSDPAGRIDLWPNQEEKLEVIHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQI  220

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-tslr  472
            +K+++G++YAASVMYGYFL+R+DQR+QLE+ M  LP+  DK     ++            
Sbjct  221  SKIKLGKLYAASVMYGYFLRRIDQRYQLERTMNTLPKRPDKTRERYEEPSPPYPLWDPDS  280

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 PE    PD     R          LR+YV   D +TLQRYATIRSKEA+++IEK 
Sbjct  281  LIRIQPEEYD-PDEYAIQRNEEESSSSYGLRSYVTYLDSDTLQRYATIRSKEAMSLIEKQ  339

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G +D+S DE++ +SFS L  LVLEAVTFGSFLWD ES V+S+YHF
Sbjct  340  TQALFGRPDIRILEDGKLDTSNDEVLSLSFSGLAMLVLEAVTFGSFLWDAESYVESKYHF  399

Query  111  V  109
            +
Sbjct  400  L  400



>emb|CDY29940.1| BnaC05g28960D [Brassica napus]
Length=401

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/241 (49%), Positives = 161/241 (67%), Gaps = 7/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  649
            +P I  P+ + +G ID  P+++E+L  +HS EA+EMIQ+HLS +LG+R+     +S VQI
Sbjct  162  IPQI-KPTSDPAGRIDLWPNQEEKLEVIHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQI  220

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-tslr  472
            +K+++G++YAASVMYGYFL+R+DQR+QLE+ M  LP+  DK     ++            
Sbjct  221  SKIKLGKLYAASVMYGYFLRRIDQRYQLERTMNTLPKRPDKTRERYEEPSPPYPLWDPDS  280

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 PE    PD     R    E     LR+YV   D +TLQRYATIRSKEA+++IEK 
Sbjct  281  LIRIQPEEYD-PDEYAIQRN-EDESSSYGLRSYVTYLDSDTLQRYATIRSKEAMSLIEKQ  338

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G +D+S DE++ +SFS L  LVLEAVTFGSFLWD ES V+S+YHF
Sbjct  339  TQALFGRPDIRILEDGKLDTSNDEVLSLSFSGLATLVLEAVTFGSFLWDAESYVESKYHF  398

Query  111  V  109
            +
Sbjct  399  L  399



>ref|XP_006415245.1| hypothetical protein EUTSA_v10007794mg [Eutrema salsugineum]
 gb|ESQ33598.1| hypothetical protein EUTSA_v10007794mg [Eutrema salsugineum]
Length=405

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 162/241 (67%), Gaps = 7/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  649
            +P I  P+ + +G +D  P+++E+L  +HS EA+EMIQ+HLS +LG+R+     +S VQI
Sbjct  166  IPQI-KPTSDPAGRVDLWPNQEEKLEVIHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQI  224

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-tslr  472
            +K+++G++YAASVMYGYFL+R+DQR+QLE+ M  LP+  +K     ++            
Sbjct  225  SKIKLGKLYAASVMYGYFLRRIDQRYQLERTMNTLPKRPEKTRERYEEPSPPYPLWDPDS  284

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 PE    PDG    R    E     LR+YV   D +TLQRYATIRSKEA+++IEK 
Sbjct  285  LIRIQPEEYD-PDGYAIERD-ENESSSYGLRSYVTYLDSDTLQRYATIRSKEAMSLIEKQ  342

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G +D+S DE++ +SFS L  LVLEAVTFGSFLWD ES V+S+YHF
Sbjct  343  TQALFGRPDIRILEDGKLDTSNDEVLSLSFSGLAMLVLEAVTFGSFLWDAESYVESKYHF  402

Query  111  V  109
            +
Sbjct  403  L  403



>gb|KFK44959.1| hypothetical protein AALP_AA1G325800 [Arabis alpina]
Length=405

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 161/241 (67%), Gaps = 7/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  649
            +P I  P+ + +G +D  P+++E+L  +HS EA+EMIQ+HLS +LG+R+     +S VQI
Sbjct  166  IPQI-KPTSDPAGRVDLWPNQEEKLEVIHSAEAFEMIQSHLSSVLGDRTAVGPLSSIVQI  224

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-tslr  472
            +K+++G++YAASVMYGYFL+R+D R+QLE+ MK LP+  +K     ++            
Sbjct  225  SKIKLGKLYAASVMYGYFLRRIDSRYQLERTMKTLPKRSEKTRERFEEPSPPYPLWDPDS  284

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 PE    PD     R    E   S LR YVM  D +TLQRYATIRSKEA+++IEK 
Sbjct  285  LIRIQPEEYD-PDEYAIQRN-EDESSSSGLRAYVMQLDSDTLQRYATIRSKEAMSLIEKQ  342

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G +D+S DE++ +S S L  LVLEAV+FGSFLWD E+ V+S+YHF
Sbjct  343  TQALFGRPDIRILEDGKLDTSNDEILSLSVSGLAMLVLEAVSFGSFLWDAETYVESKYHF  402

Query  111  V  109
            +
Sbjct  403  L  403



>ref|XP_009413223.1| PREDICTED: uncharacterized protein LOC103994576 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=402

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 165/240 (69%), Gaps = 13/240 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
            +P +T+ S + +  +D+ P+++ +L  +HSP+A EMIQ+HL+LILG R     N+  QI+
Sbjct  173  IPTVTT-STDPTYRVDSWPNQEHKLESMHSPDALEMIQSHLTLILGERVGGPLNTVAQIS  231

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            KL++G++YAAS+MYGYFLKRVD+R+QLE+ MK LP     +  G Q++  +     L   
Sbjct  232  KLKLGKLYAASIMYGYFLKRVDERYQLERTMKTLP----TKPRG-QRIFDELKPNPLWDL  286

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
             S  ++ S           G E KP RLR+YVM  D ETLQRYATIRSKE+I++IEK T+
Sbjct  287  ESMVQISS-----DDDDFDGDETKPYRLRSYVMYLDAETLQRYATIRSKESISLIEKQTQ  341

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  106
            ALFGRP+I I   G++++  DE++ I+FS L  LVLEAV FG+FLW+ E  V+S++HF++
Sbjct  342  ALFGRPDIRIADDGSLETPNDEVVGITFSGLTMLVLEAVAFGTFLWEAEGYVESKFHFLS  401



>ref|XP_009413222.1| PREDICTED: uncharacterized protein LOC103994576 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=406

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 165/240 (69%), Gaps = 13/240 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
            +P +T+ S + +  +D+ P+++ +L  +HSP+A EMIQ+HL+LILG R     N+  QI+
Sbjct  177  IPTVTT-STDPTYRVDSWPNQEHKLESMHSPDALEMIQSHLTLILGERVGGPLNTVAQIS  235

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            KL++G++YAAS+MYGYFLKRVD+R+QLE+ MK LP     +  G Q++  +     L   
Sbjct  236  KLKLGKLYAASIMYGYFLKRVDERYQLERTMKTLP----TKPRG-QRIFDELKPNPLWDL  290

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
             S  ++ S           G E KP RLR+YVM  D ETLQRYATIRSKE+I++IEK T+
Sbjct  291  ESMVQISS-----DDDDFDGDETKPYRLRSYVMYLDAETLQRYATIRSKESISLIEKQTQ  345

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  106
            ALFGRP+I I   G++++  DE++ I+FS L  LVLEAV FG+FLW+ E  V+S++HF++
Sbjct  346  ALFGRPDIRIADDGSLETPNDEVVGITFSGLTMLVLEAVAFGTFLWEAEGYVESKFHFLS  405



>gb|KHN40428.1| hypothetical protein glysoja_000926 [Glycine soja]
Length=406

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 162/240 (68%), Gaps = 11/240 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I++ S + +G +D  P+++ +L  +HSPEA+EMIQ+HLSL+LG+R      + VQI+
Sbjct  172  IPKISATS-DPTGRVDLWPNQELKLEGVHSPEAFEMIQSHLSLVLGDRLVGPLQTVVQIS  230

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKR+D+RFQLE++M  LP+   K  S  +   G          
Sbjct  231  KIKLGKLYAASIMYGYFLKRIDERFQLERSMGTLPKDFGKAKSFDEPSPGIKLWDPDSLI  290

Query  465  pSHPEVVSWPDGGMGSRGFGT-EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  289
              H       D    S    T E +  RLR YVM  D ETLQR AT+RSKEAI++IEK T
Sbjct  291  IVH-------DYDNDSDHMDTDEGRSFRLRAYVMQLDAETLQRLATVRSKEAISLIEKQT  343

Query  288  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +ALFGRP+I ++  G+I++S DEL+ ++FS L  LVLEA+ FGSFLWD E+ V+S+Y F+
Sbjct  344  QALFGRPDIRVSEDGSIETSNDELLSLTFSGLTMLVLEALAFGSFLWDKENYVESKYPFL  403



>ref|XP_009804854.1| PREDICTED: uncharacterized protein LOC104250017 [Nicotiana sylvestris]
Length=405

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/243 (46%), Positives = 165/243 (68%), Gaps = 15/243 (6%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
            +P I+  S   +GS+   P+++++L  +HS +A+EMI +H+S++LG R     +S VQI+
Sbjct  170  IPKISETSV-PTGSVGFWPNQEQKLESIHSADAFEMIVSHISIVLGEREVGPLDSIVQIS  228

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVD+R+QLE++M   P+          Q+  +  + +    
Sbjct  229  KVKLGKLYAASIMYGYFLKRVDERYQLERSMSKPPKSF--------QISTNPDEPAAPRQ  280

Query  465  pSHPE--VVSWPDGG--MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
               PE  +  +P+ G   G   F  E K  RLR+YVM  D ETLQRYAT+RSKEAI++IE
Sbjct  281  LWDPESLIEIYPEDGDREGLADFDIEDKSQRLRSYVMYLDAETLQRYATLRSKEAISVIE  340

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            K T+ALFGRP+I ++  GT+D S DE++ +++S L  LVLEAV FGSFLW+ ES V+S+Y
Sbjct  341  KQTQALFGRPDIKVSDDGTLDVSNDEVLSVTYSGLTMLVLEAVAFGSFLWEAESYVESKY  400

Query  117  HFV  109
            H +
Sbjct  401  HII  403



>gb|ACN34329.1| unknown [Zea mays]
Length=239

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 160/239 (67%), Gaps = 11/239 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
             PA+ SP       I  LP+++++L  +HS +A+EMIQNHL+LI+G +  S  ++ V+I+
Sbjct  8    TPAL-SPGGGPVRDISALPNQEDKLRNIHSADAFEMIQNHLNLIMGEKIASPPDTVVEIS  66

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
             L +G++YAAS+MYGYFLKRVD+RFQLEK MK LP   +      QQ+  ++   +    
Sbjct  67   NLNLGKLYAASIMYGYFLKRVDERFQLEKTMKTLPPKPN------QQIVFENLQPNPFWD  120

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
                  ++ PDG   S     +  P++LR+YV   D +TLQRYATIRSKEA+++IEK T+
Sbjct  121  MESLVQIT-PDGEEISLD-DEKSNPNKLRSYVSQLDADTLQRYATIRSKEAVSLIEKQTQ  178

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ALFGRP+I +   G++++    +I I+F+ L  LVLEAV FGSFLW+ ES V+S+YHFV
Sbjct  179  ALFGRPDIKVLDDGSVNAKDGRMITITFTELNHLVLEAVAFGSFLWEAESYVESKYHFV  237



>ref|XP_004245960.1| PREDICTED: uncharacterized protein LOC101262445 [Solanum lycopersicum]
Length=402

 Score =   210 bits (535),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 168/244 (69%), Gaps = 17/244 (7%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
            +P I+  S + +G++   P+++++L  +HSP+A+EMI +H++++LG R+    +S VQ++
Sbjct  167  IPKISETS-DPTGNVGYWPNQEQKLESVHSPDAFEMIISHITIVLGERAVGPLDSIVQMS  225

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVD+R+QLE+++   P+          Q+  +  + +    
Sbjct  226  KIKLGKLYAASIMYGYFLKRVDERYQLERSVSKPPESF--------QISTNPDEPAAPRQ  277

Query  465  pSHPE--VVSWPDGGMGSRGFGT---EMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
               P+  +  +P+ G    GF     E KP RLR+YVM  D +TLQRYAT+RSKEA+ +I
Sbjct  278  LWDPDSLIEIYPEDG-DREGFAVSDIEGKPERLRSYVMYLDADTLQRYATLRSKEAVTVI  336

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EK T+ALFGRP+I +T  GT+D S DE++ +++S L  LVLEAV+FGSFLW+ E  V+S+
Sbjct  337  EKQTQALFGRPDIKVTGDGTLDVSNDEVLSVTYSGLTMLVLEAVSFGSFLWETEGYVESK  396

Query  120  YHFV  109
            YH +
Sbjct  397  YHII  400



>gb|EYU43718.1| hypothetical protein MIMGU_mgv1a007450mg [Erythranthe guttata]
Length=407

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/254 (44%), Positives = 168/254 (66%), Gaps = 30/254 (12%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I + S + +  +D+ P+++E+L  +HS EA+EMI +HL+L+LG R     ++ +Q++
Sbjct  165  IPKIMATS-DPAIRVDSWPNQEEKLESVHSAEAFEMILSHLALVLGERVVGPPDTIIQMS  223

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAASVMYGYFL+RVD+R+QLE++M  LP+G  + +  ++              
Sbjct  224  KIKLGKLYAASVMYGYFLRRVDERYQLERSMNTLPEGFGEFEDRVR------------FE  271

Query  465  pSHPEVVSW-PDGGM-------GSRGFGT-------EMKPSRLRTYVMSFDGETLQRYAT  331
               P+   W PD  +       G  G  T       E K  +LR+YVM  D ETLQRYAT
Sbjct  272  EPTPDKQQWDPDSLIRIYPNEDGEYGASTVEDSSTNEDKSYKLRSYVMYLDAETLQRYAT  331

Query  330  IRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFL  151
            IRSKEAI++IEK T+ALFGRP+I +T  G++D+S DE++ ++FS L  LVLEAV FGSFL
Sbjct  332  IRSKEAISLIEKQTQALFGRPDIKVTEDGSLDASNDEIVSLTFSGLTMLVLEAVAFGSFL  391

Query  150  WDVESSVDSRYHFV  109
            WD E+ V+S+Y F+
Sbjct  392  WDNENFVESKYPFI  405



>gb|EMS68345.1| hypothetical protein TRIUR3_07699 [Triticum urartu]
Length=391

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 159/239 (67%), Gaps = 9/239 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
             PA++S S    G + +LP+++ +L  +HS +A EMIQNHL+LI+G ++ A  ++ V+I+
Sbjct  158  TPALSS-SGGPVGDVSSLPNQEYKLQNIHSQDALEMIQNHLNLIMGEQAAAPLDTVVEIS  216

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
             L +G++YAAS+MYGYFLKRVD+RFQLEK MK LP  L+      +++  +         
Sbjct  217  NLNLGKLYAASIMYGYFLKRVDERFQLEKTMKTLPPSLN------EKLFTERDIKPNPFM  270

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
                 V   PDG M       E  P++LR+YV   D +TLQRYATIRSKE++++IEK T+
Sbjct  271  DMESLVRMTPDGEMVDVEEDEETNPNKLRSYVSRLDADTLQRYATIRSKESVSLIEKQTQ  330

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ALFGRP+I +   G++++   + + ++F+ L  LVLEA  FG+FLW+ ES V+S+YHFV
Sbjct  331  ALFGRPDIKVLDDGSVNAKDGKTVTLTFTELTHLVLEAAGFGAFLWEAESHVESKYHFV  389



>ref|XP_006352932.1| PREDICTED: uncharacterized protein LOC102595128 [Solanum tuberosum]
Length=402

 Score =   210 bits (534),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 168/244 (69%), Gaps = 17/244 (7%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
            +P I+  S + +G++   P+++++L  +HSP+A+EMI +H++++LG R+    +S VQ++
Sbjct  167  IPKISETS-DPTGNVGYWPNQEQKLESVHSPDAFEMIISHITIVLGERAVGPLDSIVQMS  225

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVD+R+QLE+++   P+          Q+  +  + +    
Sbjct  226  KIKLGKLYAASIMYGYFLKRVDERYQLERSVSKPPESF--------QISTNPDEPAAPRQ  277

Query  465  pSHPE--VVSWPDGGMGSRGFGT---EMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
               P+  +  +P+ G    GF     E KP RLR+YVM  D +TLQRYAT+RSKEA+ +I
Sbjct  278  LWDPDSLIEIYPEDG-DREGFAVSDIEGKPERLRSYVMYLDADTLQRYATLRSKEAVTVI  336

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            EK T+ALFGRP+I ++  GT+D S DE++ +++S L  LVLEAV FGSFLW+ ES V+S+
Sbjct  337  EKQTQALFGRPDIKVSGDGTLDVSNDEVLSVTYSGLTMLVLEAVAFGSFLWETESYVESK  396

Query  120  YHFV  109
            YH +
Sbjct  397  YHII  400



>ref|XP_007158234.1| hypothetical protein PHAVU_002G135300g [Phaseolus vulgaris]
 gb|ESW30228.1| hypothetical protein PHAVU_002G135300g [Phaseolus vulgaris]
Length=408

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 165/247 (67%), Gaps = 18/247 (7%)
 Frame = -3

Query  825  LXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQ  652
            L +P +++ S + +G +D  P+++ +L  +HSPEA+EMIQ+HLSL+LG+R      + VQ
Sbjct  170  LMIPKLSATS-DPTGRVDLWPNQELKLEAVHSPEAFEMIQSHLSLVLGDRLVGPLQAIVQ  228

Query  651  INKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDS------GIQQVGGDs  490
            I+K+++G++YAAS+MYGYFLKRVD+RFQLE+++  LP+ L K  S      GI+    DS
Sbjct  229  ISKIKLGKLYAASIMYGYFLKRVDERFQLERSVGTLPKDLGKTKSFEEPSPGIKLWDPDS  288

Query  489  sdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  310
                            + D         TE K  RLR YVM  D ++LQR AT+RSKEAI
Sbjct  289  LIIVQDYDDDSYSDSDYMD---------TEGKSFRLRAYVMQLDPDSLQRLATVRSKEAI  339

Query  309  NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            ++IEK T+ALFGRP+I ++  G+I++S DEL+ ++FS +  L+LEAV FGSFLWD E  V
Sbjct  340  SLIEKQTQALFGRPDIRVSNDGSIETSNDELLSLTFSGMTMLILEAVAFGSFLWDKEKYV  399

Query  129  DSRYHFV  109
            +S+Y F+
Sbjct  400  ESKYPFL  406



>ref|XP_010540738.1| PREDICTED: uncharacterized protein LOC104814412 [Tarenaya hassleriana]
Length=407

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 161/242 (67%), Gaps = 7/242 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I   S + +G +D  P+++++L  +HS EA+EMIQ+HL+L+LG+R     NS VQI+
Sbjct  166  IPQIKQTS-DPAGRVDFWPNQEQKLEAVHSAEAFEMIQSHLTLVLGDRMVGPLNSIVQIS  224

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdt--slr  472
            K+++G++YAASVMYGYFL+RVDQR+QLE+ M  LP    ++     +             
Sbjct  225  KIKLGKLYAASVMYGYFLRRVDQRYQLERKMNTLPSKRQEKTRERYEEPSPPYPLWDPDS  284

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPS-RLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
                 PE    PD     R    E + S RLR+YVM  D ETLQRYATIRSKEA+++IE+
Sbjct  285  LIRIQPEDYD-PDEYAMDREAEEEGESSYRLRSYVMYLDPETLQRYATIRSKEAMSLIER  343

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYH  115
             T+ALFGRP+I I   G +++S DE++ ++FS L  LVLEAV FGSFLWD ES V+S+YH
Sbjct  344  QTQALFGRPDIRILEDGKLNTSNDEVLSLTFSGLAMLVLEAVAFGSFLWDAESYVESKYH  403

Query  114  FV  109
            F+
Sbjct  404  FL  405



>dbj|BAJ87444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/256 (43%), Positives = 162/256 (63%), Gaps = 11/256 (4%)
 Frame = -3

Query  870  FCMPWWCRNSWMLMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSL  691
            +C   W    +M   + +    SPS      I +LP+++ +L  +HS +A EMIQNHL+L
Sbjct  144  YC---WILFKFMENDISMTPALSPSGGPVRDISSLPNQEYKLQSIHSQDALEMIQNHLNL  200

Query  690  ILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDS  517
            I+G ++ A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQLEK MK LP  L+    
Sbjct  201  IMGEQAAAPLDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQLEKTMKTLPPSLN----  256

Query  516  GIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRY  337
              +++  +              V   PDG M       E  P++LR+YV   D +TLQRY
Sbjct  257  --EKLFTERDIKPNPFMDMESLVRMTPDGEMVDVEEDEETNPNKLRSYVSRLDADTLQRY  314

Query  336  ATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGS  157
            ATIRSKE++++IEK T+ALFGRP+I +   G++++   + + ++F+ L  LVLEA  FG+
Sbjct  315  ATIRSKESVSLIEKQTQALFGRPDIKVLDDGSVNAKDGKTVTLTFTELTHLVLEAAGFGA  374

Query  156  FLWDVESSVDSRYHFV  109
            FLW+ ES V+S+YHFV
Sbjct  375  FLWEAESHVESKYHFV  390



>ref|NP_001053731.1| Os04g0595100 [Oryza sativa Japonica Group]
 emb|CAE03929.1| OSJNba0093F12.3 [Oryza sativa Japonica Group]
 emb|CAD41566.3| OSJNBa0006A01.21 [Oryza sativa Japonica Group]
 dbj|BAF15645.1| Os04g0595100 [Oryza sativa Japonica Group]
 gb|EAZ31841.1| hypothetical protein OsJ_16003 [Oryza sativa Japonica Group]
 dbj|BAG90593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=405

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 153/225 (68%), Gaps = 10/225 (4%)
 Frame = -3

Query  777  IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMY  604
            I +LP+++++L  +HSP+A EMIQNHL+LI+G +  A  ++ V+I+ L +G++YAAS+MY
Sbjct  187  ISSLPNQEDRLQSIHSPDALEMIQNHLNLIMGEKVAAPLDTVVEISNLNLGKLYAASIMY  246

Query  603  GYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGM  424
            GYFLKRVD+RFQLEKNMK LP    K+   ++ +  +              V   PDG  
Sbjct  247  GYFLKRVDERFQLEKNMKTLPPN-PKQQIVLENLKPNPFWDMESL------VQITPDGEE  299

Query  423  GSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQG  244
                   E  P++LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I +   G
Sbjct  300  IDLD-DEESNPNKLRSYVSRLDADTLQRYATIRSKEAVSLIEKQTQALFGRPDIKVLDDG  358

Query  243  TIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ++++   ++I I+F  L  LVLEA  FGSFLW+ ES V+S+YHFV
Sbjct  359  SVNAKDGQMITITFIELTHLVLEAAAFGSFLWEAESHVESKYHFV  403



>ref|XP_004976664.1| PREDICTED: uncharacterized protein LOC101761297 [Setaria italica]
Length=402

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 159/241 (66%), Gaps = 15/241 (6%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
             PA+ +P       I +LP+++++L  +HSP+A+EMIQNHL+LI+G +  A  ++ V+I+
Sbjct  171  TPAL-APGGGPVRDISSLPNQEDKLQSIHSPDAFEMIQNHLNLIMGEKIAAPLDTVVEIS  229

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
             L +G++YAAS+MYGYFLKRVD+RFQLEK MK LP    K+    + +  +         
Sbjct  230  NLNLGKLYAASIMYGYFLKRVDERFQLEKTMKTLPPN-PKQQIVFENLKPNPFWDMESLV  288

Query  465  pSHP--EVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
               P  E +S  D          E  P++LR+YV   D +TLQRYATIRSKEA+++IEK 
Sbjct  289  QITPDGEEISLDD---------EESNPNKLRSYVSQLDADTLQRYATIRSKEAVSLIEKQ  339

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T++LFGRP+I +   G++++   ++I I+F  L  LVLEAV FGSFLW+ ES V+S+YHF
Sbjct  340  TQSLFGRPDIKVLDDGSVNARDGQMITITFIELNHLVLEAVAFGSFLWEAESYVESKYHF  399

Query  111  V  109
            V
Sbjct  400  V  400



>ref|NP_001242537.1| uncharacterized protein LOC100810147 [Glycine max]
 gb|ACU21518.1| unknown [Glycine max]
Length=406

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/240 (47%), Positives = 160/240 (67%), Gaps = 11/240 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I++ S + +G +D  P+++ +L  +HSPEA+EMIQ+HLSL+LG+R      + VQI+
Sbjct  172  IPKISATS-DPTGRVDLWPNQELKLEGVHSPEAFEMIQSHLSLVLGDRLVGPLQTVVQIS  230

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKR+D+RFQLE++M  LP+   K  S  +   G          
Sbjct  231  KIKLGKLYAASIMYGYFLKRIDERFQLERSMGTLPKDFGKAKSFDEPSPGIKLWDPDSLI  290

Query  465  pSHPEVVSWPDGGMGSRGFGT-EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  289
              H       D    S    T E +  RLR YVM  D ETLQR AT+RSKEAI++IEK T
Sbjct  291  IVH-------DYDNDSDHMDTDEGRSFRLRAYVMQLDAETLQRLATVRSKEAISLIEKQT  343

Query  288  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +AL GRP+I ++  G+I++S DEL+ ++FS L  LVLEA+ FGSFLWD E+ V+S Y F+
Sbjct  344  QALVGRPDIRVSEDGSIETSNDELLSLTFSGLTMLVLEALAFGSFLWDKENYVESEYPFL  403



>ref|XP_002448446.1| hypothetical protein SORBIDRAFT_06g027240 [Sorghum bicolor]
 gb|EES12774.1| hypothetical protein SORBIDRAFT_06g027240 [Sorghum bicolor]
Length=402

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 163/258 (63%), Gaps = 17/258 (7%)
 Frame = -3

Query  870  FCMPWWCRNSWMLMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSL  691
            +C   W    +M   + + +  SP       I  LP+++++L  +HS +A+EMIQNHL+L
Sbjct  156  YC---WIIYRFMDNDISMTSALSPGGGPVRDISALPNQEDKLQSIHSADAFEMIQNHLNL  212

Query  690  ILGNRSNA--NSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDS  517
            I+G +  A  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQLEK MK LP    K+  
Sbjct  213  IMGEKIAAPPDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQLEKTMKTLPPN-PKQQI  271

Query  516  GIQQVGGDssdtslrsspSHP--EVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQ  343
              + +  +            P  E +S  D G           P++L++YV   D +TLQ
Sbjct  272  VFENLQPNPFWDMESLVQITPDGEEISLDDEGSN---------PNKLKSYVSKLDADTLQ  322

Query  342  RYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTF  163
            RYATIRSKEA+++IEK T+ALFGRP+I +   G++++    ++ I+F+ L  LVLEAVTF
Sbjct  323  RYATIRSKEAVSLIEKQTQALFGRPDIKVLDDGSVNAKDGRMVTITFTELNHLVLEAVTF  382

Query  162  GSFLWDVESSVDSRYHFV  109
            GSFLW+ ES V+S+YHFV
Sbjct  383  GSFLWEAESYVESKYHFV  400



>gb|EEC77902.1| hypothetical protein OsI_17223 [Oryza sativa Indica Group]
Length=420

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 153/227 (67%), Gaps = 14/227 (6%)
 Frame = -3

Query  777  IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMY  604
            I +LP+++++L  +HSP+A EMIQNHL+LI+G +  A  ++ V+I+ L +G++YAAS+MY
Sbjct  202  ISSLPNQEDRLQSIHSPDALEMIQNHLNLIMGEKVAAPLDTVVEISNLNLGKLYAASIMY  261

Query  603  GYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHP--EVVSWPDG  430
            GYFLKRVD+RFQLEKNMK LP    K+   ++ +  +            P  E +   D 
Sbjct  262  GYFLKRVDERFQLEKNMKTLPPN-PKQQIVLENLKPNPFWDMESLVQITPDGEEIDLDD-  319

Query  429  GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITP  250
                     E  P++LR+YV   D +TLQRYATIRSKEA+++IEK T+ALFGRP+I +  
Sbjct  320  --------EESNPNKLRSYVSRLDADTLQRYATIRSKEAVSLIEKQTQALFGRPDIKVLD  371

Query  249  QGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
             G++++   ++I I+F  L  LVLEA  FGSFLW+ ES V+S+YHFV
Sbjct  372  DGSVNAKDGQMITITFIELTHLVLEAAAFGSFLWEAESHVESKYHFV  418



>ref|XP_009607216.1| PREDICTED: uncharacterized protein LOC104101473 [Nicotiana tomentosiformis]
Length=405

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/243 (45%), Positives = 165/243 (68%), Gaps = 15/243 (6%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
            +P I+  S + +GS+   P+++++L  +HS +A+EMI +H+S++LG R     +S VQI+
Sbjct  170  IPKISETS-DPTGSVGFWPNQEQKLESIHSADAFEMILSHISIVLGEREVGPLDSIVQIS  228

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVD+R+QLE++M   P+          Q+  +  + +    
Sbjct  229  KVKLGKLYAASIMYGYFLKRVDERYQLERSMSKPPESF--------QISTNPDEPAAPRQ  280

Query  465  pSHPE--VVSWPDGG--MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
               PE  +  +P+ G   G      E K  RLR+YVM  D ETLQRYAT+RSKEAI++IE
Sbjct  281  LWDPESLIEIYPEDGDREGLADSDIEGKSQRLRSYVMYLDAETLQRYATLRSKEAISVIE  340

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            K T+ALFG+P+I ++  GT+D S DE++ +++S L  LVLEAV FGSFLW+ ES V+S+Y
Sbjct  341  KQTQALFGQPDIKVSDDGTLDVSNDEVLSVTYSGLTMLVLEAVAFGSFLWEAESYVESKY  400

Query  117  HFV  109
            H +
Sbjct  401  HII  403



>gb|EMT04061.1| hypothetical protein F775_32804 [Aegilops tauschii]
Length=392

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 159/238 (67%), Gaps = 12/238 (5%)
 Frame = -3

Query  804  SPSQNSSG----SIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINK  643
            +P+ +SSG     + +LP+++ +L  +HS +A EMIQNHL+LI+G ++ A  ++ V+I+ 
Sbjct  159  TPALSSSGGPVRDVSSLPNQEYKLQSIHSQDALEMIQNHLNLIMGEQAAAPLDTVVEISN  218

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrssp  463
            L +G++YAAS+MYGYFLKRVD+RFQLEK MK LP  L+      +++  +          
Sbjct  219  LNLGKLYAASIMYGYFLKRVDERFQLEKTMKTLPPSLN------EKLFTERDIKPNPFMD  272

Query  462  SHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEA  283
                V   PDG M       E  P++LR+YV   D +TLQRYATIRSKE++++IEK T+A
Sbjct  273  MESLVRMTPDGEMVDVEEDEETNPNKLRSYVSRLDADTLQRYATIRSKESVSLIEKQTQA  332

Query  282  LFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            LFGRP+I +   G++++   + + ++F+ L  LVLEA  FG+FLW+ ES V+S+YHFV
Sbjct  333  LFGRPDIKVLDDGSVNAKDGKTVTLTFTELTHLVLEAAGFGAFLWEAESHVESKYHFV  390



>ref|XP_010677383.1| PREDICTED: uncharacterized protein LOC104893042 [Beta vulgaris 
subsp. vulgaris]
Length=415

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/255 (46%), Positives = 164/255 (64%), Gaps = 30/255 (12%)
 Frame = -3

Query  825  LXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQ  652
            L +P I S S + +G +D  P+++++L  +HS EA EMIQ+HLSL+LG R      S V+
Sbjct  175  LMIPEI-SQSPDITGRVDFWPNQEQKLESVHSTEAIEMIQSHLSLVLGERLVGPLQSLVE  233

Query  651  INKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslr  472
            I+K+++G++YAAS+MYGYFL+RVDQR+QLE+ MK LP+   K  +  Q            
Sbjct  234  ISKIKLGKLYAASIMYGYFLRRVDQRYQLERAMKTLPEDFGKSTTRFQD-----------  282

Query  471  sspSHPEVVSW-PDG---------GMGSRGFGTEM---KPSRLRTYVMSFDGETLQRYAT  331
               S P+   W PD           M S G   ++   K  +LR+YVM  D +TLQRYAT
Sbjct  283  ---SVPQSPFWDPDSLIQIPADEEDMVSYGEPLDIGDGKSYKLRSYVMYLDTDTLQRYAT  339

Query  330  IRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFL  151
            +RSKEA+++IE+ T++LFGRP+I I   G +++  DE+I ISFS L  LVLEAV FGSFL
Sbjct  340  LRSKEAMSLIERQTQSLFGRPDIKIAESGVLETQNDEIISISFSGLTMLVLEAVAFGSFL  399

Query  150  WDVESSVDSRYHFVA  106
            WD E  V+S+Y FV+
Sbjct  400  WDSEDYVESKYSFVS  414



>ref|XP_006653725.1| PREDICTED: uncharacterized protein LOC102702753 [Oryza brachyantha]
Length=399

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 157/239 (66%), Gaps = 11/239 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
             PA+ SP       I +LP+++++L  +HSP+A EMIQNHL+LI+G +  A  ++ V+I+
Sbjct  168  TPAL-SPLGGPVRDISSLPNQEDKLQSIHSPDALEMIQNHLNLIMGEKVAAPLDTVVEIS  226

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
             L +G++YAAS+MYGYFLKRVD+RFQLEKNMK LP    K+    + +  +         
Sbjct  227  NLNLGKLYAASIMYGYFLKRVDERFQLEKNMKTLPPN-PKQQIVFENLKPNPFWDMESL-  284

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
                 V   PDG         E  P++LR+YV   D +TLQRYATIRSKE++++IEK T+
Sbjct  285  -----VQITPDGEEIDLD-DEESNPNKLRSYVSRLDADTLQRYATIRSKESVSLIEKQTQ  338

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ALFGRP+I +   G++++   ++I I+F  L  LVLEA  FGSFLW+ ES ++S+YHFV
Sbjct  339  ALFGRPDIKVLDDGSVNAKDGQMITITFIELTHLVLEAAAFGSFLWEAESHIESKYHFV  397



>ref|NP_001145533.1| uncharacterized protein LOC100278968 [Zea mays]
 gb|ACG48280.1| hypothetical protein [Zea mays]
Length=400

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/256 (44%), Positives = 164/256 (64%), Gaps = 13/256 (5%)
 Frame = -3

Query  870  FCMPWWCRNSWMLMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSL  691
            +C   W    +M   + +    SP       I  LP+++++L  +HS +A+EMIQNHL+L
Sbjct  154  YC---WVTYRFMENDIYMTPALSPGGGPVRDISALPNQEDKLRNIHSADAFEMIQNHLNL  210

Query  690  ILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDS  517
            I+G +  S  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQLEK MK LP   +    
Sbjct  211  IMGEKIASPPDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQLEKTMKTLPPKPN----  266

Query  516  GIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRY  337
              QQ+  ++   +          ++ PDG   S     +  P++LR+YV   D +TLQRY
Sbjct  267  --QQIVFENLQPNPFWDMESLVQIT-PDGEEISLD-DEKSNPNKLRSYVSQLDADTLQRY  322

Query  336  ATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGS  157
            ATIRSKEA+++IEK T+ALFGRP+I +   G++++    +I I+F+ L  LVLEAV FGS
Sbjct  323  ATIRSKEAVSLIEKQTQALFGRPDIKVLDDGSVNAKDGRMITITFTELNHLVLEAVAFGS  382

Query  156  FLWDVESSVDSRYHFV  109
            FLW+ ES V+S+YHFV
Sbjct  383  FLWEAESYVESKYHFV  398



>gb|AFW59314.1| hypothetical protein ZEAMMB73_007794 [Zea mays]
Length=400

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/256 (44%), Positives = 164/256 (64%), Gaps = 13/256 (5%)
 Frame = -3

Query  870  FCMPWWCRNSWMLMYLXVPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSL  691
            +C   W    +M   + +    SP       I  LP+++++L  +HS +A+EMIQNHL+L
Sbjct  154  YC---WVTYRFMENDIYMTPALSPGGGPVRDISALPNQEDKLRNIHSADAFEMIQNHLNL  210

Query  690  ILGNR--SNANSSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDS  517
            I+G +  S  ++ V+I+ L +G++YAAS+MYGYFLKRVD+RFQLEK MK LP   +    
Sbjct  211  IMGEKIASPPDTVVEISNLNLGKLYAASIMYGYFLKRVDERFQLEKTMKTLPPKPN----  266

Query  516  GIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRY  337
              QQ+  ++   +          ++ PDG   S     +  P++LR+YV   D +TLQRY
Sbjct  267  --QQIVFENLQPNPFWDMESLVQIT-PDGEEISLD-DEKSNPNKLRSYVSQLDADTLQRY  322

Query  336  ATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGS  157
            ATIRSKEA+++IEK T+ALFGRP+I +   G++++    +I I+F+ L  LVLEAV FGS
Sbjct  323  ATIRSKEAVSLIEKQTQALFGRPDIKVLDDGSVNAKDGRMITITFTELNHLVLEAVAFGS  382

Query  156  FLWDVESSVDSRYHFV  109
            FLW+ ES V+S+YHFV
Sbjct  383  FLWEAESYVESKYHFV  398



>ref|XP_004253444.1| PREDICTED: uncharacterized protein LOC101265814, partial [Solanum 
lycopersicum]
Length=273

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 154/241 (64%), Gaps = 7/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  649
            +P I  P+ + +G ID  P+++E+L  +HS +A+EMIQ+HLS +LG+       +S VQI
Sbjct  34   IPRI-KPTSDPAGRIDLWPNQEEKLEVIHSADAFEMIQSHLSSVLGDGPAVGPLSSIVQI  92

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-tslr  472
             K+++G++YAAS MYGYFL+RVDQR+QLE+ M  LP+  +K     ++            
Sbjct  93   GKIKLGKLYAASAMYGYFLRRVDQRYQLERTMNTLPKRPEKTRERFEEPSPPYPLWDPDS  152

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 PE    PD     R    E     LR+YV   D +TLQRYATIRSKEA+ +IEK 
Sbjct  153  LIRIQPEEYD-PDEYAIQRN-EDESSSYGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQ  210

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G +D+S DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  211  TQALFGRPDIRILEDGKLDTSNDEVLSLSLSGLAMLVLEAVAFGSFLWDSESYVESKYHF  270

Query  111  V  109
            +
Sbjct  271  L  271



>ref|XP_010461033.1| PREDICTED: uncharacterized protein LOC104741810 [Camelina sativa]
Length=406

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 157/241 (65%), Gaps = 7/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  649
            +P I  P+ + +G ID  P+++E+L  +HS +A+EMIQ+HLS +LG+R+     +S VQI
Sbjct  167  IPQI-KPTSDPAGRIDLWPNQEEKLEVIHSADAFEMIQSHLSSVLGDRTAVGPLSSIVQI  225

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-tslr  472
            +K+++G++YAAS MYGYFL+RVDQR+QLE+ M  LP+  +K     ++            
Sbjct  226  SKIKLGKLYAASAMYGYFLRRVDQRYQLERTMNTLPKRPEKTRERFEEPSPPYPLWDPNS  285

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 PE    PD     R    E     LR+YV   D +TLQRYATIRSKEA+ +IEK 
Sbjct  286  LIRIQPEEYD-PDEYAIQRN-EDESSSYGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQ  343

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G +D+S DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  344  TQALFGRPDIRILEDGKLDTSNDEVLSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHF  403

Query  111  V  109
            +
Sbjct  404  L  404



>ref|XP_006854071.1| hypothetical protein AMTR_s00048p00111750 [Amborella trichopoda]
 gb|ERN15538.1| hypothetical protein AMTR_s00048p00111750 [Amborella trichopoda]
Length=383

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 151/223 (68%), Gaps = 19/223 (9%)
 Frame = -3

Query  765  PSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQVYAASVMYGYFL  592
            P+++ +L  +HS EA+EMI+NHL+L+LG R  +     ++I+KLR+G++YAAS+MYGYFL
Sbjct  178  PNQESKLQTIHSNEAFEMIENHLALVLGGRWPNPTQPRIEISKLRIGKLYAASIMYGYFL  237

Query  591  KRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRG  412
            +RVDQRFQLE++M  L   ++ ED   Q   G+  D           +V+  D       
Sbjct  238  RRVDQRFQLERSMGTLSLEVE-EDESDQVTEGEFFDAEF--------LVTESDS------  282

Query  411  FGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDS  232
               + K   LR+YVM  + E+LQRYATIRSKEA+++IEK T+ALFGRP+I +   G++D+
Sbjct  283  --DDPKSYLLRSYVMHLNSESLQRYATIRSKEAVSVIEKQTQALFGRPDIRMAEDGSLDA  340

Query  231  SKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVAH  103
              DE+I +SF SL  LVLEAV FGSFLWDVE   DS+YHF+ +
Sbjct  341  LNDEVIAVSFESLNALVLEAVAFGSFLWDVEGYADSKYHFLTN  383



>ref|XP_010499760.1| PREDICTED: uncharacterized protein LOC104777247 [Camelina sativa]
Length=410

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 157/241 (65%), Gaps = 7/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN---SSVQI  649
            +P I  P+ + +G ID  P+++E+L  +HS +A+EMIQ+HLS +LG+R+  +   S VQI
Sbjct  171  IPQI-KPTSDPAGRIDLWPNQEEKLEVIHSADAFEMIQSHLSSVLGDRTAVSPLSSIVQI  229

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-tslr  472
            +K+++G++YAAS MYGYFL+RVDQR+QLE+ M  LP+  +K     ++            
Sbjct  230  SKIKLGKLYAASAMYGYFLRRVDQRYQLERTMNTLPKRPEKTRERFEEPSPPYPLWDPNS  289

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 PE    PD     R    E     LR+YV   D +TLQRYATIRSKEA+ +IEK 
Sbjct  290  LIRIQPEEYD-PDEYAIQRN-EDESSSYGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQ  347

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G +D+S DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  348  TQALFGRPDIRILEDGKLDTSNDEVMSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHF  407

Query  111  V  109
            +
Sbjct  408  L  408



>ref|XP_002890970.1| hypothetical protein ARALYDRAFT_473397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67229.1| hypothetical protein ARALYDRAFT_473397 [Arabidopsis lyrata subsp. 
lyrata]
Length=406

 Score =   205 bits (522),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 156/241 (65%), Gaps = 7/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  649
            +P I  P+ + +G ID  P+++E+L  +HS +A+EMIQ+HLS +LG+R+     +S VQI
Sbjct  167  IPQI-KPTSDPAGRIDLWPNQEEKLEVIHSADAFEMIQSHLSSVLGDRTAVGPLSSIVQI  225

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-tslr  472
             K+++G++YAAS MYGYFL+RVDQR+QLE+ M  LP+  +K     ++            
Sbjct  226  GKIKLGKLYAASAMYGYFLRRVDQRYQLERTMNTLPKRPEKTRERFEEPSPPYPLWDPDS  285

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 PE    PD     R    E     LR+YV   D +TLQRYATIRSKEA+ +IEK 
Sbjct  286  LIRIQPEEYD-PDEYAIQRN-EDESSSYGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQ  343

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G +D+S DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  344  TQALFGRPDIRILEDGKLDTSNDEVLSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHF  403

Query  111  V  109
            +
Sbjct  404  L  404



>ref|XP_004512464.1| PREDICTED: uncharacterized protein LOC101507671 [Cicer arietinum]
Length=410

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 114/244 (47%), Positives = 161/244 (66%), Gaps = 13/244 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I + S + +  +D  P+++ +L  +HS EA+EMIQ+HLSL+LG R      + VQI+
Sbjct  173  IPKIAATS-DPNDRVDLWPNQELKLEAVHSSEAFEMIQSHLSLVLGERVVGPLQTIVQIS  231

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVD RFQLE+   +LPQ   KE+     +  D      +  
Sbjct  232  KIKLGKLYAASIMYGYFLKRVDDRFQLERRTGILPQDFGKEN-----ISFDEPSPPNKLW  286

Query  465  pSHPEVVSWPDGG----MGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
             S   +  +PD      M +   G E +  RLRTYVM  D ETLQR AT+RSKEAI++IE
Sbjct  287  DSDSLIRIYPDEEGYYEMDNMATG-EGRSFRLRTYVMQLDAETLQRLATVRSKEAISLIE  345

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            K T+ALFGRP+I ++  G+I++S DE++ ++FS L  LVLEAV FGSFLW  E+ VD +Y
Sbjct  346  KQTQALFGRPDIRVSKDGSIETSNDEVLSLTFSGLTMLVLEAVAFGSFLWVQENYVDIKY  405

Query  117  HFVA  106
             F+ 
Sbjct  406  PFLV  409



>gb|EPS63452.1| hypothetical protein M569_11331, partial [Genlisea aurea]
Length=342

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 156/234 (67%), Gaps = 35/234 (15%)
 Frame = -3

Query  777  IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--------SNANSSVQINKLRVGQVY  622
            +D  P+++++L  +HSPEA+EM+ +HLSL+LG R        S   S VQI+K+++G++Y
Sbjct  131  VDLWPNQEQKLESVHSPEAFEMVLSHLSLVLGERMTTTTGGPSEDPSVVQISKIKLGKLY  190

Query  621  AASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKE---DSGIQQVGGDssdtslrsspSHPE  451
            A+S+MYGYFL+RVD+R+QLE+++  LP  + ++    + + ++                 
Sbjct  191  ASSIMYGYFLRRVDERYQLERSVNTLPPPVGRQLWDPASLIRI-----------------  233

Query  450  VVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGR  271
               +PDG       G+     +LR+YVM  D ETLQ+YAT+RSKEA+++IEK T+A+FG+
Sbjct  234  ---YPDGAAYPEDDGSH----KLRSYVMYLDAETLQKYATMRSKEALSLIEKQTQAVFGK  286

Query  270  PEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            PEIS+T +G++D++ DE   +SF  L  LVLEAV FGSFLWD E+ V+S+Y FV
Sbjct  287  PEISVTEEGSLDAADDETFSVSFPDLTVLVLEAVAFGSFLWDAETFVESKYSFV  340



>ref|XP_003612708.1| hypothetical protein MTR_5g028020 [Medicago truncatula]
 gb|AES95666.1| plant/F3C3-6 protein [Medicago truncatula]
Length=410

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 110/241 (46%), Positives = 167/241 (69%), Gaps = 5/241 (2%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQIN  646
            +P I++ S + +  +D+ P+++ +L  +HS EA+EMIQ+HLSL+LG R+     + +QI+
Sbjct  171  IPKISATS-DPNEQVDSWPNQEFKLEAVHSSEAFEMIQSHLSLVLGERAVGPLQTIIQIS  229

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGG-Dssdtslrs  469
            K+++G++YAAS+MYGYFLKRVD+RFQLE+++  LPQ L KE+    +    +    S   
Sbjct  230  KIKLGKLYAASIMYGYFLKRVDERFQLERSVGTLPQDLGKENISFDEPSPPNKLWDSDSL  289

Query  468  spSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  289
               +P+   + +    + G G E K S LR YV   D E LQR AT+RSKEAI++IEK T
Sbjct  290  IRIYPDDEGYYEMDDMNTGDG-EGKSSGLRAYVTQLDTEALQRLATVRSKEAISLIEKQT  348

Query  288  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +ALFGRP+I ++  G+I+++ DE++ ++FS L  LVLE+V FGSFLWD E+ V+S+Y F+
Sbjct  349  QALFGRPDIRLSGDGSIETTNDEVLSLTFSGLTMLVLESVAFGSFLWDEENYVESKYPFL  408

Query  108  A  106
            A
Sbjct  409  A  409



>ref|XP_010478637.1| PREDICTED: uncharacterized protein LOC104757587 [Camelina sativa]
Length=407

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 156/241 (65%), Gaps = 7/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  649
            +P I  P+ + +G ID  P+++E+L  +HS +A+EMIQ+HLS +LG+R+     +S VQI
Sbjct  168  IPQI-KPTSDPAGRIDLWPNQEEKLEIIHSADAFEMIQSHLSSVLGDRTAVGPLSSIVQI  226

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-tslr  472
            +K+++G++YAAS MYGYFL+RVDQR+QLE+ M  LP+  +K     ++            
Sbjct  227  SKIKLGKLYAASAMYGYFLRRVDQRYQLERTMNTLPKRPEKTRERFEEPSPPYPLWDPNS  286

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 PE   +       +    E     LR+YV   D +TLQRYATIRSKEA+ +IEK 
Sbjct  287  LIRIQPE--EYDSDEYAIQRNEDESSSYGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQ  344

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G +D+S DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  345  TQALFGRPDIRILEDGKLDTSNDEVLSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHF  404

Query  111  V  109
            +
Sbjct  405  L  405



>ref|XP_006307539.1| hypothetical protein CARUB_v10009166mg, partial [Capsella rubella]
 gb|EOA40437.1| hypothetical protein CARUB_v10009166mg, partial [Capsella rubella]
Length=440

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 157/247 (64%), Gaps = 20/247 (8%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  649
            +P I  P+ + +G ID  P+++E+L  +HS +A+EMIQ+HLS +LG+R+     +S VQI
Sbjct  202  IPQI-KPTSDPAGRIDLWPNQEEKLEVIHSADAFEMIQSHLSSVLGDRTAVGPLSSIVQI  260

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGG-------Ds  490
            +K+++G++YAAS MYGYFL+RVDQR+QLE+ M  LP+  +K     ++          DS
Sbjct  261  SKIKLGKLYAASAMYGYFLRRVDQRYQLERTMNTLPKRPEKTRERYEEPSPPYPLWDPDS  320

Query  489  sdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAI  310
                        E     +    S G         LR+YV   D +TLQRYATIRSKEA+
Sbjct  321  LIRIQPEEYDSDEYAIQRNEDESSYG---------LRSYVTYLDSDTLQRYATIRSKEAM  371

Query  309  NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
             +IEK T+ALFGRP+I I   G +D+S DE++ +S S L  LVLEAV FGSFLWD E+ V
Sbjct  372  TLIEKQTQALFGRPDIRILEDGKLDTSNDEVLSLSVSGLAMLVLEAVAFGSFLWDSETYV  431

Query  129  DSRYHFV  109
            +S+YHF+
Sbjct  432  ESKYHFL  438



>ref|NP_564389.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAG23441.1|AC084165_7 unknown protein [Arabidopsis thaliana]
 gb|AAK59781.1| At1g32160/F3C3_6 [Arabidopsis thaliana]
 gb|AAM65447.1| unknown [Arabidopsis thaliana]
 gb|AAO11596.1| At1g32160/F3C3_6 [Arabidopsis thaliana]
 gb|AEE31442.1| uncharacterized protein AT1G32160 [Arabidopsis thaliana]
Length=406

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 154/241 (64%), Gaps = 7/241 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA---NSSVQI  649
            +P I  P+ + +G ID  P+++E+L  +HS +A+EMIQ+HLS +LG+       +S VQI
Sbjct  167  IPRI-KPTSDPAGRIDLWPNQEEKLEVIHSADAFEMIQSHLSSVLGDGPAVGPLSSIVQI  225

Query  648  NKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd-tslr  472
             K+++G++YAAS MYGYFL+RVDQR+QLE+ M  LP+  +K     ++            
Sbjct  226  GKIKLGKLYAASAMYGYFLRRVDQRYQLERTMNTLPKRPEKTRERFEEPSPPYPLWDPDS  285

Query  471  sspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKH  292
                 PE    PD     R    E     LR+YV   D +TLQRYATIRSKEA+ +IEK 
Sbjct  286  LIRIQPEEYD-PDEYAIQRN-EDESSSYGLRSYVTYLDSDTLQRYATIRSKEAMTLIEKQ  343

Query  291  TEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            T+ALFGRP+I I   G +D+S DE++ +S S L  LVLEAV FGSFLWD ES V+S+YHF
Sbjct  344  TQALFGRPDIRILEDGKLDTSNDEVLSLSVSGLAMLVLEAVAFGSFLWDSESYVESKYHF  403

Query  111  V  109
            +
Sbjct  404  L  404



>ref|XP_002981973.1| hypothetical protein SELMODRAFT_233832 [Selaginella moellendorffii]
 gb|EFJ17066.1| hypothetical protein SELMODRAFT_233832 [Selaginella moellendorffii]
Length=324

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 110/257 (43%), Positives = 156/257 (61%), Gaps = 34/257 (13%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILG-----NRSNANSSV  655
            VP I++      GS  + P +++ L  +HSPEA+EMI+ H+ ++LG     +R   ++  
Sbjct  78   VPKISALVNREGGSACSWPIQEKDLESVHSPEAFEMIKEHMEMVLGGHATLSRVEPHTVA  137

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ-------------GLDKEDSG  514
            QI+KLRVGQ+YA SVMYGYFLKRVD+R+QLEK MK+L +              ++K +S 
Sbjct  138  QISKLRVGQIYATSVMYGYFLKRVDERYQLEKKMKILTRVAESGRGFTTQFLSIEKRESS  197

Query  513  --IQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQR  340
              IQ  G  S    + SS   P  V+              +K + LR YV  FD ETL R
Sbjct  198  EMIQAAGAASELDLVSSSSRSPSQVA--------------LKNNDLRAYVAKFDHETLSR  243

Query  339  YATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFG  160
            YAT+R+ E +++IE+H EALFGRP++ +   G++  ++D+ I+I F+SLR LV+EA  FG
Sbjct  244  YATMRTHETVDLIERHAEALFGRPDLRVAADGSVGLARDDAIQIKFASLRALVMEAAAFG  303

Query  159  SFLWDVESSVDSRYHFV  109
            S+LWDVES VD  Y  V
Sbjct  304  SYLWDVESYVDIHYRVV  320



>ref|XP_010240349.1| PREDICTED: uncharacterized protein LOC104585415 [Brachypodium 
distachyon]
Length=391

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 150/223 (67%), Gaps = 9/223 (4%)
 Frame = -3

Query  771  TLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA--NSSVQINKLRVGQVYAASVMYGY  598
            +LP+++ +L  +HS +A EMIQNHL+LI+G ++ A  ++ V+I+ L +G++YAAS+MYGY
Sbjct  174  SLPNQEYKLQSIHSQDALEMIQNHLNLIMGEQAAAPLDTVVEISNLNLGKLYAASIMYGY  233

Query  597  FLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGS  418
            FLKRVD+RFQLEK MK LP       S  +Q+  +              V   PDG    
Sbjct  234  FLKRVDERFQLEKTMKTLPP------SPKEQIVMERDLKPNPFWDMESLVQISPDGEEVD  287

Query  417  RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTI  238
                 E  P++LR+YV   D +TLQ+YATIRSKE++++IEK T+ALFGRP+I +   G++
Sbjct  288  LD-DEESNPNKLRSYVSRLDADTLQKYATIRSKESVSLIEKQTQALFGRPDIKVLDDGSV  346

Query  237  DSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ++   +++ I+F+ L  LVLEA  FG+FLW+ ES ++S+YHFV
Sbjct  347  NAKDGKIVTITFTELTNLVLEAAGFGAFLWEAESHIESKYHFV  389



>ref|XP_002982952.1| hypothetical protein SELMODRAFT_234120 [Selaginella moellendorffii]
 gb|EFJ16197.1| hypothetical protein SELMODRAFT_234120 [Selaginella moellendorffii]
Length=324

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/257 (42%), Positives = 155/257 (60%), Gaps = 34/257 (13%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILG-----NRSNANSSV  655
            VP I++      GS  + P +++ L  +HSPEA+EMI+ H+ ++LG     +R   ++  
Sbjct  78   VPKISALVNREGGSACSWPIQEKDLESVHSPEAFEMIKEHMEMVLGGHATLSRVEPHTVA  137

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQ-------------GLDKEDSG  514
            QI+KLRVGQ+YA SVMYGYFLKRVD+R+QLEK MK+L +              ++K +S 
Sbjct  138  QISKLRVGQIYATSVMYGYFLKRVDERYQLEKKMKILTRVAESGRGFTTQFLSIEKRESS  197

Query  513  --IQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQR  340
              IQ     S    + SS   P  V+              +K + LR YV  FD ETL R
Sbjct  198  EMIQAAAAASELDLVSSSSRSPSQVA--------------LKNNDLRAYVAKFDHETLSR  243

Query  339  YATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFG  160
            YAT+R+ E +++IE+H EALFGRP++ +   G++  ++D+ I+I F+SLR LV+EA  FG
Sbjct  244  YATMRTHETVDLIERHAEALFGRPDLRVAADGSVGLARDDAIQIKFASLRALVMEAAAFG  303

Query  159  SFLWDVESSVDSRYHFV  109
            S+LWDVES VD  Y  V
Sbjct  304  SYLWDVESYVDIHYRVV  320



>ref|XP_007036963.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY21464.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=360

 Score =   193 bits (490),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 124/164 (76%), Gaps = 7/164 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VPA+T  S + SG +D  PS++++L  LHSPEAYEMIQNHL+LILGNR   ++SV QI+K
Sbjct  198  VPAMTPSSTDPSGRVDMWPSEEDKLELLHSPEAYEMIQNHLALILGNRLGDSTSVAQISK  257

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQ-VGGDssdt----s  478
            LRVGQVYAASVMYGYFLKRVDQRFQLEK MK+LP   + E+SG++Q VG D        S
Sbjct  258  LRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPNASNGEESGVEQSVGEDMGTAGLGDS  317

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETL  346
             ++  SHPEV SW  GG+   GFG  +KP RLRTYVMSFDGETL
Sbjct  318  YKAVSSHPEVSSW-SGGISPGGFGHGIKPCRLRTYVMSFDGETL  360


 Score = 53.1 bits (126),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVKA ER+KALEEILYALVVQKFMDA+V
Sbjct  168  EVKANERKKALEEILYALVVQKFMDANV  195



>emb|CBI33818.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 150/218 (69%), Gaps = 7/218 (3%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I++ S +  G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG R     ++ VQI+
Sbjct  168  IPKISATS-DPVGRVDFWPNQEQKLESIHSPEAFEMIQSHLSLVLGERLVGPLDTIVQIS  226

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MYGYFLKRVD+R+QLE+ MK LP+G ++     +  G  +      S 
Sbjct  227  KIKLGKLYAASIMYGYFLKRVDERYQLERTMKTLPEGFNENRLSFEDPGPANRLWDPDSL  286

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
               P       G + S   G+     RLR+YVM  D ETLQRYATIRSKEAI++IEK T+
Sbjct  287  IRIPADDDDDGGMLDSVEGGS----YRLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQ  342

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEA  172
            ALFG+P++ ++  G++D+S DE++ I+FS L  LVLEA
Sbjct  343  ALFGKPDVRVSEDGSLDTSNDEVVSITFSGLTMLVLEA  380



>gb|ABR16101.1| unknown [Picea sitchensis]
Length=420

 Score =   190 bits (483),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/242 (43%), Positives = 152/242 (63%), Gaps = 10/242 (4%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP + S  +N  G +DT   K+E+L  +HSPE  EMI+ H+S ILG R   N     +  
Sbjct  176  VPRLVSCMEN--GKVDTWLPKNEELESIHSPEMLEMIREHISRILGRRGKLNIVDNRTIT  233

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVG--GDssdt  481
            +I++L +G+VYAA++MYGYFL+R +QR+QLE N++ +   L   D   + +   G+S   
Sbjct  234  EIDRLTLGRVYAATIMYGYFLRRAEQRYQLEMNLETIYSYLSDADDVKKYLLHLGESKFF  293

Query  480  slrsspSHPEVVSWPDGGMGSRGF-GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
            +     S  ++ + P     +     T  +P +LR Y+MSFD E+LQR A +R+KE++N+
Sbjct  294  TRTKCLSGKDLDAIPVADPSTSSLVETRTRPRQLRDYIMSFDAESLQRCAMMRTKESVNM  353

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            +EKH EALFGRP I I   GT   + D+ +++++SSL+RL+LEAV FGS LWDVE  V S
Sbjct  354  VEKHAEALFGRPVIHIAADGTTTFAHDDALRLTYSSLKRLLLEAVAFGSLLWDVEGYVGS  413

Query  123  RY  118
             Y
Sbjct  414  IY  415



>gb|KDO57188.1| hypothetical protein CISIN_1g036217mg [Citrus sinensis]
Length=196

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 146/239 (61%), Gaps = 48/239 (20%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I   S +  G +D  P+++++L  +HSPEA+EMIQ+HLSL+LG R     ++ +QI+
Sbjct  2    IPKIRETS-DPVGRVDFWPNQEQKLESVHSPEAFEMIQSHLSLVLGERLVGPLDTIIQIS  60

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrss  466
            K+++G++YAAS+MY       D   ++  N           D G   VG           
Sbjct  61   KIKLGKLYAASIMY-------DSLIRIPPN-----------DDG--TVGE----------  90

Query  465  pSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTE  286
                   S+ DGG G        K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T+
Sbjct  91   -------SFMDGGEG--------KSYRLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQ  135

Query  285  ALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            ALFGRP+I +   G+ID+SKDE+I ++F  L  LVLEAV FGSF+WD ES V+S+Y F+
Sbjct  136  ALFGRPDIRVLEDGSIDTSKDEVISVTFLGLTMLVLEAVAFGSFMWDSESYVESKYPFI  194



>ref|XP_011018702.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105121674 
[Populus euphratica]
Length=255

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 152/242 (63%), Gaps = 18/242 (7%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I  P+ + +G +   P+++++L         EMIQ+HLS++LG R      + V+I+
Sbjct  25   IPXIL-PTSDPTGRVGFWPNQEQKL---------EMIQSHLSIVLGVRLVCPLETIVEIS  74

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVG-GDssdtslrs  469
            K+++ +++AAS++YGYFL+RVDQR+QLE+ M  LP+G DK+ +  + +            
Sbjct  75   KVKLXKLFAASILYGYFLRRVDQRYQLERTMNTLPKGFDKDRAWFEDLSPAKPLWGPESL  134

Query  468  spSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  289
                P     PDGG    G   E K  RLR+YVM+   ETL+RYAT+RSKEAI++ EK  
Sbjct  135  IRIVPGDSGCPDGGSXDTG---EEKSYRLRSYVMNLYVETLERYATLRSKEAISLNEKQA  191

Query  288  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAV--TFGSFLWDVESSVDSRYH  115
            +AL GRP+I I   G+I+++ DE++ I+FS L   VLEAV   FGSF WD ES V+S+YH
Sbjct  192  KALSGRPDIRIAENGSIETANDEVVSITFSGLAMPVLEAVAFAFGSFPWDAESDVESKYH  251

Query  114  FV  109
             +
Sbjct  252  VL  253



>ref|XP_002977160.1| hypothetical protein SELMODRAFT_106276 [Selaginella moellendorffii]
 gb|EFJ21769.1| hypothetical protein SELMODRAFT_106276 [Selaginella moellendorffii]
Length=333

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 152/245 (62%), Gaps = 12/245 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDT-LPSKDEQLARLHSPEAYEMIQNHLSLILGNRS----NANSSV  655
            VP I  PS  ++  +DT   S    +  +HS E  E++++HL +ILG  S       + V
Sbjct  94   VPKI--PSLPANQKVDTNWQSVQGDMESIHSAEVLEVVRDHLGMILGRPSPHYQEPYTLV  151

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
            Q +K+++G +YAA+V++GYFL+R+DQR+QL+ +MK   + L  +    ++ G  +++ + 
Sbjct  152  QASKMKIGHLYAATVVFGYFLRRLDQRYQLDLSMK---KALSSDKHEDEEQGKLAAEANA  208

Query  474  rsspSHPEVVSWPDGGMGSRGFGTEM--KPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
                      S   GG+G  G   ++  KPS+L++YVMS D E+LQR+AT+R KE+++++
Sbjct  209  AVQAMQAAKSSTTRGGLGGSGVFPQLGWKPSKLKSYVMSLDPESLQRFATLRCKESLDVV  268

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
            E+ T+ALFG+PE  I P G++     +   IS S LRRLV EAV FGSFLWD E+ VDS 
Sbjct  269  ERQTQALFGKPEAEIAPDGSVVLLAGDSFTISLSGLRRLVTEAVVFGSFLWDAEAHVDSH  328

Query  120  YHFVA  106
            Y+ V 
Sbjct  329  YNLVG  333



>ref|XP_002965311.1| hypothetical protein SELMODRAFT_82738 [Selaginella moellendorffii]
 gb|EFJ34149.1| hypothetical protein SELMODRAFT_82738 [Selaginella moellendorffii]
Length=333

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 140/217 (65%), Gaps = 9/217 (4%)
 Frame = -3

Query  738  LHSPEAYEMIQNHLSLILGNRS----NANSSVQINKLRVGQVYAASVMYGYFLKRVDQRF  571
            +HS E  E++++HL +ILG  S       + VQ +K+++G +YAA+V++GYFL+R+DQR+
Sbjct  120  IHSAEVLEVVRDHLGMILGRPSPHYQEPYTLVQASKMKIGHLYAATVVFGYFLRRLDQRY  179

Query  570  QLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEM--  397
            QL+ +MK   + L  +    ++ G  +++ +           S   GG+G  G   ++  
Sbjct  180  QLDLSMK---KALSSDKHEDEEQGKLAAEANAAVQAMQAAKSSTTRGGLGGSGVFPQLGW  236

Query  396  KPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDEL  217
            KPS+L++YVMS D E+LQR+AT+R KE+++++E+ T+ALFG+PE  I P G++     + 
Sbjct  237  KPSKLKSYVMSLDPESLQRFATLRCKESLDVVERQTQALFGKPEAEIAPDGSVVLLAGDS  296

Query  216  IKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFVA  106
              IS S LRRLV EAV FGSFLWD E+ VDS Y+ V 
Sbjct  297  FTISLSGLRRLVTEAVVFGSFLWDAEAHVDSHYNLVG  333



>emb|CAN66177.1| hypothetical protein VITISV_005141 [Vitis vinifera]
Length=89

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -3

Query  369  MSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLR  190
            MSFD ETLQRYATIRSKEA++IIEKHTEALFGRPEI ITPQGTIDSSKDELIKISF  L+
Sbjct  1    MSFDAETLQRYATIRSKEAVSIIEKHTEALFGRPEIIITPQGTIDSSKDELIKISFGGLK  60

Query  189  RLVLEAVTFGSFLWDVESSVDSRYHFV  109
            RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  61   RLVLEAVTFGSFLWDVESFVDSRYHFV  87



>dbj|BAD94862.1| hypothetical protein [Arabidopsis thaliana]
Length=89

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = -3

Query  369  MSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLR  190
            MSFD ETLQRYATIRS+EA+ IIEKHTEALFG+PEI ITP+GT+DSSKDE IKISF  ++
Sbjct  1    MSFDAETLQRYATIRSREAVGIIEKHTEALFGKPEIVITPEGTVDSSKDEQIKISFGGMK  60

Query  189  RLVLEAVTFGSFLWDVESSVDSRYHFV  109
            RLVLEAVTFGSFLWDVES VD+RYHFV
Sbjct  61   RLVLEAVTFGSFLWDVESHVDARYHFV  87



>gb|AFK47814.1| unknown [Lotus japonicus]
Length=90

 Score =   154 bits (389),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -3

Query  372  VMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSL  193
            +MSFDGETLQRYATIRSKE+++IIEKHTEALFGRP+  ITP+G I+SSKDE+IKISF  L
Sbjct  1    MMSFDGETLQRYATIRSKESVSIIEKHTEALFGRPDAVITPEGKINSSKDEIIKISFGGL  60

Query  192  RRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +RLVLEAVTFGSFLWDVES VDSRYHFV
Sbjct  61   KRLVLEAVTFGSFLWDVESYVDSRYHFV  88



>ref|XP_006437251.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
 gb|ESR50491.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
Length=281

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 138/243 (57%), Gaps = 23/243 (9%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++    N  G ++  PSKD +L  +H  E  EMI+ H+S ++G R+N +     ++ 
Sbjct  48   VPKLSRCIYN--GRLEIWPSKDWELESIHEFEVLEMIREHISTVIGLRANCSVTDSWATT  105

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
            +I +LR+G+VY AS++YGYFLK    R+ LE+ +    Q L        Q        + 
Sbjct  106  EIQRLRLGRVYVASILYGYFLKSASLRYYLEECLASAHQDLHLTHRNSLQF-----PEAW  160

Query  474  rsspSHPEVVSWPDG----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAIN  307
                   +VV   +      +G    G E+K  +L+ YVM FD ETLQR A +RS+EA+N
Sbjct  161  SYGLKQNQVVGCVNNTQSISLGRGTNGHELKQEKLKCYVMGFDPETLQRCAKLRSREAVN  220

Query  306  IIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVD  127
            ++EKH+ ALFG  +      G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D
Sbjct  221  LVEKHSCALFGDGQ-----TGLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYAD  273

Query  126  SRY  118
            + Y
Sbjct  274  AVY  276



>gb|KDO46606.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
 gb|KDO46607.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
 gb|KDO46608.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
 gb|KDO46609.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
 gb|KDO46610.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=250

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 137/243 (56%), Gaps = 23/243 (9%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++    N  G ++  PSKD +L  +H  E  EMI+ H+S ++G R+N +     ++ 
Sbjct  17   VPKLSRCIYN--GRLEIWPSKDWELESIHEFEVLEMIREHISTVIGLRANCSVTDSWATT  74

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
            +I +LR+G+VY AS++YGYFLK    R+ LE+ +    Q L        Q        + 
Sbjct  75   EIQRLRLGRVYVASILYGYFLKSASLRYYLEECLASAHQDLHLTHRNSLQF-----PEAW  129

Query  474  rsspSHPEVVSWPDG----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAIN  307
                   +VV   +      +G    G E+K   L+ YVM FD ETLQR A +RS+EA+N
Sbjct  130  SYGLKQNQVVGCVNNTQSISLGRGTNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVN  189

Query  306  IIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVD  127
            ++EKH+ ALFG  +      G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D
Sbjct  190  LVEKHSCALFGDGQ-----TGLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYAD  242

Query  126  SRY  118
            + Y
Sbjct  243  AVY  245



>gb|KDO46604.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
 gb|KDO46605.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=281

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 137/243 (56%), Gaps = 23/243 (9%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++    N  G ++  PSKD +L  +H  E  EMI+ H+S ++G R+N +     ++ 
Sbjct  48   VPKLSRCIYN--GRLEIWPSKDWELESIHEFEVLEMIREHISTVIGLRANCSVTDSWATT  105

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
            +I +LR+G+VY AS++YGYFLK    R+ LE+ +    Q L        Q        + 
Sbjct  106  EIQRLRLGRVYVASILYGYFLKSASLRYYLEECLASAHQDLHLTHRNSLQF-----PEAW  160

Query  474  rsspSHPEVVSWPDG----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAIN  307
                   +VV   +      +G    G E+K   L+ YVM FD ETLQR A +RS+EA+N
Sbjct  161  SYGLKQNQVVGCVNNTQSISLGRGTNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVN  220

Query  306  IIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVD  127
            ++EKH+ ALFG  +      G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D
Sbjct  221  LVEKHSCALFGDGQ-----TGLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYAD  273

Query  126  SRY  118
            + Y
Sbjct  274  AVY  276



>gb|KDO46603.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=276

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 137/243 (56%), Gaps = 23/243 (9%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++    N  G ++  PSKD +L  +H  E  EMI+ H+S ++G R+N +     ++ 
Sbjct  43   VPKLSRCIYN--GRLEIWPSKDWELESIHEFEVLEMIREHISTVIGLRANCSVTDSWATT  100

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
            +I +LR+G+VY AS++YGYFLK    R+ LE+ +    Q L        Q        + 
Sbjct  101  EIQRLRLGRVYVASILYGYFLKSASLRYYLEECLASAHQDLHLTHRNSLQF-----PEAW  155

Query  474  rsspSHPEVVSWPDG----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAIN  307
                   +VV   +      +G    G E+K   L+ YVM FD ETLQR A +RS+EA+N
Sbjct  156  SYGLKQNQVVGCVNNTQSISLGRGTNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVN  215

Query  306  IIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVD  127
            ++EKH+ ALFG  +      G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D
Sbjct  216  LVEKHSCALFGDGQ-----TGLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYAD  268

Query  126  SRY  118
            + Y
Sbjct  269  AVY  271



>gb|KDO46602.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=281

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 137/243 (56%), Gaps = 23/243 (9%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++    N  G ++  PSKD +L  +H  E  EMI+ H+S ++G R+N +     ++ 
Sbjct  48   VPKLSRCIYN--GRLEIWPSKDWELESIHEFEVLEMIREHISTVIGLRANCSVTDSWATT  105

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
            +I +LR+G+VY AS++YGYFLK    R+ LE+ +    Q L        Q        + 
Sbjct  106  EIQRLRLGRVYVASILYGYFLKSASLRYYLEECLASAHQDLHLTHRNSLQF-----PEAW  160

Query  474  rsspSHPEVVSWPDG----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAIN  307
                   +VV   +      +G    G E+K   L+ YVM FD ETLQR A +RS+EA+N
Sbjct  161  SYGLKQNQVVGCVNNTQSISLGRGTNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVN  220

Query  306  IIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVD  127
            ++EKH+ ALFG  +      G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D
Sbjct  221  LVEKHSCALFGDGQT-----GLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYAD  273

Query  126  SRY  118
            + Y
Sbjct  274  AVY  276



>ref|NP_001031154.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32294.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=342

 Score =   149 bits (375),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 108/150 (72%), Gaps = 8/150 (5%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+ITS S + SG +DT P+ D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+K
Sbjct  177  VPSITSSSADPSGRVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGD-------ssd  484
            L VGQVYAASVMYGYFLKR+DQRFQLEK M++LP G D+ ++ I+Q G D        ++
Sbjct  237  LGVGQVYAASVMYGYFLKRIDQRFQLEKTMRILPGGSDEGETSIEQAGRDVERNFYEEAE  296

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMK  394
             + ++  S+ +V S+  G   S GF ++MK
Sbjct  297  ETYQAVSSNQDVGSFVGGINASGGFSSDMK  326


 Score = 50.1 bits (118),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVK  ERR+ALEEILYALVVQKFMDA+V
Sbjct  147  EVKEKERRRALEEILYALVVQKFMDANV  174



>ref|XP_007049654.1| F21O3.2 protein [Theobroma cacao]
 gb|EOX93811.1| F21O3.2 protein [Theobroma cacao]
Length=403

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/271 (37%), Positives = 146/271 (54%), Gaps = 59/271 (22%)
 Frame = -3

Query  840  WMLMY-----LXVPAITSPSQN-SSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGN  679
            +ML++     + VP +   S+   +G ++  PSKD +L  +HS E  EM++ H+S ++G 
Sbjct  157  YMLIFYKFSEIRVPLVPKLSRCIYNGRLEIWPSKDWELESIHSIEVLEMVREHVSTVIGL  216

Query  678  RSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSG  514
            R+N++     ++ +I +L++G+VYAAS++YGYFLK    R+ LEK + +  Q    + + 
Sbjct  217  RANSSVTDNWATTEIQRLQLGRVYAASILYGYFLKSASSRYHLEKCLALAHQDRLSQRNS  276

Query  513  IQQVGGDssdtslrsspSHPEVVSWPD---GGMGSRGFG----------------TEMKP  391
            +Q                      +PD    G  S  FG                 E   
Sbjct  277  LQ----------------------FPDLLPCGFKSLVFGHVRDMQSVSLGQGPGRQEKNL  314

Query  390  SRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIK  211
              LR YVM FD ETLQR A ++SKEA+N+IEKH+ ALFG  +  +   G       E+I 
Sbjct  315  EELRCYVMGFDPETLQRCAKVKSKEAVNLIEKHSCALFGDEKTGVLETG-------EVIL  367

Query  210  ISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
             SFSSL+RLVLEAV FGSFLWD+E  VD+ Y
Sbjct  368  TSFSSLKRLVLEAVAFGSFLWDIEEYVDTVY  398



>dbj|BAH56904.1| AT1G48450 [Arabidopsis thaliana]
Length=321

 Score =   146 bits (369),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+ITS S + SG +DT P+ D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+K
Sbjct  177  VPSITSSSADPSGRVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGD  493
            L VGQVYAASVMYGYFLKR+DQRFQLEK M++LP G D+ ++ I+Q G D
Sbjct  237  LGVGQVYAASVMYGYFLKRIDQRFQLEKTMRILPGGSDEGETSIEQAGRD  286


 Score = 50.1 bits (118),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVK  ERR+ALEEILYALVVQKFMDA+V
Sbjct  147  EVKEKERRRALEEILYALVVQKFMDANV  174



>ref|NP_001185170.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE32295.1| uncharacterized protein AT1G48450 [Arabidopsis thaliana]
Length=333

 Score =   146 bits (368),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            VP+ITS S + SG +DT P+ D +L RLHSPE YEMIQNHLS+IL NR++  ++V QI+K
Sbjct  177  VPSITSSSADPSGRVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISK  236

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGD  493
            L VGQVYAASVMYGYFLKR+DQRFQLEK M++LP G D+ ++ I+Q G D
Sbjct  237  LGVGQVYAASVMYGYFLKRIDQRFQLEKTMRILPGGSDEGETSIEQAGRD  286


 Score = 50.1 bits (118),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            EVK  ERR+ALEEILYALVVQKFMDA+V
Sbjct  147  EVKEKERRRALEEILYALVVQKFMDANV  174



>ref|XP_006484801.1| PREDICTED: uncharacterized protein LOC102613099 [Citrus sinensis]
Length=390

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 134/232 (58%), Gaps = 21/232 (9%)
 Frame = -3

Query  786  SGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVY  622
            +G ++  PSKD +L  +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY
Sbjct  166  NGRLEIWPSKDWELESIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVY  225

Query  621  AASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVS  442
             AS++YGYFLK    R+ LE+ +    Q L        Q        +        +VV 
Sbjct  226  VASILYGYFLKSASLRYYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVG  280

Query  441  WPDG----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFG  274
              +      +G    G E+K  +L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG
Sbjct  281  CVNNMQSISLGRGTNGHELKQEKLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFG  340

Query  273  RPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
              +      G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  341  DGQT-----GLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  385



>ref|XP_006437252.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
 gb|ESR50492.1| hypothetical protein CICLE_v10031774mg [Citrus clementina]
Length=390

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 134/232 (58%), Gaps = 21/232 (9%)
 Frame = -3

Query  786  SGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVY  622
            +G ++  PSKD +L  +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY
Sbjct  166  NGRLEIWPSKDWELESIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVY  225

Query  621  AASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVS  442
             AS++YGYFLK    R+ LE+ +    Q L        Q        +        +VV 
Sbjct  226  VASILYGYFLKSASLRYYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVG  280

Query  441  WPDG----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFG  274
              +      +G    G E+K  +L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG
Sbjct  281  CVNNTQSISLGRGTNGHELKQEKLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFG  340

Query  273  RPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
              +      G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  341  DGQT-----GLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  385



>ref|XP_002531072.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31286.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 138/239 (58%), Gaps = 16/239 (7%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++    N  G ++  PSKD +L  +HS E  EMI+ H+  ++G R+N++     ++ 
Sbjct  176  VPKLSRCIYN--GRLEIGPSKDWELESIHSFEVLEMIKEHVCTVIGLRANSSVTDSWATT  233

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
            +I +L++G+VYAASV+YGYFLK    R  LE+ + V    +      ++Q     S    
Sbjct  234  EIQRLQLGRVYAASVLYGYFLKSASLRHYLEQCIAVSHHNVHLSCRTVRQYPESISHGLT  293

Query  474  rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
                    + +   G  G      + +  +LR YVM FD ETLQR A ++SKEA+N+IEK
Sbjct  294  NIVFR--RISNMQSGSAGQGSIKQDWQRGKLRCYVMGFDAETLQRCAKLKSKEAMNLIEK  351

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            H+ ALFG         G++++  DE+I  SFSSL+RLVLEAV FGSFLWD E  V+S +
Sbjct  352  HSSALFGNDNT-----GSLEN--DEVILTSFSSLKRLVLEAVAFGSFLWDTEEYVNSIF  403



>gb|KDO46600.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=404

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 133/232 (57%), Gaps = 21/232 (9%)
 Frame = -3

Query  786  SGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVY  622
            +G ++  PSKD +L  +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY
Sbjct  180  NGRLEIWPSKDWELESIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVY  239

Query  621  AASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVS  442
             AS++YGYFLK    R+ LE+ +    Q L        Q        +        +VV 
Sbjct  240  VASILYGYFLKSASLRYYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVG  294

Query  441  WPDG----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFG  274
              +      +G    G E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG
Sbjct  295  CVNNTQSISLGRGTNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFG  354

Query  273  RPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
              +      G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  355  DGQT-----GLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  399



>gb|KDO46601.1| hypothetical protein CISIN_1g015579mg [Citrus sinensis]
Length=390

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/232 (40%), Positives = 133/232 (57%), Gaps = 21/232 (9%)
 Frame = -3

Query  786  SGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVY  622
            +G ++  PSKD +L  +H  E  EMI+ H+S ++G R+N +     ++ +I +LR+G+VY
Sbjct  166  NGRLEIWPSKDWELESIHEFEVLEMIREHISTVIGLRANCSVTDSWATTEIQRLRLGRVY  225

Query  621  AASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVS  442
             AS++YGYFLK    R+ LE+ +    Q L        Q        +        +VV 
Sbjct  226  VASILYGYFLKSASLRYYLEECLASAHQDLHLTHRNSLQF-----PEAWSYGLKQNQVVG  280

Query  441  WPDG----GMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFG  274
              +      +G    G E+K   L+ YVM FD ETLQR A +RS+EA+N++EKH+ ALFG
Sbjct  281  CVNNTQSISLGRGTNGHELKQENLKCYVMGFDPETLQRCAKLRSREAVNLVEKHSCALFG  340

Query  273  RPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
              +      G +D+  DE+I  SFSSL+RLVLEA+ FGSFLWD E   D+ Y
Sbjct  341  DGQT-----GLLDT--DEVILTSFSSLKRLVLEAIAFGSFLWDAEEYADAVY  385



>gb|KJB42555.1| hypothetical protein B456_007G157400 [Gossypium raimondii]
Length=398

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 148/253 (58%), Gaps = 23/253 (9%)
 Frame = -3

Query  840  WMLMY-----LXVPAITSPSQNSSGS-IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGN  679
            +ML++     L VP +   S+      ++  PSKD +L  +HS E  E++++H+S ++G 
Sbjct  152  YMLIFYKFSDLRVPLVPKLSRCMYNCRLEIWPSKDWELESIHSIEVLEVVRDHISAVIGL  211

Query  678  RSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSG  514
            R++++     ++ +I +L +G++YAAS++YGYFLK    R QLE+ + ++ Q      + 
Sbjct  212  RADSSVTDNWATTEIQQLHLGRLYAASILYGYFLKSASSRHQLERCLTLVHQKRLNHRNS  271

Query  513  IQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKP-SRLRTYVMSFDGETLQRY  337
            +Q +                +V S P G    +G G + K    LR YVM FD ETLQR 
Sbjct  272  LQFLDLLPCGIKSLVLGRFSDVQSVPLG----QGPGRQEKDLEELRCYVMGFDPETLQRC  327

Query  336  ATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGS  157
            A  RSKEA ++IE+H+ ALFG  +  I PQ       DE+I+ SFSSL+RLVLEAV FGS
Sbjct  328  AKPRSKEAAHLIERHSCALFGDEQTGI-PQ------TDEVIRTSFSSLKRLVLEAVAFGS  380

Query  156  FLWDVESSVDSRY  118
            FLWD+E  VD+ Y
Sbjct  381  FLWDIEEYVDTVY  393



>gb|KHG02769.1| Phosphoserine aminotransferase [Gossypium arboreum]
Length=403

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 98/253 (39%), Positives = 148/253 (58%), Gaps = 23/253 (9%)
 Frame = -3

Query  840  WMLMY-----LXVPAITSPSQNSSGS-IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGN  679
            +ML++     L VP +   S+      ++  PSKD +L  +HS E  E++++H+S ++G 
Sbjct  157  YMLIFYKFSDLRVPLVPKLSRCMYNCRLEIWPSKDWELESIHSIEVLEVVRDHISAVIGL  216

Query  678  RSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSG  514
            R++++     ++ +I +L +G++YAAS++YGYFLK    R QLE+ + ++ Q      + 
Sbjct  217  RADSSVTDNWATTEIQQLHLGRLYAASILYGYFLKSASSRHQLERCLTLVHQKRLNHRNS  276

Query  513  IQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKP-SRLRTYVMSFDGETLQRY  337
            +Q +                +V S P G    +G G + K    LR YVM FD ETLQR 
Sbjct  277  LQFLDLLPCGIKSLVLGRFSDVQSVPLG----QGPGRQEKDLEELRCYVMGFDPETLQRC  332

Query  336  ATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGS  157
            A  RSKEA ++IE+H+ ALFG  +  I P+       DE+I+ SFSSL+RLVLEAV FGS
Sbjct  333  AKPRSKEAAHLIERHSCALFGDEQTGI-PE------TDEVIRTSFSSLKRLVLEAVAFGS  385

Query  156  FLWDVESSVDSRY  118
            FLWD+E  VD+ Y
Sbjct  386  FLWDIEEYVDTVY  398



>ref|XP_007209264.1| hypothetical protein PRUPE_ppa007392mg [Prunus persica]
 gb|EMJ10463.1| hypothetical protein PRUPE_ppa007392mg [Prunus persica]
Length=369

 Score =   152 bits (384),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 135/240 (56%), Gaps = 48/240 (20%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQIN  646
            +P I++ S + +G +D  P ++++L  +HSPEA EMIQ+HLSL+LG R     ++ V+I+
Sbjct  173  IPKISATS-DPTGRVDFWPMQEKKLESVHSPEALEMIQSHLSLVLGERLVGPLSAIVEIS  231

Query  645  KLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQV-GGDssdtslrs  469
            K+++G++YAAS+MYGYFLKRVDQRFQLE+ M  LP G   + +   Q+   DS       
Sbjct  232  KIKLGKLYAASIMYGYFLKRVDQRFQLERTMNTLPDGFTPDAAPANQLWDPDSLIRIPPD  291

Query  468  spSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHT  289
              S  +  S+ + G        + K  RLR+YVM                          
Sbjct  292  GGSDSDGGSYMNNG--------DDKSYRLRSYVM--------------------------  317

Query  288  EALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
                      IT  G+ID+S DE+I ++FS L  LVLEAV FGSFLWD E+ ++S YHF+
Sbjct  318  ----------ITEDGSIDASNDEVIALTFSGLTMLVLEAVAFGSFLWDAETYIESNYHFL  367


 Score = 39.7 bits (91),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADV  827
            +VK  ERR ALEEI+Y L+VQKF++ D+
Sbjct  143  QVKEKERRMALEEIIYCLIVQKFIENDI  170



>ref|XP_010069618.1| PREDICTED: uncharacterized protein LOC104456510 [Eucalyptus grandis]
 gb|KCW58026.1| hypothetical protein EUGRSUZ_H00754 [Eucalyptus grandis]
Length=389

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 138/255 (54%), Gaps = 50/255 (20%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++    N  G ++  P+KD +L  +H  +  EMI+ H++ ++G R +++     ++ 
Sbjct  159  VPKLSRCIYN--GRLEIWPAKDWELESIHGIDVLEMIKEHVAAVIGLRVDSSVTDNWATT  216

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
             I +L++GQ+YAASV+YGYFLK    R  LE ++ + PQG                    
Sbjct  217  HIQRLQLGQLYAASVLYGYFLKSASLRHHLECSLALSPQG----------------HRVF  260

Query  474  rsspSHPEVVSWPDG----------------GMGSRGFGTEMKPSRLRTYVMSFDGETLQ  343
              +  HP  + WP G                G  S   G   K   LR YVM FD ETLQ
Sbjct  261  HRNSLHPPKI-WPHGWNNLVCGRVSNDKLSLGQASIQDGNHGK---LRCYVMGFDPETLQ  316

Query  342  RYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTF  163
            R A +RS+EA+++IEKH+ ALFG  ++ +        + D++I  SFSSL+RLVLEA+ F
Sbjct  317  RCAKVRSREAMDLIEKHSCALFGDGKMGLI-------TSDDVILTSFSSLKRLVLEAIAF  369

Query  162  GSFLWDVESSVDSRY  118
            GSFLWDVE  VD+ Y
Sbjct  370  GSFLWDVEEHVDTVY  384



>gb|KDP45280.1| hypothetical protein JCGZ_15145 [Jatropha curcas]
Length=400

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 93/239 (39%), Positives = 133/239 (56%), Gaps = 20/239 (8%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++    N  G ++  PSKD +L  +HS E  EMI+ H+S ++G R+N++     ++ 
Sbjct  172  VPKLSRCIYN--GRLEIGPSKDWELESIHSFEVLEMIREHVSTVIGLRANSSVTDTWATT  229

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
            +I +L++G++Y AS++YGYFLK    R  LE  + V    +        Q+   S     
Sbjct  230  EIQRLQLGRLYVASILYGYFLKSASLRHYLELCLAVPHHDVHLSRRTSLQLPESSPYRIS  289

Query  474  rsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEK  295
                 H  V S      G +    + K   LR YVM FD ETLQR A ++SKEA+N+IEK
Sbjct  290  NLVFGHQSVSS------GQKSRKQDQKRGNLRCYVMGFDAETLQRCAKLKSKEAVNLIEK  343

Query  294  HTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            H+ ALFG  +  +          DE+I  SFSSL+RL+LEAV FGSFLWD E  V+S +
Sbjct  344  HSCALFGDDKAGLL-------ENDEVILTSFSSLKRLILEAVAFGSFLWDTEEYVNSVF  395



>ref|XP_010274079.1| PREDICTED: uncharacterized protein LOC104609452 [Nelumbo nucifera]
Length=414

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 97/245 (40%), Positives = 144/245 (59%), Gaps = 27/245 (11%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            +P ++   +N  G ++  PSKD+ L  +HS E  EM++ H+  I+G R  +      S+ 
Sbjct  181  IPRLSRCVRN--GKLEVWPSKDQDLEAIHSLEVVEMVKEHVGTIIGWRGKSRLTDNWSTT  238

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKV------LPQGLDKEDSGIQQVGGD  493
            QI+KL++G+VYAASVMYGYFLK    + +LE ++ +      L  G+    + +Q  G +
Sbjct  239  QIHKLQLGRVYAASVMYGYFLKSASLKHRLELSLALTHQDLPLGHGIRIPVTELQLHGLE  298

Query  492  ssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEA  313
            +     RS+ +    +     G G R  G +    +LR+YVM FD ETLQR A ++S+EA
Sbjct  299  NLVVLGRSTETRSTSLCQ---GTGRRVDGHK----KLRSYVMGFDSETLQRCAKLKSQEA  351

Query  312  INIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESS  133
             N+IEKH+ ALFG    S           D+++ ++FSSL+RLVLEA+ FGSFLWDVE+ 
Sbjct  352  ANLIEKHSWALFGDGNTS-------SLENDKVLVVTFSSLKRLVLEAIAFGSFLWDVETY  404

Query  132  VDSRY  118
            VD  Y
Sbjct  405  VDRVY  409



>ref|XP_002303068.2| hypothetical protein POPTR_0002s24910g [Populus trichocarpa]
 gb|EEE82341.2| hypothetical protein POPTR_0002s24910g [Populus trichocarpa]
Length=407

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/255 (38%), Positives = 141/255 (55%), Gaps = 47/255 (18%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++    N  G ++  PSKD +L  +HS E  EM++ H+S ++G ++N++     ++ 
Sbjct  174  VPKLSRCIYN--GRLEIRPSKDWELESIHSFEVLEMVREHVSTVIGLKANSSVADSWATT  231

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
            ++ + R+G+VYAAS++YGYFLK    R  LE  + VLP     +D  +            
Sbjct  232  EVQRCRLGRVYAASILYGYFLKSASLRHHLEWCL-VLPH----QDIHLGH----------  276

Query  474  rsspSHPEVVSWPDGGMGSRGFGT----------------EMKPSRLRTYVMSFDGETLQ  343
            RS+   PE  S P  G+ +  FG                 + +  +L+ Y+M FD ETLQ
Sbjct  277  RSTLQFPE--SLPSYGLTNLVFGHISNKQSTSQGTRLNRPKSEHEKLKCYMMGFDSETLQ  334

Query  342  RYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTF  163
            R A ++SKEA+N+IEKH+ ALFG  +  +          DE+I  SFSSL+RLVLEAV F
Sbjct  335  RCAKLKSKEAVNLIEKHSCALFGDEKTGVLEN-------DEVILTSFSSLKRLVLEAVAF  387

Query  162  GSFLWDVESSVDSRY  118
            G FLWD E  V+S Y
Sbjct  388  GCFLWDTEEDVNSVY  402



>ref|XP_010247844.1| PREDICTED: uncharacterized protein LOC104590798 [Nelumbo nucifera]
Length=415

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 142/245 (58%), Gaps = 27/245 (11%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++   +N  G +   PSKD++   +HS E  EM++ H+  I+G R   N     ++ 
Sbjct  182  VPRLSRCVRN--GKLAVWPSKDKEFEAIHSDELLEMVREHVRTIIGWRGRFNMTDNWTTT  239

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKV----LP--QGLDKEDSGIQQVGGD  493
            QI+KL++G+VYAAS++YGYFLK    R +LE ++ +    LP  +G+    + +Q  G +
Sbjct  240  QIHKLQLGRVYAASILYGYFLKSAYLRHRLELSLSLTHLDLPIGRGIRIPVTELQLHGSE  299

Query  492  ssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEA  313
                  RS     E +S     +  R      +   L++YVM FD ETLQR A ++S+EA
Sbjct  300  DHVLFGRS----AETIS---TSLYQRLGRHVDRHENLKSYVMKFDPETLQRCARLKSREA  352

Query  312  INIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESS  133
            +N+IEKH+ ALFG          T    KDE+I ++FSSL+RLVLEAV FGSFLWD E  
Sbjct  353  VNLIEKHSWALFG-------DGNTSSLEKDEVIVVTFSSLKRLVLEAVAFGSFLWDAERF  405

Query  132  VDSRY  118
            VDS Y
Sbjct  406  VDSVY  410



>ref|XP_002272171.1| PREDICTED: uncharacterized protein LOC100251038 [Vitis vinifera]
Length=380

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 136/242 (56%), Gaps = 22/242 (9%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++    N  G ++  P++D  L  +H+ E  EMI+ HL+ +LG +  +N     ++ 
Sbjct  152  VPRLSRCIYN--GRLEIWPARDWALECIHNFEVLEMIKEHLTTVLGWKPKSNVTENWATT  209

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKED-SGIQQVGGDssdts  478
            QI + ++GQ+YAAS++YGYFLK    R  LE ++      L   + SG    G       
Sbjct  210  QIRRFQLGQIYAASILYGYFLKSASLRHHLEMSLVHSHHDLPSSNVSGFWSYG-------  262

Query  477  lrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIE  298
            L+     P   S P     +     E +  +LR YVM FD +TLQR A ++SKEA+N++E
Sbjct  263  LKDLFLGPNCSSQPTSLGEASSRQEEKEEKKLRCYVMGFDPDTLQRCAKLKSKEAVNLVE  322

Query  297  KHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            KH+ ALFG  +      G +++  D++I  SFSS++RLVLEAV FGSFLWD E  V S Y
Sbjct  323  KHSCALFGDEKT-----GLLET--DDVISTSFSSMKRLVLEAVAFGSFLWDTEEYVGSVY  375

Query  117  HF  112
            + 
Sbjct  376  NL  377



>ref|XP_006368347.1| hypothetical protein POPTR_0001s01860g [Populus trichocarpa]
 gb|ERP64916.1| hypothetical protein POPTR_0001s01860g [Populus trichocarpa]
Length=219

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 93/233 (40%), Positives = 127/233 (55%), Gaps = 62/233 (27%)
 Frame = -3

Query  801  PSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNR--SNANSSVQINKLRVGQ  628
            P+ + +G +   P+++++L         EMIQ+HLS++LG R      + V+I+K     
Sbjct  45   PTSDPTGRVGFRPNQEQKL---------EMIQSHLSIVLGERLVCPLETIVEISK-----  90

Query  627  VYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEV  448
                                  +N    P+ L      I+ V GDS              
Sbjct  91   ----------------------RNRLWRPESL------IRIVPGDS--------------  108

Query  447  VSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRP  268
              +PDGG    G   E K  RLR+YVM  D ETLQRYATIRSKEAI++ EK T+ALFGRP
Sbjct  109  -GYPDGGFTDTG---EEKSYRLRSYVMYLDVETLQRYATIRSKEAISLNEKQTQALFGRP  164

Query  267  EISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +ISI   G+I+++ DE++ I+FS L   VLEAV FGSFLWD ES V+S+YHF+
Sbjct  165  DISIAKNGSIETANDEVVSITFSGLTMPVLEAVAFGSFLWDAESYVESKYHFL  217



>ref|XP_006367000.1| PREDICTED: uncharacterized protein LOC102582294 [Solanum tuberosum]
Length=390

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 134/251 (53%), Gaps = 40/251 (16%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSS-----V  655
            +P ++    N  G ++  P KD +L  +HS E  EM++ HL+ +LG +  +N +      
Sbjct  158  IPRLSKCMYN--GRLEIWPCKDWELESIHSCEVLEMVREHLTTVLGWKEKSNVADNWTPT  215

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKED------SGIQQVGGD  493
            ++ K ++ QVYAASV+YGYFLK    R  LEK +  +   LD         S I+ +G  
Sbjct  216  EVQKFKLCQVYAASVLYGYFLKSASLRHHLEKKLDHINPYLDIASYNQLLLSEIRSLGS-  274

Query  492  ssdtslrsspSHPEVVSW-PDGGMGSRGFGT-----EMKPSRLRTYVMSFDGETLQRYAT  331
                         E+V +   GG  S   G      E K  +L+ YVMSFD ETLQ +A 
Sbjct  275  -------------EIVPFGCIGGTRSTSVGQIPLLREKKQDKLKYYVMSFDPETLQMWAK  321

Query  330  IRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFL  151
             +SKEA+N+IEKH+ ALFG  +  +        + DE+I  S +SL+R+VLEA+ FGSFL
Sbjct  322  PKSKEALNLIEKHSYALFGDKKTGLV-------ASDEVILTSLASLKRIVLEAIAFGSFL  374

Query  150  WDVESSVDSRY  118
            WD E  V   Y
Sbjct  375  WDAEEYVRIVY  385



>ref|XP_011024597.1| PREDICTED: uncharacterized protein LOC105125729 [Populus euphratica]
Length=404

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 141/255 (55%), Gaps = 47/255 (18%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++    N    ++  PSKD +L  +HS E  EM++ H+S ++G ++N++     ++ 
Sbjct  171  VPKLSRCIYN--ARLEIRPSKDWELESIHSFEVLEMVREHVSTVIGLKANSSVADSWATT  228

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
            ++ + R+G+VYAAS++YGYFLK    R  LE  + VLP     +D  +            
Sbjct  229  EVQRCRLGRVYAASILYGYFLKSASLRHHLEWCL-VLPH----QDIHLGH----------  273

Query  474  rsspSHPEVVSWPDGGMGSRGFG---------TEMKPSR-------LRTYVMSFDGETLQ  343
            R++   PE  S P  G+ +  FG          E + +R       L+ Y+M FD ETL+
Sbjct  274  RTTLQFPE--SLPSYGLTNLVFGHISNKQSTSQETRLNRPKSEHEKLKCYLMGFDSETLK  331

Query  342  RYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTF  163
            R A ++SKEA+N+IEKH+ ALFG  +  +          DE+I  SFSSL+RLVLEAV F
Sbjct  332  RCAKLKSKEAVNLIEKHSCALFGDEKTGVLEN-------DEVILTSFSSLKRLVLEAVAF  384

Query  162  GSFLWDVESSVDSRY  118
            G FLWD E  V+S Y
Sbjct  385  GCFLWDTEEYVNSVY  399



>emb|CBI40011.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   132 bits (333),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 81/109 (74%), Gaps = 1/109 (1%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSSV-QINK  643
            +P ++  S  SSG +D  PS D  L  LHSPEA EMIQNHL+ ILGNR   ++SV +++K
Sbjct  167  IPRMSPSSLGSSGRVDNWPSLDRDLGELHSPEATEMIQNHLAFILGNRFGDSTSVAKMSK  226

Query  642  LRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGG  496
            LRVGQVYAASVMYGYFLKRVD+RFQLEK MK+LP  LD +   +++  G
Sbjct  227  LRVGQVYAASVMYGYFLKRVDERFQLEKTMKILPYALDGDKGYVEEAMG  275


 Score = 46.6 bits (109),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -2

Query  910  EVKAXERRKALEEILYALVVQKFMDADVP  824
            +VKA ER+KALEEILY LVVQKF+ A+VP
Sbjct  137  KVKANERKKALEEILYVLVVQKFVGANVP  165



>ref|XP_004290164.1| PREDICTED: uncharacterized protein LOC101305809 [Fragaria vesca 
subsp. vesca]
Length=379

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 134/229 (59%), Gaps = 25/229 (11%)
 Frame = -3

Query  777  IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSS-----VQINKLRVGQVYAAS  613
            ++ LP+KD +L  ++S E  EMI+ H++ ++G R+N++ +      +I +  +G+VY AS
Sbjct  162  LEILPAKDWELESIYSLEVLEMIREHVTTVIGLRANSSVTDNWAMTKITRQTLGRVYVAS  221

Query  612  VMYGYFLKRVDQRFQLEKNMKVLPQGLDKE-DSGIQQVGGDssdtslrsspSHPEVVSWP  436
            ++YGYFLK V  R +LE+++ +  Q L     + +Q++      +          ++   
Sbjct  222  ILYGYFLKSVSLRHRLERSLFLESQDLHLSCRTSLQEMSPHGIKS----------LIFGH  271

Query  435  DGGMGSRGFGT---EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPE  265
             G + S   G+   E    +L+ YVM FD ETLQR A +RS+E++++I+ H  ALFG   
Sbjct  272  VGKIQSECVGSNRLEKTHGKLKCYVMGFDPETLQRCAKLRSEESVDLIKNHCCALFGDDA  331

Query  264  ISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
               +P+       DE+I  SFSSL+RLVLEAV FGSFLWD E  +DS Y
Sbjct  332  EMGSPE------IDEVISTSFSSLKRLVLEAVAFGSFLWDTEECIDSVY  374



>ref|XP_010908555.1| PREDICTED: uncharacterized protein LOC105034920 isoform X2 [Elaeis 
guineensis]
Length=351

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 129/242 (53%), Gaps = 18/242 (7%)
 Frame = -3

Query  825  LXVPAITSPSQN-SSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----  664
            + VP + + S+      +D   S+D +L  +H PE  EM++ HLS IL  R   N     
Sbjct  117  IKVPMVPNLSKCIKYARLDMSSSQDAELESIHDPEILEMVREHLSNILKWRGKVNLIENS  176

Query  663  SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd  484
            S + I ++++G++YAAS+MYGYF+K V  R QLE     L      ED  + Q+      
Sbjct  177  SMIHIKRVQLGRIYAASIMYGYFIKSVSLRHQLE-----LSLARTDEDLPLGQLMNSELF  231

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
               +         S+         +    +  +LR+Y+M FD ETLQ  A +RS+EA+N+
Sbjct  232  KKEQEENLVALGCSFDMASSLHPSYDRRRRVEKLRSYMMGFDSETLQICAKLRSQEAVNL  291

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKH+ ALF   E S         + D  I +++S+ +RLVLEAV FGSFLWDVE  VDS
Sbjct  292  IEKHSYALFEDREKST-------QTNDGNIIVTYSAFKRLVLEAVAFGSFLWDVERYVDS  344

Query  123  RY  118
             Y
Sbjct  345  IY  346



>ref|XP_010908554.1| PREDICTED: uncharacterized protein LOC105034920 isoform X1 [Elaeis 
guineensis]
Length=408

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 87/225 (39%), Positives = 122/225 (54%), Gaps = 17/225 (8%)
 Frame = -3

Query  777  IDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAAS  613
            +D   S+D +L  +H PE  EM++ HLS IL  R   N     S + I ++++G++YAAS
Sbjct  191  LDMSSSQDAELESIHDPEILEMVREHLSNILKWRGKVNLIENSSMIHIKRVQLGRIYAAS  250

Query  612  VMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD  433
            +MYGYF+K V  R QLE     L      ED  + Q+         +         S+  
Sbjct  251  IMYGYFIKSVSLRHQLE-----LSLARTDEDLPLGQLMNSELFKKEQEENLVALGCSFDM  305

Query  432  GGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISIT  253
                   +    +  +LR+Y+M FD ETLQ  A +RS+EA+N+IEKH+ ALF   E S  
Sbjct  306  ASSLHPSYDRRRRVEKLRSYMMGFDSETLQICAKLRSQEAVNLIEKHSYALFEDREKST-  364

Query  252  PQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
                   + D  I +++S+ +RLVLEAV FGSFLWDVE  VDS Y
Sbjct  365  ------QTNDGNIIVTYSAFKRLVLEAVAFGSFLWDVERYVDSIY  403



>ref|XP_004247039.1| PREDICTED: uncharacterized protein LOC101262953 [Solanum lycopersicum]
Length=390

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 86/234 (37%), Positives = 124/234 (53%), Gaps = 26/234 (11%)
 Frame = -3

Query  786  SGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSS-----VQINKLRVGQVY  622
            +G ++  P KD +L  +HS E  EM++ HL+ +LG +  +N +      ++ K ++ QVY
Sbjct  167  NGRLEIWPCKDWELESIHSCEVLEMVREHLTSVLGWKEKSNVADNWTPTEVQKFKLCQVY  226

Query  621  AASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKED------SGIQQVGGDssdtslrsspS  460
             ASV+YGYFLK    R  LEK +  +   LD         S IQ +G +           
Sbjct  227  VASVLYGYFLKSASLRHHLEKKLDHINPYLDLASYKQLLLSTIQSLGSEIVPFGCIGGTR  286

Query  459  HPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEAL  280
               V   P           E K  +L+ YVM+FD E LQ  A  +SKEA+N+IEKH+ AL
Sbjct  287  STSVSQIP--------LLREKKQDKLKYYVMNFDPEMLQMCAKPKSKEALNLIEKHSYAL  338

Query  279  FGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
            FG        + T+  + D++I  S +SL+R+VLEA+ FGSFLWD E  V + Y
Sbjct  339  FG-------DKNTVLVASDDVILTSLASLKRIVLEAIAFGSFLWDAEEYVRTVY  385



>ref|XP_006432689.1| hypothetical protein CICLE_v10003247mg [Citrus clementina]
 gb|ESR45929.1| hypothetical protein CICLE_v10003247mg [Citrus clementina]
Length=129

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%), Gaps = 1/110 (1%)
 Frame = -3

Query  435  DGGMGSRGF-GTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEIS  259
            DG +G     G E K  RLR+YVM  D ETLQRYATIRSKEAI++IEK T+ALFGRP++ 
Sbjct  18   DGTVGESFMDGGEGKSYRLRSYVMYLDAETLQRYATIRSKEAISLIEKQTQALFGRPDVR  77

Query  258  ITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHFV  109
            +   G+ID+SKDE+I ++F  L  LVLEAV FGSF+WD ES V+S+Y F+
Sbjct  78   VLEDGSIDTSKDEVISVTFLGLTMLVLEAVAFGSFMWDSESYVESKYPFI  127



>ref|XP_010100787.1| hypothetical protein L484_015816 [Morus notabilis]
 gb|EXB84485.1| hypothetical protein L484_015816 [Morus notabilis]
Length=363

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 91/247 (37%), Positives = 138/247 (56%), Gaps = 37/247 (15%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSS-----V  655
            VP ++    N  G ++  P KD +L  ++S E  E+++ H++ ++G R+N++ +      
Sbjct  136  VPRLSGCVYN--GRLEIWPPKDWELESIYSFEVLEIVREHIAAVIGLRANSSITDHWAIT  193

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
             I K  + ++Y AS++YGYFLK    R QLE+ +      LD +D  ++Q          
Sbjct  194  TIAKSALSRIYIASILYGYFLKSALLRLQLEQCV-----ALDSQDLPLRQ----------  238

Query  474  rsspSHPEVVSWPDGGMGS--------RGFGTEMKPSRLRTYVMSFDGETLQRYATIRSK  319
            R++  H  + +   G +GS             E KP  L+ YVM FD ETLQR A ++SK
Sbjct  239  RTTVQHHGIKNLLFGRIGSIQSESQSLDPSSQEKKPENLKCYVMGFDPETLQRCAKLKSK  298

Query  318  EAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVE  139
            EA ++IE H+ ALFG  +      G++D   DE+I  SFSSL+RLVLEAV FGSFLW+ E
Sbjct  299  EATSLIENHSSALFGDEK-----TGSLDD--DEVILTSFSSLKRLVLEAVAFGSFLWETE  351

Query  138  SSVDSRY  118
              V++ Y
Sbjct  352  ECVNTVY  358



>ref|XP_009587865.1| PREDICTED: uncharacterized protein LOC104085515 [Nicotiana tomentosiformis]
Length=387

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 131/249 (53%), Gaps = 32/249 (13%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSS-----V  655
            VP ++    N  G ++  P +D +L  +HS E  EM++ HL+++LG +  +N +      
Sbjct  155  VPKLSKCMYN--GRLEIWPCRDWELESIHSCEVLEMVREHLTIVLGWKEKSNVTDNWAPT  212

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtsl  475
            ++ KL++ +VYAASV++GYFLK    R  LE+ +  + + L         + G S     
Sbjct  213  KVQKLQLCRVYAASVLFGYFLKSASLRHHLEQKVDHINRDLG--------IAGSSQLLLS  264

Query  474  rsspSHPEVVSWPDGGM-GSRGFGT-------EMKPSRLRTYVMSFDGETLQRYATIRSK  319
                   E V  P G + G+R           E K  +L+ YVMSFD ETLQ  A  +SK
Sbjct  265  ELRSLGSETV--PFGRISGTRSTSVGRIPLVREKKQEKLKYYVMSFDAETLQMCAKPKSK  322

Query  318  EAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVE  139
            EA+N+IEKH  ALFG  +  +   G +       I  S +SL+R+VLEA+ FGSFLWD E
Sbjct  323  EALNLIEKHIYALFGDEKTGLIASGGV-------ISTSLASLKRIVLEAIAFGSFLWDAE  375

Query  138  SSVDSRYHF  112
              + + Y  
Sbjct  376  EYIRTVYQL  384



>gb|KFK38188.1| hypothetical protein AALP_AA3G080700 [Arabis alpina]
Length=374

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 95/272 (35%), Positives = 135/272 (50%), Gaps = 65/272 (24%)
 Frame = -3

Query  876  KRFCMPWWCRNSWMLMY-----LXVPAITSPSQN-SSGSIDTLPSKDEQLARLHSPEAYE  715
            +R+C        +ML++     + VP +   S+   +G ++  P+KD +L  +HS EA E
Sbjct  133  ERYCKTAVQDIMYMLIFYKYSEIRVPLVPKLSRCIYNGRLEIWPTKDWELESIHSCEALE  192

Query  714  MIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMK  550
            +I+ H+S ++G R N+      ++ +I KL +G VYAAS++YGYFLK    R QLE    
Sbjct  193  LIKEHVSAVIGLRVNSCVTDNWATTEIQKLHLGNVYAASILYGYFLKSASLRHQLE----  248

Query  549  VLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPS------  388
                        +  + G                     G + S  FG     S      
Sbjct  249  ----------CSLSDIHGS--------------------GYLKSSVFGCSFTTSNAQIST  278

Query  387  --RLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELI  214
              +LR Y+ +FD ETLQR A  R++EA+N+IEK + ALFG  +             DE I
Sbjct  279  KQQLRHYISAFDPETLQRCAKPRTEEAMNLIEKQSLALFGTED------------HDETI  326

Query  213  KISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
              SFSSL+RLVLEAV FG+FLWD E  VD  Y
Sbjct  327  VTSFSSLKRLVLEAVAFGTFLWDTELYVDGAY  358



>ref|XP_011089045.1| PREDICTED: uncharacterized protein LOC105170122 [Sesamum indicum]
Length=378

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 126/231 (55%), Gaps = 20/231 (9%)
 Frame = -3

Query  786  SGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSVQINKLRVGQVY  622
            +G ++  PSKD +L  +HS E  +M++ HL  ++G RS +N     ++ +I +L++ ++Y
Sbjct  155  NGRLEIWPSKDWELESIHSFEVLQMVREHLRAVVGWRSISNVTASWATTEIQRLKLCKLY  214

Query  621  AASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGI---QQVGGDssdtslrsspSHPE  451
            AAS++YGYFLK    R  LE+ +      L     GI    Q+      +      +   
Sbjct  215  AASILYGYFLKSASLRHHLERVLD-----LSNSHFGIGARNQLSAPEMFSVGSDYITSGR  269

Query  450  VVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGR  271
            V S     +G   +    K    R YVM FD ET+Q  A  +SKEA+N+IE+H+ ALFG 
Sbjct  270  VGSAKSSSVGRVSYSLGSKQENFRFYVMGFDAETIQMCAKPKSKEAVNLIERHSSALFGD  329

Query  270  PEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRY  118
             E  +          +++I  SF+SL+R +LEAV FGSFLW+ E+ V++ Y
Sbjct  330  EETGLV-------ETNDVITTSFASLKRFLLEAVAFGSFLWEAENCVNAVY  373



>ref|XP_008776305.1| PREDICTED: uncharacterized protein LOC103696450 [Phoenix dactylifera]
Length=408

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/242 (37%), Positives = 127/242 (52%), Gaps = 18/242 (7%)
 Frame = -3

Query  825  LXVPAITSPSQN-SSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILG-----NRSNAN  664
            + VP + + S+      +D   SKD +L  +H  E  EM++ HLS IL      N    +
Sbjct  174  IKVPMVPNLSECIKYARLDMSSSKDAELESIHDSEILEMVREHLSNILKWKGKINLMENS  233

Query  663  SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssd  484
            S + I ++++G++YAAS+MYGYF+K V  R QLE     L      ED  + Q+      
Sbjct  234  SMIHIKRVQLGRIYAASIMYGYFIKSVSLRHQLE-----LSLARTDEDLPLGQLMNSELF  288

Query  483  tslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINI  304
               +         S+         +    +  +LR+Y+M FD ETLQ  A +RS+EAIN+
Sbjct  289  KKEQEENLVALGCSFDMASSLHPSYDRRRRVEKLRSYMMGFDSETLQICAKLRSREAINL  348

Query  303  IEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDS  124
            IEKH+ ALF   + S           D  I +++S+ +RLVLEAV FGSFLWDVE  VDS
Sbjct  349  IEKHSYALFEDRQKSTQKN-------DGNIIVTYSAFKRLVLEAVAFGSFLWDVEKYVDS  401

Query  123  RY  118
             Y
Sbjct  402  IY  403



>ref|XP_009763079.1| PREDICTED: uncharacterized protein LOC104215037 [Nicotiana sylvestris]
Length=392

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/229 (37%), Positives = 121/229 (53%), Gaps = 26/229 (11%)
 Frame = -3

Query  765  PSKDEQLARLHSPEAYEMIQNHLSLILGNRSNANSS-----VQINKLRVGQVYAASVMYG  601
            P +D +L  +HS E  EM++ HL+ +LG +  +N +      ++ KL++ +VYAASV++G
Sbjct  176  PCRDWELESIHSCEVLEMVREHLTTVLGWKEKSNVTDNWAPTKVRKLQLCRVYAASVLFG  235

Query  600  YFLKRVDQRFQLEKNMKVLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPD-GGM  424
            YFLK    R  LE+ +  + + L         + G S            E V +    G 
Sbjct  236  YFLKSASLRHHLEQKVDHINRDLG--------IAGSSQLLLSELRSLGSETVPFSHISGT  287

Query  423  GSRGFGT-----EMKPSRLRTYVMSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEIS  259
             S   G      E K  +L+ YVMSFD ETLQ  A  +SKEA+N+IEKH  ALFG  +  
Sbjct  288  RSTSVGRIPLVREKKQEKLKYYVMSFDAETLQMCAKPKSKEALNLIEKHIYALFGDEKTG  347

Query  258  ITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSRYHF  112
            +   G       E+I  S +SL+R+VLEA+ FGSFLWD E  + + Y  
Sbjct  348  LIASG-------EVISTSLASLKRIVLEAIAFGSFLWDAEEYIRTVYQL  389



>ref|XP_003520988.1| PREDICTED: uncharacterized protein LOC100793365 [Glycine max]
Length=393

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 136/244 (56%), Gaps = 32/244 (13%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++S   N  G ++ LPSKD +L  +HS E  +MI+ H++ + G R+ ++     ++ 
Sbjct  167  VPKLSSCLYN--GRLEILPSKDWELESIHSLEVLDMIREHITTVTGLRAKSSVTECWATT  224

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD--KEDSGIQQVGGDssdt  481
             + +  + +VY AS++YGYFLK V  R+ LE+N+ +    L    + S +   G      
Sbjct  225  HVRQFLLARVYVASILYGYFLKSVSLRYHLERNLSLANHDLHLGHKTSLMCSYG------  278

Query  480  slrsspSHPEVVSWPDGGMGSRGFGT---EMKPSRLRTYVMSFDGETLQRYATIRSKEAI  310
                     + +      M S G G    E +   L+ YVMSF   +LQR A +RSKEA+
Sbjct  279  -------FKDAIFGHLSNMSSLGQGLIRPEEELEDLKCYVMSFHPGSLQRCARLRSKEAV  331

Query  309  NIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSV  130
            N++  ++ ALF   E      G++++  D++I  SFSSL+RLVLEAV FGSFLW++E  +
Sbjct  332  NLVGSYSCALFNNEE-----SGSVEN--DDVILTSFSSLKRLVLEAVAFGSFLWEIEDYI  384

Query  129  DSRY  118
            D+ Y
Sbjct  385  DNVY  388



>gb|KHN40722.1| hypothetical protein glysoja_049851 [Glycine soja]
Length=381

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/241 (36%), Positives = 135/241 (56%), Gaps = 26/241 (11%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++S   N  G ++ LPSKD +L  +HS E  +MI+ H++ + G R+ ++     ++ 
Sbjct  155  VPKLSSCLYN--GRLEILPSKDWELESIHSSEVLDMIREHITTVTGLRAKSSVTECWATT  212

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD--KEDSGIQQVGGDssdt  481
            Q+ +  + +VY AS++YGYFLK V  R+ LE+N+ +    L      S +   G   +  
Sbjct  213  QVRQFLLARVYVASILYGYFLKSVSLRYHLERNLSLANHDLHLGHRTSVMFSYGFKDAIF  272

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
                      + + P  G G      E +   L+ YVMSF   +LQR A +RSKEA+N++
Sbjct  273  G--------HLSNMPSLGQGL--IRPEEEIEDLKCYVMSFHPGSLQRCARLRSKEAVNLV  322

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
              ++ ALF   E      G++++  D++I  SFSSL+RLVLEAV FGSFLW+ E  +D+ 
Sbjct  323  GSYSCALFNNKE-----SGSVEN--DDVILTSFSSLKRLVLEAVAFGSFLWETEDYIDNV  375

Query  120  Y  118
            Y
Sbjct  376  Y  376



>ref|XP_006599165.1| PREDICTED: uncharacterized protein LOC100804253 [Glycine max]
Length=388

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/241 (36%), Positives = 135/241 (56%), Gaps = 26/241 (11%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++S   N  G ++ LPSKD +L  +HS E  +MI+ H++ + G R+ ++     ++ 
Sbjct  162  VPKLSSCLYN--GRLEILPSKDWELESIHSSEVLDMIREHITTVTGLRAKSSVTECWATT  219

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLD--KEDSGIQQVGGDssdt  481
            Q+ +  + +VY AS++YGYFLK V  R+ LE+N+ +    L      S +   G   +  
Sbjct  220  QVRQFLLARVYVASILYGYFLKSVSLRYHLERNLSLANHDLHLGHRTSVMFSYGFKDAIF  279

Query  480  slrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATIRSKEAINII  301
                      + + P  G G      E +   L+ YVMSF   +LQR A +RSKEA+N++
Sbjct  280  G--------HLSNMPSLGQGL--IRPEEEIEDLKCYVMSFHPGSLQRCARLRSKEAVNLV  329

Query  300  EKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVESSVDSR  121
              ++ ALF   E      G++++  D++I  SFSSL+RLVLEAV FGSFLW+ E  +D+ 
Sbjct  330  GSYSCALFNNKE-----SGSVEN--DDVILTSFSSLKRLVLEAVAFGSFLWETEDYIDNV  382

Query  120  Y  118
            Y
Sbjct  383  Y  383



>ref|XP_006848511.1| hypothetical protein AMTR_s00013p00260550 [Amborella trichopoda]
 gb|ERN10092.1| hypothetical protein AMTR_s00013p00260550 [Amborella trichopoda]
Length=424

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 140/247 (57%), Gaps = 26/247 (11%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNA----NSSVQ  652
            VP ++   +N  G  DT    D +L  +H  EA  M+++HL+ ILG RS++    NS V 
Sbjct  185  VPRLSKCIKN--GKADTWSCHDSELEAIHDWEARIMVKDHLNKILGRRSDSSYTLNSCVM  242

Query  651  --INKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKV-----LPQGLDKEDSGIQQVGGD  493
              I +L++G++YA+SVMYGYFL+   +R+ LEK++ V     L QG+   DSG   +  +
Sbjct  243  TLIGRLQLGKLYASSVMYGYFLESACRRYHLEKSLHVRSDHPLFQGITLPDSGCWHLTPE  302

Query  492  ssdtslrsspSHPEVVSWPDGGMGSRGFGTEM--KPSRLRTYVMSFDGETLQRYATIRSK  319
            +           P  V+          + ++   +   L+ Y+  F+ ET QR A +RSK
Sbjct  303  TLI---------PLGVTEEQETCCGDTYSSKTIDELDSLKRYITGFNAETFQRCAALRSK  353

Query  318  EAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLWDVE  139
            EA+N++EKH+ ALF   E     +  +   +DE++ IS SSL+RLVLEAV FG FL++VE
Sbjct  354  EAVNLVEKHSWALF--GECEEEGEEGMGEEQDEVLLISISSLKRLVLEAVAFGLFLYNVE  411

Query  138  SSVDSRY  118
            + VD  Y
Sbjct  412  AYVDPIY  418



>ref|XP_010547130.1| PREDICTED: uncharacterized protein LOC104818981 [Tarenaya hassleriana]
Length=370

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 96/261 (37%), Positives = 138/261 (53%), Gaps = 59/261 (23%)
 Frame = -3

Query  840  WMLMY-----LXVPAITSPSQN-SSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGN  679
            +ML++     + VP +   S+   +G ++  PSKD +L  +HS +A E+I+ H+S ++G 
Sbjct  132  YMLIFYKFSEIRVPLVPKLSRCIYNGRLEIWPSKDWELESIHSIDALELIKEHVSAVIGL  191

Query  678  RSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMKVLPQGLDKEDSG  514
            R N++     ++ QI KL +G+VY AS++YGYFLK    R QLE ++          D  
Sbjct  192  RVNSSVTDNWATTQIQKLHLGRVYTASILYGYFLKSATLRHQLECSLS---------DLQ  242

Query  513  IQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGT---------EMKPSRLRTYVMSF  361
            I Q                P  + +P G +    F T         E+K   LR Y+  F
Sbjct  243  INQ--------------QRP--IQFPKGPVFGCSFPTSTPQAFENRELK--HLRHYISGF  284

Query  360  DGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLV  181
            + ETLQR A  RS+EA N+IEK + ALFG+ +             DE++  SFSSL+RLV
Sbjct  285  NPETLQRCAKPRSEEARNLIEKQSIALFGQEK------------GDEVVVTSFSSLKRLV  332

Query  180  LEAVTFGSFLWDVESSVDSRY  118
            LEAV FG+FLWD E  VD  Y
Sbjct  333  LEAVAFGTFLWDTEEYVDGVY  353



>ref|XP_006407850.1| hypothetical protein EUTSA_v10020977mg [Eutrema salsugineum]
 gb|ESQ49303.1| hypothetical protein EUTSA_v10020977mg [Eutrema salsugineum]
Length=367

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/264 (36%), Positives = 131/264 (50%), Gaps = 49/264 (19%)
 Frame = -3

Query  876  KRFCMPWWCRNSWMLMY-----LXVPAITSPSQN-SSGSIDTLPSKDEQLARLHSPEAYE  715
            +R+C        +ML++     + VP +   S+   +G ++  P+KD +L  +HS +A E
Sbjct  126  ERYCKTAVQDIMYMLIFYKYSEIRVPLVPKLSRCIYNGRLEIWPTKDWELESIHSCDALE  185

Query  714  MIQNHLSLILGNRSNAN-----SSVQINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNMK  550
            +I+ H+S ++G R N+      ++ QI KL +G+VY AS+MYGYFLK    R QLE +  
Sbjct  186  LIKEHVSAVIGLRVNSCVTDNWATTQIQKLHLGKVYVASIMYGYFLKSASLRHQLECSFS  245

Query  549  VLPQGLDKEDSGIQQVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYV  370
                  D   SG  +                    S   G   + G        +LR Y+
Sbjct  246  ------DLHGSGYLK--------------------SPVFGCSVTTGTAQISTKQKLRHYI  279

Query  369  MSFDGETLQRYATIRSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLR  190
              FD  TLQR A  R++EA N+IEK   ALFG  E             DE I  SFSSL+
Sbjct  280  SGFDPVTLQRCANPRTEEARNLIEKQCLALFGTEE------------SDETIVTSFSSLK  327

Query  189  RLVLEAVTFGSFLWDVESSVDSRY  118
            RLVLEAV FG+FLWD E  VD  Y
Sbjct  328  RLVLEAVAFGTFLWDTELYVDGAY  351



>gb|KHN21277.1| hypothetical protein glysoja_038588 [Glycine soja]
Length=293

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/250 (36%), Positives = 133/250 (53%), Gaps = 40/250 (16%)
 Frame = -3

Query  819  VPAITSPSQNSSGSIDTLPSKDEQLARLHSPEAYEMIQNHLSLILGNRSNAN-----SSV  655
            VP ++S   +  G ++ LPSKD  L  +HS E  ++I+ H+S + G RSN +      + 
Sbjct  60   VPKLSSCLYD--GRLEILPSKDWDLESIHSLEVLDIIRKHVSTVTGLRSNPSVRESWETT  117

Query  654  QINKLRVGQVYAASVMYGYFLKRVDQRFQLEKNM-----------KVLPQGLDKEDSGIQ  508
             I ++ + QVY AS++YGYFLK V  R+ LE+++           K+ P   D   SG +
Sbjct  118  PIRQVWLAQVYVASILYGYFLKSVSLRYNLERSLSLSDHDFHHGHKIGPSFHDMYHSGAK  177

Query  507  QVGGDssdtslrsspSHPEVVSWPDGGMGSRGFGTEMKPSRLRTYVMSFDGETLQRYATI  328
             V             +  ++ S   G +G      E +   L+ YV  F   + +R A +
Sbjct  178  DV----------MFGNKSDIQSVWHGLIGQ-----EEEIEDLKCYVTGFHPGSFERCAKL  222

Query  327  RSKEAINIIEKHTEALFGRPEISITPQGTIDSSKDELIKISFSSLRRLVLEAVTFGSFLW  148
            RSKEA++++E H+ ALFG  +  +       S  D++I  SFSSLRRLVLEAV FGSFLW
Sbjct  223  RSKEAVHLVESHSNALFGDGKSGL-------SQHDDIIVTSFSSLRRLVLEAVAFGSFLW  275

Query  147  DVESSVDSRY  118
            + E  +DS Y
Sbjct  276  ETEDYIDSVY  285



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2048534808000