BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038D18

Length=897
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                   376   6e-127   Citrus sinensis [apfelsine]
gb|KJB11770.1|  hypothetical protein B456_001G276400                    376   9e-127   Gossypium raimondii
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    375   2e-126   Camelina sativa [gold-of-pleasure]
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    375   3e-126   Camelina sativa [gold-of-pleasure]
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                378   4e-126   Arachis hypogaea [goober]
gb|KJB70724.1|  hypothetical protein B456_011G088800                    374   8e-126   Gossypium raimondii
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    376   1e-125   Cucumis melo [Oriental melon]
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    376   2e-125   Cucumis melo [Oriental melon]
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             375   3e-125   Citrus clementina [clementine]
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    375   4e-125   Citrus sinensis [apfelsine]
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    375   5e-125   Arabis alpina [alpine rockcress]
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         374   9e-125   Morus notabilis
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   3e-124   Solanum lycopersicum
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                373   3e-124   Mangifera indica
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   3e-124   Nicotiana sylvestris
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   5e-124   Populus euphratica
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    368   5e-124   Tarenaya hassleriana [spider flower]
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             372   5e-124   Populus trichocarpa [western balsam poplar]
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             372   6e-124   Cucumis sativus [cucumbers]
gb|KJB11771.1|  hypothetical protein B456_001G276400                    372   8e-124   Gossypium raimondii
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   8e-124   
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             372   8e-124   Eutrema salsugineum [saltwater cress]
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   9e-124   Camelina sativa [gold-of-pleasure]
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    373   9e-124   
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   1e-123   Populus euphratica
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   1e-123   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   1e-123   Oryza brachyantha
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             372   1e-123   Prunus persica
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   1e-123   Nicotiana tomentosiformis
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   1e-123   
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    371   1e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             371   1e-123   Capsella rubella
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    371   1e-123   Camelina sativa [gold-of-pleasure]
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    371   1e-123   
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    371   1e-123   Glycine soja [wild soybean]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    371   1e-123   Prunus mume [ume]
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    371   1e-123   
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    369   2e-123   Arabidopsis thaliana [mouse-ear cress]
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    371   2e-123   Glycine soja [wild soybean]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    371   2e-123   
ref|XP_002875330.1|  gapa                                               371   2e-123   Arabidopsis lyrata subsp. lyrata
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    371   2e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    371   2e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    371   2e-123   Brassica rapa
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    371   2e-123   Cicer arietinum [garbanzo]
gb|KJB70723.1|  hypothetical protein B456_011G088800                    371   3e-123   Gossypium raimondii
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    370   3e-123   Nelumbo nucifera [Indian lotus]
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    370   4e-123   Nelumbo nucifera [Indian lotus]
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             370   4e-123   Nicotiana benthamiana
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      368   4e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                370   4e-123   Arabidopsis thaliana [mouse-ear cress]
gb|ACU21011.1|  unknown                                                 370   5e-123   Glycine max [soybeans]
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    370   5e-123   Ricinus communis
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         370   5e-123   Jatropha curcas
gb|ABK96233.1|  unknown                                                 369   1e-122   Populus trichocarpa x Populus deltoides
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    369   1e-122   Solanum lycopersicum
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    369   1e-122   Sesamum indicum [beniseed]
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    369   2e-122   Malus domestica [apple tree]
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    369   2e-122   Theobroma cacao [chocolate]
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    368   2e-122   Solanum tuberosum [potatoes]
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                366   2e-122   Lilium regale
ref|NP_001052984.1|  Os04g0459500                                       368   4e-122   
dbj|BAJ34149.1|  unnamed protein product                                367   5e-122   Eutrema halophilum
gb|ABK96725.1|  unknown                                                 367   5e-122   Populus trichocarpa x Populus deltoides
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             367   5e-122   
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    364   6e-122   Brassica rapa
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    367   7e-122   Pyrus x bretschneideri [bai li]
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    365   7e-122   Pyrus x bretschneideri [bai li]
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    367   1e-121   Tarenaya hassleriana [spider flower]
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    363   1e-121   
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          366   2e-121   Amborella trichopoda
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              366   2e-121   Scoparia dulcis [escobilla]
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   366   2e-121   Citrus sinensis [apfelsine]
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    365   3e-121   Pyrus x bretschneideri [bai li]
gb|ABK94956.1|  unknown                                                 365   3e-121   Populus trichocarpa [western balsam poplar]
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    367   3e-121   
gb|AGJ50596.1|  GAPDH                                                   365   3e-121   Pericallis cruenta
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    365   3e-121   Eucalyptus grandis [rose gum]
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    365   4e-121   Fragaria vesca subsp. vesca
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    365   4e-121   Malus domestica [apple tree]
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    365   5e-121   Setaria italica
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    362   6e-121   Camelina sativa [gold-of-pleasure]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             365   7e-121   Phaseolus vulgaris [French bean]
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         364   9e-121   
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    361   1e-120   Camelina sativa [gold-of-pleasure]
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    364   1e-120   Zea mays [maize]
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     360   2e-120   Arabidopsis thaliana [mouse-ear cress]
emb|CAA30152.1|  GADPH (383 AA)                                         363   2e-120   Zea mays [maize]
gb|EPS59235.1|  hypothetical protein M569_15573                         362   3e-120   Genlisea aurea
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    362   5e-120   Vitis vinifera
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    362   6e-120   
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         362   8e-120   Medicago truncatula
emb|CAN78872.1|  hypothetical protein VITISV_021726                     362   9e-120   Vitis vinifera
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    362   9e-120   Brachypodium distachyon [annual false brome]
emb|CDY16038.1|  BnaC08g40850D                                          361   1e-119   Brassica napus [oilseed rape]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    361   1e-119   Pisum sativum [garden pea]
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                361   1e-119   Bruguiera gymnorhiza [Burma mangrove]
emb|CDY26599.1|  BnaA09g46780D                                          361   1e-119   Brassica napus [oilseed rape]
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       361   2e-119   Medicago sativa [alfalfa]
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              358   2e-119   Brassica rapa subsp. chinensis [bok-choy]
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    357   4e-119   Miscanthus sinensis
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    360   4e-119   Brassica rapa
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    359   7e-119   Beta vulgaris subsp. vulgaris [field beet]
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    357   7e-119   Spinacia oleracea
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    359   7e-119   Arabis alpina [alpine rockcress]
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    357   8e-119   Spinacia oleracea
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    359   8e-119   Camelina sativa [gold-of-pleasure]
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    357   8e-119   Spinacia oleracea
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    357   8e-119   Spinacia oleracea
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               356   1e-118   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    359   1e-118   Brassica rapa
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               359   1e-118   Brassica rapa subsp. chinensis [bok-choy]
emb|CDY19412.1|  BnaC05g09210D                                          358   1e-118   Brassica napus [oilseed rape]
gb|ACN40537.1|  unknown                                                 358   2e-118   Picea sitchensis
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    358   2e-118   Spinacia oleracea
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    357   2e-118   Spinacia oleracea
emb|CAA33264.1|  unnamed protein product                                358   2e-118   Pisum sativum [garden pea]
gb|ABK25233.1|  unknown                                                 358   2e-118   Picea sitchensis
gb|ACN39951.1|  unknown                                                 355   3e-118   Picea sitchensis
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    358   3e-118   Camelina sativa [gold-of-pleasure]
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    355   4e-118   Spinacia oleracea
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             357   5e-118   Eutrema salsugineum [saltwater cress]
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             355   6e-118   
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                359   8e-118   Erythranthe guttata [common monkey flower]
dbj|BAJ90530.1|  predicted protein                                      357   8e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        357   8e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892719.1|  GAPA-2                                             356   9e-118   Arabidopsis lyrata subsp. lyrata
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     355   9e-118   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ90885.1|  predicted protein                                      356   1e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN40000.1|  unknown                                                 357   1e-117   Picea sitchensis
gb|ABK24313.1|  unknown                                                 357   1e-117   Picea sitchensis
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    356   2e-117   
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   357   2e-117   Citrus sinensis [apfelsine]
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             355   3e-117   Selaginella moellendorffii
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             355   4e-117   
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             354   8e-117   Selaginella moellendorffii
dbj|BAH57068.1|  AT1G12900                                              352   2e-116   Arabidopsis thaliana [mouse-ear cress]
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  353   3e-116   Pinus sylvestris [Scotch pine]
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...    346   4e-116   Sinapis alba [bai jie]
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    350   3e-115   Nicotiana tabacum [American tobacco]
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              350   3e-115   Phaseolus vulgaris [French bean]
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    342   8e-113   Marchantia polymorpha
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               343   2e-112   Marchantia polymorpha
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    338   1e-111   Chlorokybus atmophyticus
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               335   1e-110   Capsicum annuum
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase                332   2e-110   Helianthus annuus
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      335   3e-110   Chlorokybus atmophyticus
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    332   4e-110   
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase                330   7e-110   Helianthus annuus
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    336   1e-109   
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    335   3e-109   
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    332   9e-109   
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               330   1e-108   Capsicum annuum
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase                326   2e-108   Helianthus annuus
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    333   3e-108   Zea mays [maize]
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    329   6e-108   
dbj|BAN09110.1|  glyceraldehyde-3-phosphate dehydrogenase               325   7e-108   Artemisia indica
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase                326   2e-107   Mesostigma viride
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          329   2e-107   Chlamydomonas sp. W80
ref|XP_001771209.1|  predicted protein                                  330   3e-107   
ref|XP_001771246.1|  predicted protein                                  330   3e-107   
ref|XP_001779769.1|  predicted protein                                  328   8e-107   
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase                323   2e-106   Mesostigma viride
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    324   3e-106   Mesostigma viride
ref|XP_001779753.1|  predicted protein                                  327   4e-106   
ref|XP_001753934.1|  predicted protein                                  327   5e-106   
emb|CDP18560.1|  unnamed protein product                                326   5e-106   Coffea canephora [robusta coffee]
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      324   6e-106   Mesostigma viride
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    325   7e-106   Triticum urartu
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     325   7e-106   Physcomitrella patens
emb|CDX83635.1|  BnaC07g23750D                                          325   1e-105   
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                323   3e-105   Syntrichia caninervis
emb|CDY13649.1|  BnaA06g32740D                                          323   5e-105   Brassica napus [oilseed rape]
emb|CDY28536.1|  BnaC02g36240D                                          323   6e-105   Brassica napus [oilseed rape]
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     319   2e-104   Physcomitrella patens
ref|XP_001766703.1|  predicted protein                                  321   4e-104   
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    318   9e-103   Botryococcus braunii
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      313   1e-102   Spermatozopsis similis
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                315   6e-102   Dunaliella salina
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           315   1e-101   Bathycoccus prasinos
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              314   2e-101   Volvox carteri f. nagariensis
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    315   2e-101   Auxenochlorella protothecoides
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      311   3e-101   Chara vulgaris
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase               310   3e-101   Sphagnum cuspidatum
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    313   4e-101   Chlamydomonas incerta
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               311   5e-101   Sphagnum cuspidatum
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      313   6e-101   Cladophora rupestris
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           312   6e-101   Chlamydomonas reinhardtii
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               310   7e-101   Spirogyra sp.
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           312   2e-100   Coccomyxa subellipsoidea C-169
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    310   5e-100   Dunaliella viridis
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      307   1e-99    Chlorella sp. JP-2005
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      309   3e-99    Cyanophora paradoxa
emb|CDY48981.1|  BnaA02g28150D                                          308   4e-99    Brassica napus [oilseed rape]
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    307   1e-98    Micromonas commoda
ref|XP_001420043.1|  predicted protein                                  305   1e-98    Ostreococcus lucimarinus CCE9901
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    306   1e-98    Ostreococcus sp. 'lucimarinus'
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               308   3e-98    Solanum tuberosum [potatoes]
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase                299   3e-98    Helianthus annuus
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              303   4e-98    Medicago truncatula
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      306   4e-98    Scherffelia dubia
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          306   6e-98    
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    307   9e-98    Nicotiana tomentosiformis
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    306   1e-97    Nicotiana tabacum [American tobacco]
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   1e-97    Nicotiana sylvestris
gb|KJB57938.1|  hypothetical protein B456_009G186400                    305   1e-97    Gossypium raimondii
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   2e-97    Solanum lycopersicum
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               306   2e-97    Marchantia polymorpha
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    303   2e-97    Ostreococcus tauri
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase                301   2e-97    Klebsormidium flaccidum
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   3e-97    Solanum tuberosum [potatoes]
gb|KJB57936.1|  hypothetical protein B456_009G186400                    306   3e-97    Gossypium raimondii
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    301   3e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    303   3e-97    
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   3e-97    Tarenaya hassleriana [spider flower]
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    306   3e-97    Gossypium arboreum [tree cotton]
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           305   4e-97    Medicago truncatula
gb|EPS70760.1|  hypothetical protein M569_03997                         305   4e-97    Genlisea aurea
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             305   4e-97    Prunus persica
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    308   4e-97    Cicer arietinum [garbanzo]
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   5e-97    Prunus mume [ume]
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   5e-97    Nicotiana sylvestris
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   5e-97    Nicotiana tomentosiformis
gb|KJB14201.1|  hypothetical protein B456_002G114000                    305   6e-97    Gossypium raimondii
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   8e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   8e-97    Elaeis guineensis
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         305   8e-97    Jatropha curcas
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   9e-97    Sesamum indicum [beniseed]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    304   1e-96    Pisum sativum [garden pea]
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   1e-96    Pyrus x bretschneideri [bai li]
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    304   1e-96    Gossypium arboreum [tree cotton]
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    304   1e-96    Eucalyptus grandis [rose gum]
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      303   1e-96    Mesostigma viride
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             301   1e-96    Micromonas pusilla CCMP1545
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    304   2e-96    
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   2e-96    
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    303   2e-96    Pyrus x bretschneideri [bai li]
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   2e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   3e-96    Malus domestica [apple tree]
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    303   4e-96    
ref|NP_001048847.1|  Os03g0129300                                       302   4e-96    
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      303   4e-96    Chlorokybus atmophyticus
gb|ACJ84309.1|  unknown                                                 303   5e-96    Medicago truncatula
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              300   6e-96    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         301   6e-96    Micromonas commoda
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   7e-96    
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   7e-96    
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   8e-96    
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    302   9e-96    Phoenix dactylifera
emb|CDP07271.1|  unnamed protein product                                302   9e-96    Coffea canephora [robusta coffee]
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    302   9e-96    Glycine soja [wild soybean]
gb|ACU20783.1|  unknown                                                 302   9e-96    Glycine max [soybeans]
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    300   9e-96    Ostreococcus tauri
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    301   1e-95    
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              301   1e-95    Pyrus x bretschneideri [bai li]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   1e-95    Brassica rapa
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase               297   1e-95    Klebsormidium flaccidum
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    301   1e-95    Glycine max [soybeans]
emb|CDY69523.1|  BnaC08g46180D                                          300   1e-95    Brassica napus [oilseed rape]
ref|NP_001240080.1|  uncharacterized protein LOC100806482               301   1e-95    Glycine max [soybeans]
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             301   1e-95    Phaseolus vulgaris [French bean]
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             301   2e-95    Eutrema salsugineum [saltwater cress]
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              301   2e-95    Scoparia dulcis [escobilla]
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    298   2e-95    Mesostigma viride
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   3e-95    Nelumbo nucifera [Indian lotus]
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    301   3e-95    Fragaria vesca subsp. vesca
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    300   3e-95    Populus euphratica
emb|CAA33262.1|  unnamed protein product                                300   3e-95    Pisum sativum [garden pea]
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    298   3e-95    Spinacia oleracea
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    300   3e-95    Ostreococcus tauri
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    300   3e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                296   3e-95    Mesostigma viride
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           299   3e-95    Bathycoccus prasinos
dbj|BAK02737.1|  predicted protein                                      295   3e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    300   4e-95    
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             299   4e-95    Micromonas pusilla CCMP1545
dbj|BAJ86633.1|  predicted protein                                      300   4e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             299   5e-95    
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    300   5e-95    
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    300   5e-95    
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    300   5e-95    
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    300   6e-95    
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             299   7e-95    
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    300   7e-95    
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    298   7e-95    
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      298   8e-95    
gb|ABK24645.1|  unknown                                                 300   8e-95    
gb|ACN40006.1|  unknown                                                 300   9e-95    
ref|XP_001415434.1|  predicted protein                                  298   9e-95    
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            299   1e-94    
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             299   1e-94    
dbj|BAJ87214.1|  predicted protein                                      299   1e-94    
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    299   1e-94    
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             298   1e-94    
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    298   1e-94    
gb|ACN40526.1|  unknown                                                 299   1e-94    
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    298   2e-94    
emb|CAN69459.1|  hypothetical protein VITISV_021576                     298   2e-94    
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    298   2e-94    
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    298   3e-94    
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             298   3e-94    
gb|ADD54591.1|  putative glyceraldehyde-3-phosphate dehydrogenase       289   4e-94    
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    297   4e-94    
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    297   5e-94    
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    297   6e-94    
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    297   8e-94    
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    296   9e-94    
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    296   9e-94    
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    292   1e-93    
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               297   1e-93    
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             296   2e-93    
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      291   2e-93    
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    295   3e-93    
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    294   9e-93    
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    292   1e-92    
emb|CBI29293.3|  unnamed protein product                                290   1e-92    
dbj|BAD72793.1|  glyceraldehyde-3-phosphate dehydrogenase               285   3e-92    
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+         289   4e-92    
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase           288   4e-92    
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    291   8e-92    
gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase                281   2e-91    
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           288   7e-91    
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    288   7e-91    
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           285   7e-91    
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    285   8e-91    
gb|ABK00066.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    283   9e-91    
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             286   1e-90    
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2              283   2e-90    
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    284   2e-90    
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    284   2e-90    
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         303   3e-90    
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           284   4e-90    
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           283   4e-90    
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             284   6e-90    
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           282   1e-89    
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase                281   1e-89    
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           282   2e-89    
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    284   2e-89    
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    281   2e-89    
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         281   2e-89    
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             282   3e-89    
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             282   3e-89    
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    281   3e-89    
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    281   5e-89    
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    283   5e-89    
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           280   6e-89    
gb|ERT05629.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        278   8e-89    
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...    280   8e-89    
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    280   1e-88    
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    280   1e-88    
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           280   1e-88    
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase                280   2e-88    
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               278   2e-88    
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase           279   2e-88    
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    279   3e-88    
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    281   3e-88    
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      278   5e-88    
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           278   5e-88    
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        278   1e-87    
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           277   1e-87    
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              280   1e-87    
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    277   1e-87    
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           282   1e-87    
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           277   2e-87    
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           277   2e-87    
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    276   2e-87    
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           276   3e-87    
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    276   3e-87    
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase               276   3e-87    
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           276   3e-87    
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           276   3e-87    
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           276   3e-87    
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           276   3e-87    
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    276   4e-87    
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase           276   4e-87    
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        276   4e-87    
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    276   5e-87    
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    275   5e-87    
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           275   6e-87    
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           275   6e-87    
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase           275   6e-87    
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               274   8e-87    
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                275   1e-86    
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           275   1e-86    
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        275   1e-86    
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           274   2e-86    
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    274   2e-86    
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           274   3e-86    
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    273   3e-86    
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           273   4e-86    
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           273   4e-86    
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    273   4e-86    
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           273   4e-86    
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           273   4e-86    
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    273   5e-86    
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           273   5e-86    
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    273   6e-86    
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                273   6e-86    
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    273   7e-86    
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    273   7e-86    
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           272   8e-86    
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           272   9e-86    
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           272   1e-85    
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   275   1e-85    
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           272   1e-85    
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    272   1e-85    
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           272   2e-85    
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase           271   2e-85    
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase                271   2e-85    
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase           271   2e-85    
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           271   2e-85    
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    271   2e-85    
gb|ADB81485.1|  glyceraldehyde-3-phosphate dehydrogenase                270   3e-85    
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [         271   3e-85    
gb|AHB87911.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehyd...    270   4e-85    
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    271   4e-85    
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           270   5e-85    
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      273   5e-85    
ref|WP_041429017.1|  glyceraldehyde-3-phosphate dehydrogenase           270   5e-85    
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           270   6e-85    
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    270   7e-85    
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           270   8e-85    
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase           270   1e-84    
gb|EDX87031.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        269   1e-84    
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase           270   1e-84    
ref|WP_011057306.1|  glyceraldehyde-3-phosphate dehydrogenase           270   1e-84    
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase           269   1e-84    
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    269   2e-84    
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           269   2e-84    
gb|AAB66887.1|  glyceraldehyde-3-phosphate dehydrogenase                267   2e-84    
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase           269   2e-84    
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    269   2e-84    
gb|AHJ31016.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    266   2e-84    
pdb|3ZCX|A  Chain A, Structure Of Gapdh From Thermosynechococcus ...    269   3e-84    
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           268   3e-84    
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase    268   3e-84    
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           268   3e-84    
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           268   3e-84    
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                268   4e-84    
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           268   4e-84    
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           268   5e-84    
ref|WP_015125741.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    268   5e-84    
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           268   7e-84    
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           267   1e-83    
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    266   1e-83    
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           266   2e-83    
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    266   2e-83    
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           266   2e-83    
ref|WP_025944290.1|  glyceraldehyde-3-phosphate dehydrogenase           264   2e-83    
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           266   2e-83    
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase           266   2e-83    
ref|WP_010313976.1|  glyceraldehyde-3-phosphate dehydrogenase           266   2e-83    
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    266   2e-83    
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           266   3e-83    
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           265   5e-83    
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           265   5e-83    
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    265   7e-83    
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           265   7e-83    
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase           267   8e-83    
ref|WP_025938864.1|  glyceraldehyde-3-phosphate dehydrogenase           265   8e-83    
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    265   9e-83    
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    265   1e-82    
ref|WP_025895306.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    265   1e-82    
ref|WP_025900197.1|  glyceraldehyde-3-phosphate dehydrogenase           262   1e-82    
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    264   2e-82    
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           264   2e-82    
ref|WP_025887309.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    264   2e-82    
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           264   2e-82    
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    264   2e-82    
gb|AIQ96116.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    263   2e-82    
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    264   3e-82    
ref|WP_025970551.1|  glyceraldehyde-3-phosphate dehydrogenase           263   3e-82    
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           263   3e-82    
ref|WP_025924004.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    263   3e-82    
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase           263   4e-82    
ref|WP_025935563.1|  glyceraldehyde-3-phosphate dehydrogenase           263   4e-82    
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase           263   4e-82    
ref|WP_025941106.1|  glyceraldehyde-3-phosphate dehydrogenase           263   4e-82    
ref|WP_025932858.1|  glyceraldehyde-3-phosphate dehydrogenase           263   5e-82    
ref|WP_038650443.1|  glyceraldehyde-3-phosphate dehydrogenase           263   5e-82    
ref|WP_025923775.1|  glyceraldehyde-3-phosphate dehydrogenase           263   5e-82    
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                264   5e-82    
ref|WP_011817500.1|  glyceraldehyde-3-phosphate dehydrogenase           263   6e-82    
ref|WP_032523814.1|  glyceraldehyde-3-phosphate dehydrogenase           263   6e-82    
ref|WP_025925726.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    263   6e-82    
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    262   6e-82    
ref|WP_036906091.1|  glyceraldehyde-3-phosphate dehydrogenase           263   7e-82    
ref|WP_025781786.1|  glyceraldehyde-3-phosphate dehydrogenase           263   7e-82    
ref|WP_011375588.1|  glyceraldehyde-3-phosphate dehydrogenase           262   7e-82    
ref|WP_025947080.1|  glyceraldehyde-3-phosphate dehydrogenase           262   8e-82    
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase           262   8e-82    
ref|YP_002049068.1|  Glyceraldehyde 3-phosphate dehydrogenase NAD...    262   9e-82    
ref|WP_025921298.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    262   9e-82    
ref|WP_025951324.1|  glyceraldehyde-3-phosphate dehydrogenase           262   9e-82    
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           262   9e-82    
ref|WP_025970042.1|  glyceraldehyde-3-phosphate dehydrogenase           262   1e-81    
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           262   1e-81    
ref|WP_011433307.1|  glyceraldehyde-3-phosphate dehydrogenase           262   1e-81    
ref|WP_032515148.1|  glyceraldehyde-3-phosphate dehydrogenase           262   1e-81    



>gb|KDO63479.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=293

 Score =   376 bits (965),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 231/239 (97%), Positives = 234/239 (98%), Gaps = 0/239 (0%)
 Frame = -3

Query  877  GTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNC  698
            GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY PDEPIISNASCTTNC
Sbjct  55   GTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCTTNC  114

Query  697  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAV  518
            LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV
Sbjct  115  LAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV  174

Query  517  ALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVC  338
            ALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVC
Sbjct  175  ALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVC  234

Query  337  DEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  161
            DEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  235  DEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  293



>gb|KJB11770.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=305

 Score =   376 bits (965),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  64   VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADIYNPDEPIISNASCT  123

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  124  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  183

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  184  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGIL  243

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  244  SVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  303

Query  166  WK  161
            WK
Sbjct  304  WK  305



>ref|XP_010425376.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   375 bits (964),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  76   VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCT  135

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  136  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  195

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL
Sbjct  196  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGIL  255

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  256  DVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  315

Query  166  WK  161
            WK
Sbjct  316  WK  317



>ref|XP_010502598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score =   375 bits (963),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  76   VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCT  135

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  136  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  195

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL
Sbjct  196  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGIL  255

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  256  DVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  315

Query  166  WK  161
            WK
Sbjct  316  WK  317



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   378 bits (970),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT
Sbjct  164  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  223

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  224  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  283

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GIL
Sbjct  284  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGIL  343

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  344  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANS  403

Query  166  WK  161
            WK
Sbjct  404  WK  405



>gb|KJB70724.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=303

 Score =   374 bits (959),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  62   VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADTYNPDEPIISNASCT  121

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  122  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  181

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAF+ESA  EL GIL
Sbjct  182  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFKESAEKELQGIL  241

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVC+EPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  242  SVCEEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANS  301

Query  166  WK  161
            WK
Sbjct  302  WK  303



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score =   376 bits (966),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GIL
Sbjct  282  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score =   376 bits (966),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 233/242 (96%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GIL
Sbjct  283  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  343  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANN  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   375 bits (964),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY PDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  282  KAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   375 bits (964),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY PDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  282  KAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   375 bits (963),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  159  VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNASCT  218

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  219  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  278

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  279  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGIL  338

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  339  EVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  398

Query  166  WK  161
            WK
Sbjct  399  WK  400



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   374 bits (961),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKF IIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GIL
Sbjct  283  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  343  SVCDEPLVSVDFRCTDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   373 bits (958),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 230/241 (95%), Positives = 235/241 (98%), Gaps = 0/241 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD YSPDE IISNASCT
Sbjct  168  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYSPDESIISNASCT  227

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  228  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  287

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  288  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELAGIL  347

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA+IVANQ
Sbjct  348  SVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLANIVANQ  407

Query  166  W  164
            W
Sbjct  408  W  408



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  160  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  220  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  280  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  340  SVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  399

Query  166  WK  161
            WK
Sbjct  400  WK  401



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  160  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  220  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL GIL
Sbjct  280  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  340  DVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  399

Query  166  WK  161
            WK
Sbjct  400  WK  401



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score =   373 bits (957),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI AGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADAYSSDEPIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GIL
Sbjct  283  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  343  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>ref|XP_010528120.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=280

 Score =   368 bits (944),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD+EGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY P EPIISNASCT
Sbjct  39   VIEGTGVFVDQEGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYDPAEPIISNASCT  98

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  99   TNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  158

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL GIL
Sbjct  159  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELKGIL  218

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  219  EVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  278

Query  166  WK  161
            WK
Sbjct  279  WK  280



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score =   372 bits (956),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI AGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADAYSSDEPIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GIL
Sbjct  283  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  343  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   372 bits (956),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DE IISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSHDESIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPN SVVDLVVQVSKKTFAEEVNAAFRESA  EL+GIL
Sbjct  282  KAVALVLPSLKGKLNGIALRVPTPNASVVDLVVQVSKKTFAEEVNAAFRESAEKELNGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   372 bits (955),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  162  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADIYNPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  282  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   372 bits (955),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DE IISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSHDESIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GIL
Sbjct  282  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   372 bits (954),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  159  VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNASCT  218

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  219  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  278

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  279  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  338

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  339  EVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  398

Query  166  WK  161
            WK
Sbjct  399  WK  400



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   372 bits (954),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  159  VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCT  218

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  219  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  278

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL
Sbjct  279  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGIL  338

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  339  DVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  398

Query  166  WK  161
            WK
Sbjct  399  WK  400



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   373 bits (958),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  204  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCT  263

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  264  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  323

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  324  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDTAEKELKGIL  383

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  384  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  443

Query  166  WK  161
            WK
Sbjct  444  WK  445



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score =   372 bits (954),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 230/242 (95%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI AGAKKV ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GIL
Sbjct  283  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  343  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   372 bits (954),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  159  VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCT  218

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  219  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  278

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL
Sbjct  279  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGIL  338

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  339  EVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  398

Query  166  WK  161
            WK
Sbjct  399  WK  400



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   372 bits (954),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD YSPDEPIISNASCT
Sbjct  160  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  220  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVNAAFR+SAANEL GIL
Sbjct  280  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRDSAANELQGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  340  EVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  399

Query  166  WK  161
            WK
Sbjct  400  WK  401



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   372 bits (954),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKH++AGAKKV ITAPGKGDIPTYVVGVNADAYSPDE IISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+S+A EL GIL
Sbjct  282  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSSAKELAGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   372 bits (954),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  160  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  220  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRE+A  EL GIL
Sbjct  280  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFREAADKELKGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  340  DVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  399

Query  166  WK  161
            WK
Sbjct  400  WK  401



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score =   372 bits (954),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 231/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DE IISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYSHDESIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GIL
Sbjct  282  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_009420999.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN DAY+PDEPIISNASCT
Sbjct  161  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEDAYNPDEPIISNASCT  220

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  221  TNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  280

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  281  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAADKELKGIL  340

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  341  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  400

Query  166  WK  161
            WK
Sbjct  401  WK  402



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  159  VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCT  218

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  219  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  278

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL
Sbjct  279  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGIL  338

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  339  EVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  398

Query  166  WK  161
            WK
Sbjct  399  WK  400



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  159  VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCT  218

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  219  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  278

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL
Sbjct  279  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGIL  338

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  339  DVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  398

Query  166  WK  161
            WK
Sbjct  399  WK  400



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD YSPDEPIISNASCT
Sbjct  162  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVNAAFR+SAANEL GIL
Sbjct  282  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRDSAANELQGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  342  EVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN   YSPDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  282  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  342  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKH++AGAKKV ITAPGKGDIPTYVVGVNADAYSPDE IISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+S+A EL GIL
Sbjct  282  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSSAKELAGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN   YSPDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  282  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELQGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  342  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   369 bits (947),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  96   VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCT  155

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  156  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  215

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL
Sbjct  216  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGIL  275

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  276  DVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  335

Query  166  WK  161
            WK
Sbjct  336  WK  337



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   371 bits (953),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN   YSPDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  282  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  342  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   371 bits (953),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN   YSPDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  282  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  342  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  155  VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCT  214

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  215  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  274

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL
Sbjct  275  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGIL  334

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  335  DVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  394

Query  166  WK  161
            WK
Sbjct  395  WK  396



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  155  VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCT  214

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  215  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  274

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL
Sbjct  275  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGIL  334

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  335  DVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  394

Query  166  WK  161
            WK
Sbjct  395  WK  396



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADTYNPDEPIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVNAAFR +A  EL+GIL
Sbjct  283  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRNAAEKELNGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  343  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGA KHIEAGAKKV ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  159  VIEGTGVFVDREGAXKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNASCT  218

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  219  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  278

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA  EL GIL
Sbjct  279  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESAEKELKGIL  338

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  339  EVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  398

Query  166  WK  161
            WK
Sbjct  399  WK  400



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAY+ DE IISNASCT
Sbjct  164  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADAYTHDEAIISNASCT  223

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  224  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  283

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVN AFRESAANEL+GIL
Sbjct  284  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNEAFRESAANELNGIL  343

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  344  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANN  403

Query  166  WK  161
            WK
Sbjct  404  WK  405



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   371 bits (952),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  167  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADTYNPDEPIISNASCT  226

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  227  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  286

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAF+ESA  EL GIL
Sbjct  287  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFKESAEKELQGIL  346

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVC+EPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  347  SVCEEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANS  406

Query  166  WK  161
            WK
Sbjct  407  WK  408



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   370 bits (951),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDE IISNASCT
Sbjct  161  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADTYNPDETIISNASCT  220

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  221  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  280

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  281  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGIL  340

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  341  SVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  400

Query  166  WK  161
            WK
Sbjct  401  WK  402



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   370 bits (950),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 237/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD+Y+P+EPIISNASCT
Sbjct  161  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADSYNPEEPIISNASCT  220

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  221  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  280

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL+GIL
Sbjct  281  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELNGIL  340

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  341  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  400

Query  166  WK  161
            WK
Sbjct  401  WK  402



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   370 bits (950),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDE IISNASCT
Sbjct  160  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDESIISNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  220  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL GIL
Sbjct  280  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  340  DVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  399

Query  166  WK  161
            WK
Sbjct  400  WK  401



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   368 bits (945),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKH+EAGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  109  VIEGTGVFVDREGAGKHMEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCT  168

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  169  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  228

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL
Sbjct  229  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGIL  288

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  289  DVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  348

Query  166  WK  161
            WK
Sbjct  349  WK  350



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   370 bits (949),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKH+EAGAKKV ITAPGKGDIPTYVVGVNADAYS DEPIISNASCT
Sbjct  155  VIEGTGVFVDREGAGKHMEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCT  214

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  215  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  274

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL
Sbjct  275  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGIL  334

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSD S+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  335  DVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  394

Query  166  WK  161
            WK
Sbjct  395  WK  396



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   370 bits (950),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN   YSPDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEYDYSPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  282  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR VDLADIVAN+
Sbjct  342  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRAVDLADIVANK  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   370 bits (950),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD YS DEPIISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADGYSADEPIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL GIL
Sbjct  283  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELKGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  343  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   370 bits (950),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY+P EPIISNASCT
Sbjct  170  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPAEPIISNASCT  229

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  230  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  289

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  290  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGIL  349

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  350  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  409

Query  166  WK  161
            WK
Sbjct  410  WK  411



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI AGAKKV ITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHITAGAKKVIITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GIL
Sbjct  283  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+Q
Sbjct  343  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQ  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   369 bits (947),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ YS DEPIISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHDEPIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRE+A  EL+GIL
Sbjct  278  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFREAADKELNGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  338  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   369 bits (947),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD YSPDEPIISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADDYSPDEPIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  EL+GIL
Sbjct  278  KAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAADKELNGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   369 bits (946),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKH+ AGAKKV ITAPGKGDIPTYVVGVNADAYSPDE IISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHLLAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GIL
Sbjct  282  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   369 bits (946),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD +GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD+Y+PDEPIISNASCT
Sbjct  163  VIEGTGVFVDSDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADSYNPDEPIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL+GIL
Sbjct  283  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELNGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  343  SVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 236/242 (98%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ Y+ DEPIISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYNHDEPIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRE+A  EL+GIL
Sbjct  278  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFREAADKELNGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  338  AVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   366 bits (940),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 229/242 (95%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD YSPD+ IISNASCT
Sbjct  103  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDDTIISNASCT  162

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  163  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  222

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  223  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADGELKGIL  282

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  283  SVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  342

Query  166  WK  161
            WK
Sbjct  343  WK  344



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   368 bits (944),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD YSPDEPIISNASCT
Sbjct  161  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYSPDEPIISNASCT  220

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  221  TNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  280

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR+SAANEL GIL
Sbjct  281  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDSAANELKGIL  340

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSDVS T+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  341  EVCDVPLVSVDFRCSDVSCTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  400

Query  166  WK  161
            WK
Sbjct  401  WK  402



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   367 bits (943),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  159  VIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNASCT  218

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTT SYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  219  TNCLAPFVKVLDQKFGIIKGTMTTTPSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  278

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  279  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  338

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  339  EVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  398

Query  166  WK  161
            WK
Sbjct  399  WK  400



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   367 bits (943),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI AGAKKV ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GIL
Sbjct  283  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNLGFRESAEKELKGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+Q
Sbjct  343  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQ  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score =   367 bits (943),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 228/242 (94%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI AGAKKV ITAPGKGDIPTYVVGVNADAY PDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHITAGAKKVIITAPGKGDIPTYVVGVNADAYKPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GIL
Sbjct  282  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+Q
Sbjct  342  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQ  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_009118049.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   364 bits (934),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYV GVNA+ YS ++ IISNASCT
Sbjct  76   VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCT  135

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  136  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  195

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL
Sbjct  196  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGIL  255

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDL+DIVAN 
Sbjct  256  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANN  315

Query  166  WK  161
            WK
Sbjct  316  WK  317



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   367 bits (942),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKH+ AGAKKV ITAPGKGDIPTYVVGVNADAY+PDE IISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHLLAGAKKVLITAPGKGDIPTYVVGVNADAYNPDETIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GIL
Sbjct  282  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   365 bits (938),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKH+ AGAKKV ITAPGKGDIPTYVVGVNADAY+PDE IISNASCT
Sbjct  114  VIEGTGVFVDREGAGKHLLAGAKKVLITAPGKGDIPTYVVGVNADAYNPDETIISNASCT  173

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  174  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  233

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GIL
Sbjct  234  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGIL  293

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  294  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  353

Query  166  WK  161
            WK
Sbjct  354  WK  355



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD+EGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY P EPIISNASCT
Sbjct  161  VIEGTGVFVDQEGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYDPAEPIISNASCT  220

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  221  TNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  280

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL GIL
Sbjct  281  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELKGIL  340

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  341  EVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  400

Query  166  WK  161
            WK
Sbjct  401  WK  402



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   363 bits (933),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  76   VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  135

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  136  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  195

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  196  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  255

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  256  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  315

Query  166  WK  161
            WK
Sbjct  316  WK  317



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 227/241 (94%), Positives = 233/241 (97%), Gaps = 0/241 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD+EGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY+P EPIISNASCT
Sbjct  157  VIEGTGVFVDKEGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYNPSEPIISNASCT  216

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  217  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  276

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL GIL
Sbjct  277  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELQGIL  336

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVANQ
Sbjct  337  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVANQ  396

Query  166  W  164
            W
Sbjct  397  W  397



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD YS DEPIISNASCT
Sbjct  157  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADDYSADEPIISNASCT  216

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  217  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  276

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  EL+GIL
Sbjct  277  KAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRETADKELNGIL  336

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  337  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  396

Query  166  WK  161
            WK
Sbjct  397  WK  398



>gb|KDO63477.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=416

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 231/255 (91%), Positives = 236/255 (93%), Gaps = 13/255 (5%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY PDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKF-------------GIIKGTMTTTHSYTGDQrlldashrdlrrara  566
            TNCLAPFVKVLDQKF             GIIKGTMTTTHSYTGDQRLLDASHRDLRRARA
Sbjct  222  TNCLAPFVKVLDQKFVTQLNDRIFPMCAGIIKGTMTTTHSYTGDQRLLDASHRDLRRARA  281

Query  565  aaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAA  386
            AALNIVPTSTGAAKAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAA
Sbjct  282  AALNIVPTSTGAAKAVALVLPALKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAA  341

Query  385  FRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYS  206
            FRESA NEL GILSVCDEPLVSVDFRCSDVSSTVDSSLT+VMGDDMVKVIAWYDNEWGYS
Sbjct  342  FRESADNELKGILSVCDEPLVSVDFRCSDVSSTVDSSLTLVMGDDMVKVIAWYDNEWGYS  401

Query  205  QRVVDLADIVANQWK  161
            QRVVDLADIVAN WK
Sbjct  402  QRVVDLADIVANNWK  416



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   365 bits (938),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKH+ AGAKKV ITAPGKGDIPTYVVGVNADAYSPDE IISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHLLAGAKKVLITAPGKGDIPTYVVGVNADAYSPDETIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GIL
Sbjct  282  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDE LVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDESLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score =   365 bits (938),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI AGAKKV ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHITAGAKKVIITAPGKGDIPTYVVGVNADAYNPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDHKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GIL
Sbjct  282  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+Q
Sbjct  342  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQ  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score =   367 bits (942),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN + Y+PDEPIISNASCT
Sbjct  204  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNVETYNPDEPIISNASCT  263

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  264  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  323

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  324  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDTAEKELKGIL  383

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  384  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  443

Query  166  WK  161
            WK
Sbjct  444  WK  445



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score =   365 bits (938),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 235/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHIEAGAKKV ITAPGKGDIPTYVVGVNAD Y+  E IISNASCT
Sbjct  157  VIEGTGVFVDRDGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADLYNHSENIISNASCT  216

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  217  TNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  276

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+AANEL+GIL
Sbjct  277  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAAANELNGIL  336

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDM+KVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  337  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMLKVIAWYDNEWGYSQRVVDLADIVANN  396

Query  166  WK  161
            WK
Sbjct  397  WK  398



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   365 bits (937),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHIEAGAKKV ITAPGKGDIPTYVVGVNAD Y+P EPIISNASCT
Sbjct  161  VIEGTGVFVDRDGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNADLYNPAEPIISNASCT  220

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  221  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  280

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNA FRESA NEL GIL
Sbjct  281  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRESADNELKGIL  340

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+ 
Sbjct  341  SVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADN  400

Query  166  WK  161
            WK
Sbjct  401  WK  402



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   365 bits (937),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHIEAGAKKV ITAPGKGDIPTYVVGVNA+ YS D+ IISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHIEAGAKKVLITAPGKGDIPTYVVGVNAELYSHDDTIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA  EL GIL
Sbjct  283  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESADKELAGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  343  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   365 bits (937),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH+ AGAKKV ITAPGKGDIPTYVVGVNADAY+PDE IISNASCT
Sbjct  162  VIEGTGVFVDRDGAGKHLLAGAKKVLITAPGKGDIPTYVVGVNADAYNPDETIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GIL
Sbjct  282  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  342  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   365 bits (936),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYV GVNAD Y+PDEPIISNASCT
Sbjct  160  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNADQYNPDEPIISNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  220  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR+SAANEL GIL
Sbjct  280  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDSAANELAGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  340  EVCDAPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  399

Query  166  WK  161
            WK
Sbjct  400  WK  401



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   362 bits (928),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  76   VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  135

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  136  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  195

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  196  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  255

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  256  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  315

Query  166  WK  161
            WK
Sbjct  316  WK  317



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   365 bits (936),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 227/242 (94%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI AGAKKV ITAPGKGDIPTYVVGVN   YS DEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIVAGAKKVLITAPGKGDIPTYVVGVNEYDYSGDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  282  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  342  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   364 bits (935),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL
Sbjct  282  KAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI ANQ
Sbjct  342  EVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQ  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   361 bits (926),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  76   VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  135

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  136  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  195

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  196  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  255

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  256  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  315

Query  166  WK  161
            WK
Sbjct  316  WK  317



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL
Sbjct  282  KAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI ANQ
Sbjct  342  EVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQ  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 220/242 (91%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  76   VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  135

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  136  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  195

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  196  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  255

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  256  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  315

Query  166  WK  161
            WK
Sbjct  316  WK  317



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  142  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNASCT  201

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  202  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  261

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL
Sbjct  262  KAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGIL  321

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI ANQ
Sbjct  322  EVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQ  381

Query  166  WK  161
            WK
Sbjct  382  WK  383



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y PDE IISNASCT
Sbjct  154  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADDYKPDETIISNASCT  213

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KF IIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  214  TNCLAPFVKVLDEKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  273

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL GIL
Sbjct  274  KAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELKGIL  333

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  334  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  393

Query  166  WK  161
            WK
Sbjct  394  WK  395



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   362 bits (930),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+ DE IISNASCT
Sbjct  163  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADEYNHDESIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNA FR+SA  EL GIL
Sbjct  283  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRDSAEKELQGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  343  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   362 bits (929),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+ DE IISNASCT
Sbjct  162  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADEYNHDESIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNA FR+SA  EL GIL
Sbjct  282  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRDSAEKELQGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  342  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   362 bits (929),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 226/242 (93%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI AGAKKV ITAPGKGDIPTYVVGVNAD YS  + IISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADGYSHADDIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN AFR+SAA EL GIL
Sbjct  283  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRDSAAKELSGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  343  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   362 bits (928),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+ DE IISNASCT
Sbjct  163  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADEYNHDEXIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNA FR+SA  EL GIL
Sbjct  283  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRDSAEKELQGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  343  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   362 bits (928),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH+EAGAKKV ITAPGKGDIPTYVVGVNA+ YS  + IISNASCT
Sbjct  162  VIEGTGVFVDRDGAGKHLEAGAKKVLITAPGKGDIPTYVVGVNAELYSHSDTIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  281

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVNAAFR++AANEL GIL
Sbjct  282  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRDAAANELKGIL  341

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  342  DVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  401

Query  166  WK  161
            WK
Sbjct  402  WK  403



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYV GVNA+ YS ++ IISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>sp|P12858.2|G3PA_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Pisum sativum]
 emb|CAA36396.1| glyceraldehyde-3-phosphate dehydrogenase [Pisum sativum]
Length=405

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAG+HI AGAKKV ITAPGKGDIPTYVVGVNADAY+  + IISNASCT
Sbjct  164  VIEGTGVFVDREGAGRHITAGAKKVLITAPGKGDIPTYVVGVNADAYTHADDIISNASCT  223

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  224  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  283

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN AFRESAA EL GIL
Sbjct  284  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRESAAKELTGIL  343

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  344  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANN  403

Query  166  WK  161
            WK
Sbjct  404  WK  405



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 230/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI AGAK V ITAPGKGDIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  164  VIEGTGVFVDREGAGKHIHAGAKNVLITAPGKGDIPTYVVGVNADAYNPDEPIISNASCT  223

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQK GIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  224  TNCLAPFVKVLDQKSGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  283

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            K VALVLP+L+GKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  284  KPVALVLPTLRGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGIL  343

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGY QRVVDLAD+VA +
Sbjct  344  SVCDEPLVSVDFRCRDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYFQRVVDLADVVAEK  403

Query  166  WK  161
            WK
Sbjct  404  WK  405



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   361 bits (926),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYV GVNA+ YS ++ IISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 225/242 (93%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI AGAKKV ITAPGKGDIPTYVVGVNAD Y+  + IISNASCT
Sbjct  163  VIEGTGVFVDREGAGKHITAGAKKVLITAPGKGDIPTYVVGVNADGYNHADDIISNASCT  222

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  223  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  282

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN AFR+SAA EL GIL
Sbjct  283  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRDSAAKELSGIL  342

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  343  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  402

Query  166  WK  161
            WK
Sbjct  403  WK  404



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   358 bits (919),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYV GVNA+ YS ++ I+SNASCT
Sbjct  95   VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIVSNASCT  154

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  155  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  214

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL
Sbjct  215  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGIL  274

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  275  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  334

Query  166  WK  161
            WK
Sbjct  335  WK  336



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score =   357 bits (916),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 220/242 (91%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  75   VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADQYNPDEPIISNASCT  134

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  135  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  194

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL
Sbjct  195  KAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELIGIL  254

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI A +
Sbjct  255  EVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICAIK  314

Query  166  WK  161
            WK
Sbjct  315  WK  316



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   360 bits (923),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYV GVNA+ YS ++ IISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDL+DIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   359 bits (922),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN + Y+  + IISNASCT
Sbjct  160  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  220  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA NEL GIL
Sbjct  280  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESADNELKGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVA++
Sbjct  340  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVADK  399

Query  166  WK  161
            W+
Sbjct  400  WQ  401



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   357 bits (916),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 217/242 (90%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVN + Y+  + IISNASCT
Sbjct  95   VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCT  154

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDA+HRDLRRARAA LNIVPTSTGAA
Sbjct  155  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDAAHRDLRRARAACLNIVPTSTGAA  214

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  215  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  274

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  275  SVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  334

Query  166  WK  161
            W+
Sbjct  335  WQ  336



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   359 bits (922),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 233/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVNA+ YS  + IISNASCT
Sbjct  158  VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHADTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANE+ GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANEMKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   357 bits (916),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 218/242 (90%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVN + Y+  + IISNASCT
Sbjct  95   VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCT  154

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAA
Sbjct  155  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAA  214

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  215  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  274

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  275  SVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  334

Query  166  WK  161
            W+
Sbjct  335  WQ  336



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   359 bits (921),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   357 bits (916),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 218/242 (90%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVN + Y+  + IISNASCT
Sbjct  95   VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCT  154

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAA
Sbjct  155  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAA  214

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  215  KAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  274

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  275  SVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  334

Query  166  WK  161
            W+
Sbjct  335  WQ  336



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   357 bits (916),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 218/242 (90%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVN + Y+  + IISNASCT
Sbjct  95   VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCT  154

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAA
Sbjct  155  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAA  214

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  215  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  274

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  275  SVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  334

Query  166  WK  161
            W+
Sbjct  335  WQ  336



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  87   VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  146

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  147  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  206

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR +AANEL GIL
Sbjct  207  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRGAAANELKGIL  266

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSV FRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  267  DVCDEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  326

Query  166  WK  161
            WK
Sbjct  327  WK  328



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR +AANEL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRGAAANELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSV FRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN   YSP + IISNASCT
Sbjct  168  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNASCT  227

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  228  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  287

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL
Sbjct  288  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGIL  347

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN 
Sbjct  348  AVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANN  407

Query  166  WK  161
            WK
Sbjct  408  WK  409



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 218/242 (90%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVN + Y+  + IISNASCT
Sbjct  160  VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAA
Sbjct  220  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  280  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  340  SVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  399

Query  166  WK  161
            W+
Sbjct  400  WQ  401



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 219/247 (89%), Positives = 234/247 (95%), Gaps = 0/247 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVN + Y+  + IISNASCT
Sbjct  95   VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCT  154

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAA
Sbjct  155  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAA  214

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GIL
Sbjct  215  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGIL  274

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  275  SVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  334

Query  166  WK*MPAS  146
            W+ +  S
Sbjct  335  WQGLEGS  341



>emb|CAA33264.1| unnamed protein product [Pisum sativum]
Length=405

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 223/242 (92%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAG+HI AGAKKV ITAP KGDIPTYVVGVNADAY+  + IISNASCT
Sbjct  164  VIEGTGVFVDREGAGRHITAGAKKVLITAPRKGDIPTYVVGVNADAYTHADDIISNASCT  223

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  224  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  283

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVN AFRESAA EL GIL
Sbjct  284  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRESAAKELTGIL  343

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  344  SVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANN  403

Query  166  WK  161
            WK
Sbjct  404  WK  405



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN   YSP + IISNASCT
Sbjct  168  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNASCT  227

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  228  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  287

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL
Sbjct  288  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGIL  347

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN 
Sbjct  348  AVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANN  407

Query  166  WK  161
            WK
Sbjct  408  WK  409



>gb|ACN39951.1| unknown [Picea sitchensis]
Length=330

 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 222/242 (92%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN   YSP + IISNASCT
Sbjct  88   VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNASCT  147

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  148  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  207

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL
Sbjct  208  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGIL  267

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN 
Sbjct  268  AVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANN  327

Query  166  WK  161
            WK
Sbjct  328  WK  329



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  158  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 217/242 (90%), Positives = 230/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVN + Y+  + IISNASCT
Sbjct  93   VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCT  152

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAA
Sbjct  153  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAA  212

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  213  KAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADQELKGIL  272

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVS+DFRC+DVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  273  SVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  332

Query  166  WK  161
            W+
Sbjct  333  WQ  334



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   357 bits (916),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYV GVNA+ YS ++ IISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   355 bits (911),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYV GVNA+ YS ++ IISNASCT
Sbjct  109  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVCGVNAELYSHEDTIISNASCT  168

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  169  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  228

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  229  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  288

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  289  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  348

Query  166  WK  161
            WK
Sbjct  349  WK  350



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score =   359 bits (921),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 224/242 (93%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY+  + IISNASCT
Sbjct  225  VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYTHADDIISNASCT  284

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  285  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  344

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A NEL GIL
Sbjct  345  KAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAADNELSGIL  404

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  405  AVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  464

Query  166  WK  161
            WK
Sbjct  465  WK  466



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   357 bits (915),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 219/242 (90%), Positives = 230/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR GAGKH+EAGAKKV ITAPGKGDIPTYV GVNAD Y+  + IISNASCT
Sbjct  160  VIEGTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  220  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL
Sbjct  280  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  340  DVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  399

Query  166  WK  161
            WK
Sbjct  400  WK  401



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   357 bits (915),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 220/242 (91%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  158  VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   356 bits (914),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 220/242 (91%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  158  VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   355 bits (910),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 220/242 (91%), Positives = 232/242 (96%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  109  VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  168

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  169  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  228

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  229  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  288

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  289  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  348

Query  166  WK  161
            WK
Sbjct  349  WK  350



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 219/242 (90%), Positives = 230/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR GAGKH+EAGAKKV ITAPGKGDIPTYV GVNAD Y+  + IISNASCT
Sbjct  160  VIEGTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  220  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL
Sbjct  280  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  340  DVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  399

Query  166  WK  161
            WK
Sbjct  400  WK  401



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 230/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN   YSP + IISNASCT
Sbjct  168  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNASCT  227

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGII GTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  228  TNCLAPFVKVLDQKFGIINGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  287

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL
Sbjct  288  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGIL  347

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN 
Sbjct  348  AVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANN  407

Query  166  WK  161
            WK
Sbjct  408  WK  409



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 230/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVN   YSP + IISNASCT
Sbjct  168  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNEGKYSPTDDIISNASCT  227

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  228  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  287

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL
Sbjct  288  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGIL  347

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMV V+AWYDNEWGYSQRVVDLADIVAN 
Sbjct  348  AVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVNVVAWYDNEWGYSQRVVDLADIVANN  407

Query  166  WK  161
            WK
Sbjct  408  WK  409



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 219/242 (90%), Positives = 230/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR GAGKH+EAGAKKV ITAPGKGDIPTYV GVNAD Y+  + IISNASCT
Sbjct  161  VIEGTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNASCT  220

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  221  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  280

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL
Sbjct  281  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGIL  340

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  341  DVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  400

Query  166  WK  161
            WK
Sbjct  401  WK  402



>gb|KDO63476.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=442

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 231/281 (82%), Positives = 236/281 (84%), Gaps = 39/281 (14%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNADAY PDEPIISNASCT
Sbjct  162  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADAYKPDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFG---------------------------------------IIKGT  644
            TNCLAPFVKVLDQKFG                                       IIKGT
Sbjct  222  TNCLAPFVKVLDQKFGKYQKHLQKSSLSLCSDIIQLRKTQKVTQLNDRIFPMCAGIIKGT  281

Query  643  MTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRV  464
            MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRV
Sbjct  282  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIALRV  341

Query  463  PTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstv  284
            PTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVSSTV
Sbjct  342  PTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVSSTV  401

Query  283  dssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  161
            DSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  402  DSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  442



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 219/242 (90%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD+EGAGKH++AGAKKV ITAPGKG IPTYVVGVNA+ YSP EPIISNASCT
Sbjct  161  VIEGTGVFVDQEGAGKHLKAGAKKVLITAPGKGAIPTYVVGVNAEQYSPTEPIISNASCT  220

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  221  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  280

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA   L+GIL
Sbjct  281  KAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKALNGIL  340

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+IVA Q
Sbjct  341  AVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQ  400

Query  166  WK  161
            WK
Sbjct  401  WK  402



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 220/242 (91%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVNA+ YS  + IISNASCT
Sbjct  158  VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHADTIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  278  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  338  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  397

Query  166  WK  161
            WK
Sbjct  398  WK  399



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   354 bits (908),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 218/242 (90%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD+EGAGKH++AGAKKV ITAPGKG IPTYVVGVNA+ YSP EPIISNASCT
Sbjct  161  VIEGTGVFVDQEGAGKHLKAGAKKVLITAPGKGAIPTYVVGVNAEQYSPTEPIISNASCT  220

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  221  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  280

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A   L+GIL
Sbjct  281  KAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAADKALNGIL  340

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+IVA Q
Sbjct  341  AVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQ  400

Query  166  WK  161
            WK
Sbjct  401  WK  402



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 219/242 (90%), Positives = 231/242 (95%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKH++AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCT
Sbjct  109  VIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCT  168

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  169  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  228

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL
Sbjct  229  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGIL  288

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQR VDLADIVAN 
Sbjct  289  DVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRDVDLADIVANN  348

Query  166  WK  161
            WK
Sbjct  349  WK  350



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score =   353 bits (906),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 220/242 (91%), Positives = 228/242 (94%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ G GVFVDREGAGKH++AGAKKV ITAPGKGDIPTYV GVN D Y P E IISNASCT
Sbjct  169  VIEGPGVFVDREGAGKHLQAGAKKVLITAPGKGDIPTYVCGVNEDKYYPAEEIISNASCT  228

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  229  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  288

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  EL GIL
Sbjct  289  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRETADKELKGIL  348

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN 
Sbjct  349  AVCDEPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANN  408

Query  166  WK  161
            WK
Sbjct  409  WK  410



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score =   346 bits (887),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 216/233 (93%), Positives = 224/233 (96%), Gaps = 0/233 (0%)
 Frame = -3

Query  859  DREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNCLAPFVK  680
            DREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ YS ++ IISNASCTTNCLAPFVK
Sbjct  1    DREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYSHEDTIISNASCTTNCLAPFVK  60

Query  679  VLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPS  500
            VLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+
Sbjct  61   VLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPN  120

Query  499  LKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVS  320
            LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVS
Sbjct  121  LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVS  180

Query  319  VDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  161
            VDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  181  VDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  233



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 218/242 (90%), Positives = 227/242 (94%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  151  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNASCT  210

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  211  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  270

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVAL   +L+G    + LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL GIL
Sbjct  271  KAVALSSQALRGSSMALPLRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGIL  330

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ
Sbjct  331  DVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  390

Query  166  WK  161
            WK
Sbjct  391  WK  392



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 209/242 (86%), Positives = 216/242 (89%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDRE AGKHI AGAKKV ITAPGKGDIPTYVVGVN   YS DEPIISNASCT
Sbjct  162  VIEGTGVFVDRERAGKHIVAGAKKVLITAPGKGDIPTYVVGVNEYDYSGDEPIISNASCT  221

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTT SYTGD+ L  +     R   AA  NIVPTSTGAA
Sbjct  222  TNCLAPFVKVLDQKFGIIKGTMTTTPSYTGDRALDASHRDLRRARAAAL-NIVPTSTGAA  280

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  281  KAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGIL  340

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEP VSVDFRC+DVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+
Sbjct  341  SVCDEPFVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANK  400

Query  166  WK  161
            WK
Sbjct  401  WK  402



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   342 bits (878),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 210/241 (87%), Positives = 228/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD+EGAGKH++AGAKKV ITAPGKG IPTYV+GVN + Y P E IISNASCT
Sbjct  116  VIEGTGVFVDKEGAGKHLQAGAKKVLITAPGKGPIPTYVIGVNEELYDPSEQIISNASCT  175

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  176  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  235

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  ++ GIL
Sbjct  236  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAANGDMKGIL  295

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +
Sbjct  296  AVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEK  355

Query  166  W  164
            W
Sbjct  356  W  356



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 210/241 (87%), Positives = 228/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD+EGAGKH++AGAKKV ITAPGKG IPTYV+GVN + Y P E IISNASCT
Sbjct  157  VIEGTGVFVDKEGAGKHLQAGAKKVLITAPGKGPIPTYVIGVNEELYDPSEQIISNASCT  216

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  217  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  276

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  ++ GIL
Sbjct  277  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAANGDMKGIL  336

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            +VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +
Sbjct  337  AVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEK  396

Query  166  W  164
            W
Sbjct  397  W  397



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 209/242 (86%), Positives = 220/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVFVD  GAGKHIEAGAKKV ITAP KG DIPTYVVGVN   Y P  PIISNASC
Sbjct  71   VIEGTGVFVDSAGAGKHIEAGAKKVLITAPAKGSDIPTYVVGVNDQDYDPSAPIISNASC  130

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPFVK+L  KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA
Sbjct  131  TTNCLAPFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA  190

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVS+VDLV+Q  KKTFAEEVNAAFRE+A   L GI
Sbjct  191  AKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTFAEEVNAAFREAANGPLKGI  250

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN
Sbjct  251  LAVCDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVAN  310

Query  169  QW  164
             W
Sbjct  311  NW  312



>emb|CAC80372.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=314

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 211/224 (94%), Positives = 219/224 (98%), Gaps = 0/224 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  91   VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYNPDEPIISNASCT  150

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVK+LDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  151  TNCLAPFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  210

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL+GIL
Sbjct  211  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELNGIL  270

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEW  215
            SVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDNEW
Sbjct  271  SVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEW  314



>gb|ABG35250.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35251.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35252.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35253.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35256.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35257.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35258.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35259.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35260.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35261.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35262.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35263.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35264.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35265.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35266.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35268.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35269.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35270.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35271.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35272.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35273.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35274.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35275.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35276.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35277.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35278.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35279.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35280.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35281.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35282.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35283.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35284.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35285.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35286.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35287.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35288.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35289.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35290.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35291.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35292.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35293.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35294.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35295.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35296.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35297.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35298.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35299.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35300.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35301.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35302.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35303.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35304.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35305.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35306.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35307.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35308.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35309.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35310.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35311.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35312.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35313.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   332 bits (850),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 212/224 (95%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -3

Query  832  EAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGII  653
            EAGAKKV ITAPGKGDIPTYVVGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGII
Sbjct  1    EAGAKKVLITAPGKGDIPTYVVGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGII  60

Query  652  KGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  473
            KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  61   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  120

Query  472  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  293
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  121  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  180

Query  292  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  161
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  181  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  224



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score =   335 bits (860),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 209/242 (86%), Positives = 220/242 (91%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVFVD  GAGKHIEAGAKKV ITAP KG DIPTYVVGVN   Y P  PIISNASC
Sbjct  93   VIEGTGVFVDSAGAGKHIEAGAKKVLITAPAKGSDIPTYVVGVNDQDYDPSAPIISNASC  152

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPFVK+L  KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA
Sbjct  153  TTNCLAPFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA  212

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVS+VDLV+Q  KKTFAEEVNAAFRE+A   L GI
Sbjct  213  AKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTFAEEVNAAFREAANGPLKGI  272

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN
Sbjct  273  LAVCDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVAN  332

Query  169  QW  164
             W
Sbjct  333  NW  334



>ref|XP_010929533.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic [Elaeis guineensis]
Length=261

 Score =   332 bits (851),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 212/243 (87%), Positives = 226/243 (93%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITA-PGKGDIPTYVVGVNADAYSPDEPIISNASC  710
            +++GTGVFV+REGAGK+I+A        + PG+GDIPTYVVGVNA+ Y+PDEPIISNASC
Sbjct  19   VIKGTGVFVEREGAGKNIQAAGGADGAXSWPGEGDIPTYVVGVNAETYNPDEPIISNASC  78

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCL+PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA
Sbjct  79   TTNCLSPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA  138

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP+LKGKLN IALRVPTPNVSVVDLVVQVSKK  AEE+NAAFR+SA  EL GI
Sbjct  139  AKAVALVLPTLKGKLNEIALRVPTPNVSVVDLVVQVSKKILAEEINAAFRDSAEKELRGI  198

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            LSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN
Sbjct  199  LSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  258

Query  169  QWK  161
             WK
Sbjct  259  NWK  261



>gb|ABG35267.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   330 bits (846),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 211/224 (94%), Positives = 217/224 (97%), Gaps = 0/224 (0%)
 Frame = -3

Query  832  EAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGII  653
            EAGAKKV ITAPGKGDIPTYVVGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGII
Sbjct  1    EAGAKKVLITAPGKGDIPTYVVGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGII  60

Query  652  KGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  473
            KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  61   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  120

Query  472  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  293
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  121  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  180

Query  292  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  161
            STVDSSLTMVMGDDMVKVIAWYD+EWGYSQRVVDLADIVAN WK
Sbjct  181  STVDSSLTMVMGDDMVKVIAWYDHEWGYSQRVVDLADIVANNWK  224



>ref|XP_008663264.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58480.1| hypothetical protein ZEAMMB73_511551 [Zea mays]
Length=401

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 208/242 (86%), Positives = 221/242 (91%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
             + GTGVFVD EGAGKHI+AGAKKV ITAP KG+IPTYVVGVNAD Y+PDEPII+NASCT
Sbjct  160  FIEGTGVFVDHEGAGKHIQAGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIINNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNC  PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AA
Sbjct  220  TNCRVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL
Sbjct  280  KAVALVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQ
Sbjct  340  EVCDVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQ  399

Query  166  WK  161
            WK
Sbjct  400  WK  401



>ref|XP_008663258.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58475.1| hypothetical protein ZEAMMB73_739238 [Zea mays]
Length=401

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 208/242 (86%), Positives = 220/242 (91%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
             + GTGVFVD E AGKHI+AGAKKV ITAP KG+IPTYVVGVNAD Y+PDEPIISNASCT
Sbjct  160  FIEGTGVFVDHESAGKHIQAGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIISNASCT  219

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNC  PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AA
Sbjct  220  TNCRVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAA  279

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL
Sbjct  280  KAVALVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGIL  339

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQ
Sbjct  340  EVCDVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQ  399

Query  166  WK  161
            WK
Sbjct  400  WK  401



>gb|AFW58485.1| hypothetical protein ZEAMMB73_956640 [Zea mays]
Length=372

 Score =   332 bits (852),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 206/242 (85%), Positives = 218/242 (90%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
             + GTGVFVD EGAGKHI+ GAKKV ITAP KG+IPTYVVGVNAD Y+PDEPIISN SCT
Sbjct  131  FIEGTGVFVDHEGAGKHIQVGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIISNTSCT  190

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNC  PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AA
Sbjct  191  TNCRVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAA  250

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAV LVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL
Sbjct  251  KAVVLVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGIL  310

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQ
Sbjct  311  EVCDVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQ  370

Query  166  WK  161
            WK
Sbjct  371  WK  372



>emb|CAC80373.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=312

 Score =   330 bits (846),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 211/222 (95%), Positives = 216/222 (97%), Gaps = 0/222 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYVVGVNAD YSPDEPIISNASCT
Sbjct  91   VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNADLYSPDEPIISNASCT  150

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  151  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  210

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL
Sbjct  211  KAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELAGIL  270

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDN  221
            SVCDEPLVSVDFRCSDVSSTVD+SLTMVMGDDMVKVIAWYDN
Sbjct  271  SVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDN  312



>gb|ABG35254.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35255.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   326 bits (836),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 210/224 (94%), Positives = 215/224 (96%), Gaps = 0/224 (0%)
 Frame = -3

Query  832  EAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGII  653
            EAGAKK  I APGKGDIPTYVVGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGII
Sbjct  1    EAGAKKGVIRAPGKGDIPTYVVGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGII  60

Query  652  KGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  473
            KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  61   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  120

Query  472  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  293
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  121  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  180

Query  292  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  161
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  181  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  224



>ref|XP_008664191.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Zea mays]
Length=420

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 206/242 (85%), Positives = 218/242 (90%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
             + GTGVFVD EGAGKHI+ GAKKV ITAP KG+IPTYVVGVNAD Y+PDEPIISN SCT
Sbjct  179  FIEGTGVFVDHEGAGKHIQVGAKKVLITAPDKGNIPTYVVGVNADQYNPDEPIISNTSCT  238

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNC  PFVKVLDQKFGIIKGTMTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AA
Sbjct  239  TNCRVPFVKVLDQKFGIIKGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAA  298

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAV LVLP+LKGKLNGIAL VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL
Sbjct  299  KAVVLVLPNLKGKLNGIALWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGIL  358

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSD SST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQ
Sbjct  359  EVCDVPLVSVDFRCSDFSSTIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQ  418

Query  166  WK  161
            WK
Sbjct  419  WK  420



>ref|XP_003548929.2| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde 3-phosphate dehydrogenase 
GAPA2, chloroplastic-like [Glycine max]
Length=346

 Score =   329 bits (844),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 201/243 (83%), Positives = 210/243 (86%), Gaps = 12/243 (5%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAK V ITAPGKGDIPTYVVGVNAD Y+PDEPIISNASC 
Sbjct  115  VIEGTGVFVDRDGAGKHIQAGAKXVLITAPGKGDIPTYVVGVNADIYNPDEPIISNASC-  173

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
                 PFVKVLDQKFGIIKGTMTTTHSYTGDQR LD   R          NIVPTSTGAA
Sbjct  174  ----XPFVKVLDQKFGIIKGTMTTTHSYTGDQRFLDXRARAAAL------NIVPTSTGAA  223

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK-TFAEEVNAAFRESAANELDGI  350
            KAV LVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KK TFAEEVNA FRES  NEL GI
Sbjct  224  KAVVLVLPTLKGKLNGIALRVPTPNVSVVDLVVQVTKKXTFAEEVNAVFRESTENELKGI  283

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            LSVCDEPLVSVDFRCSDVSSTVDS LTMV+GDDMVKVIAWYDNE GYSQRVVDLADIVA+
Sbjct  284  LSVCDEPLVSVDFRCSDVSSTVDSXLTMVVGDDMVKVIAWYDNEXGYSQRVVDLADIVAH  343

Query  169  QWK  161
             WK
Sbjct  344  NWK  346



>dbj|BAN09110.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Artemisia 
indica]
Length=241

 Score =   325 bits (834),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 208/226 (92%), Positives = 217/226 (96%), Gaps = 0/226 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR+GAGKHI+AGAKKV ITAPGKGDIPTYVVGVNA+ Y+  E IISNASCT
Sbjct  16   VIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKGDIPTYVVGVNAELYNHSEDIISNASCT  75

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  76   TNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  135

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KA ALVLPSLKGKLNGIALR PTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GIL
Sbjct  136  KAAALVLPSLKGKLNGIALRAPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGIL  195

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGY  209
            SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGY
Sbjct  196  SVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGY  241



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 204/241 (85%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GAGKHI AGAKKV ITAPGKG +IPTYVVGVNAD Y   + I+SNASC
Sbjct  44   VIEGTGVFIDEAGAGKHITAGAKKVLITAPGKGPNIPTYVVGVNADQYKSTDTIVSNASC  103

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPF KVLD KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA
Sbjct  104  TTNCLAPFAKVLDDKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA  163

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+
Sbjct  164  AKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGV  223

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+AN
Sbjct  224  LAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAN  283

Query  169  Q  167
            Q
Sbjct  284  Q  284



>dbj|BAA94304.1| NADP-glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
sp. W80]
Length=369

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 203/243 (84%), Positives = 224/243 (92%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGD-IPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D +GAGKHIEAGAKKV ITAP KGD IPT+V GVNAD Y  + PIISNASC
Sbjct  127  VIEGTGVFIDTKGAGKHIEAGAKKVLITAPAKGDGIPTFVCGVNADDYKHEYPIISNASC  186

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNC+APFVKVL++KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAA+NIVPTSTGA
Sbjct  187  TTNCMAPFVKVLEEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGA  246

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLPS+KGKLNGIALRVPTPNVS+VDLVVQV KKTFAEEVNAAFRE+A     G+
Sbjct  247  AKAVALVLPSMKGKLNGIALRVPTPNVSIVDLVVQVEKKTFAEEVNAAFREAANGAQKGV  306

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+V DEPLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+I A 
Sbjct  307  LAVSDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAQ  366

Query  169  QWK  161
            +W+
Sbjct  367  KWE  369



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   330 bits (845),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 208/243 (86%), Positives = 223/243 (92%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD  GAGKHI+AGAKKV ITAPGKG IPTYVVGVN   Y   + IISNASCT
Sbjct  157  VIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTYVVGVNEKDYKHSDSIISNASCT  216

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  217  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  276

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRES-AANELDGI  350
            KAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++ A  EL G+
Sbjct  277  KAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACATEELKGV  336

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA IVA 
Sbjct  337  LAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAE  396

Query  169  QWK  161
            +W+
Sbjct  397  KWQ  399



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   330 bits (845),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 208/243 (86%), Positives = 223/243 (92%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD  GAGKHI+AGAKKV ITAPGKG IPTYVVGVN   Y   + IISNASCT
Sbjct  164  VIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTYVVGVNEKDYKHSDSIISNASCT  223

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  224  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  283

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRES-AANELDGI  350
            KAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++ A  EL G+
Sbjct  284  KAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACATEELKGV  343

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA IVA 
Sbjct  344  LAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAE  403

Query  169  QWK  161
            +W+
Sbjct  404  KWQ  406



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   328 bits (842),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 206/243 (85%), Positives = 223/243 (92%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD  GAGKHI+AGAKKV ITAPGKG IPTYVVGVN   Y   + IISNASCT
Sbjct  158  VIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTYVVGVNEQDYKHSDAIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGI  350
            KAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+
Sbjct  278  KAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACETEQLKGV  337

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA 
Sbjct  338  LAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAE  397

Query  169  QWK  161
            +W+
Sbjct  398  KWQ  400



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 202/241 (84%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GAGKHI AGAKKV ITAPGKG +IPTYVVGVNAD Y   + I+SNASC
Sbjct  44   VIEGTGVFIDEAGAGKHITAGAKKVLITAPGKGPNIPTYVVGVNADQYKSTDTIVSNASC  103

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPF KVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA
Sbjct  104  TTNCLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA  163

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+
Sbjct  164  AKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGV  223

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+A 
Sbjct  224  LAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAK  283

Query  169  Q  167
            +
Sbjct  284  E  284



>gb|ABK00056.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Mesostigma viride]
Length=310

 Score =   324 bits (830),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 202/241 (84%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GAGKHI AGAKKV ITAPGKG +IPTYVVGVNAD Y   + I+SNASC
Sbjct  70   VIEGTGVFIDEAGAGKHITAGAKKVLITAPGKGPNIPTYVVGVNADQYKSTDTIVSNASC  129

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPF KVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA
Sbjct  130  TTNCLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA  189

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+
Sbjct  190  AKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGV  249

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+A 
Sbjct  250  LAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAK  309

Query  169  Q  167
            +
Sbjct  310  E  310



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   327 bits (838),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 206/243 (85%), Positives = 223/243 (92%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD  GAGKHI+AGAKKV ITAPGKG IPTYVVGVN   Y   + IISNASCT
Sbjct  164  VIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTYVVGVNEQDYKHSDAIISNASCT  223

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  224  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  283

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGI  350
            KAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+
Sbjct  284  KAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACETEQLKGV  343

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA 
Sbjct  344  LAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAE  403

Query  169  QWK  161
            +W+
Sbjct  404  KWQ  406



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   327 bits (837),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 223/243 (92%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD  GAGKHI+AGAKKV ITAPGKG IPT+VVGVN   Y   + IISNASCT
Sbjct  164  VIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTFVVGVNEQDYKHSDAIISNASCT  223

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  224  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  283

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGI  350
            KAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+
Sbjct  284  KAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACQTEQLKGV  343

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA 
Sbjct  344  LAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAE  403

Query  169  QWK  161
            +W+
Sbjct  404  KWE  406



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   326 bits (835),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 210/242 (87%), Positives = 220/242 (91%), Gaps = 13/242 (5%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKHI+AGAKKV ITAPGKGDIPTYV+GVNA+ Y+PDE IISNASCT
Sbjct  158  VIEGTGVFVDREGAGKHIQAGAKKVLITAPGKGDIPTYVIGVNAETYNPDETIISNASCT  217

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  218  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  277

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  EL+GIL
Sbjct  278  KAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAADKELNGIL  337

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
            SVCDEPLVSVDFRC+DVSSTVD+SLTMVMGDDMVK             RVVDLADIVAN 
Sbjct  338  SVCDEPLVSVDFRCTDVSSTVDASLTMVMGDDMVK-------------RVVDLADIVANN  384

Query  166  WK  161
            WK
Sbjct  385  WK  386



>gb|ABD37961.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Mesostigma 
viride]
Length=333

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 203/243 (84%), Positives = 221/243 (91%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GAGKHI AGAKKV ITAPGKG +IPTYVVGVNAD Y   + I+SNASC
Sbjct  91   VIEGTGVFIDEAGAGKHITAGAKKVLITAPGKGPNIPTYVVGVNADQYKSTDTIVSNASC  150

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPF KVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA
Sbjct  151  TTNCLAPFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA  210

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+
Sbjct  211  AKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGV  270

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDF+CSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+A 
Sbjct  271  LAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAK  330

Query  169  QWK  161
            + K
Sbjct  331  EMK  333



>gb|EMS61784.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Triticum 
urartu]
Length=365

 Score =   325 bits (833),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 191/242 (79%), Positives = 203/242 (84%), Gaps = 27/242 (11%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDR GAGKH+EAGAKKV ITAPGKGDIPTYV GVNAD Y+  + IISNASCT
Sbjct  151  VIEGTGVFVDRAGAGKHLEAGAKKVLITAPGKGDIPTYVCGVNADLYTHADTIISNASCT  210

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRL                          
Sbjct  211  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRL--------------------------  244

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
             AVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL
Sbjct  245  -AVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGIL  303

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVA+Q
Sbjct  304  DVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVADQ  363

Query  166  WK  161
            WK
Sbjct  364  WK  365



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   325 bits (834),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 205/243 (84%), Positives = 223/243 (92%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD  GAGKHI+AGAKKV ITAPGKG IPT+VVGVN   Y   + IISNASCT
Sbjct  136  VIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGAIPTFVVGVNEQDYKHSDAIISNASCT  195

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  196  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  255

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGI  350
            KAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+
Sbjct  256  KAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACQTEQLKGV  315

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA 
Sbjct  316  LAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAE  375

Query  169  QWK  161
            +W+
Sbjct  376  KWE  378



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 210/242 (87%), Positives = 216/242 (89%), Gaps = 20/242 (8%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREG                    DIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  159  VIEGTGVFVDREG--------------------DIPTYVVGVNADAYNPDEPIISNASCT  198

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  199  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  258

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA  EL GIL
Sbjct  259  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESAEKELKGIL  318

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  319  EVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  378

Query  166  WK  161
            WK
Sbjct  379  WK  380



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 204/243 (84%), Positives = 223/243 (92%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD  GAGKH++AGAKKV ITAPGKG IPTYV+GVN   Y+  + IISNASCT
Sbjct  135  VIEGTGVFVDEAGAGKHLQAGAKKVLITAPGKGAIPTYVIGVNEQDYTHADKIISNASCT  194

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  195  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  254

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAAN-ELDGI  350
            KAVALVLP LKGK+NGIALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++    +L GI
Sbjct  255  KAVALVLPRLKGKINGIALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACETPQLKGI  314

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA 
Sbjct  315  LAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAE  374

Query  169  QWK  161
            +W+
Sbjct  375  KWQ  377



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   323 bits (828),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 209/242 (86%), Positives = 216/242 (89%), Gaps = 20/242 (8%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREG                    DIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  159  VIEGTGVFVDREG--------------------DIPTYVVGVNADAYNPDEPIISNASCT  198

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  199  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  258

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GIL
Sbjct  259  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELKGIL  318

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  319  EVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  378

Query  166  WK  161
            WK
Sbjct  379  WK  380



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 208/242 (86%), Positives = 216/242 (89%), Gaps = 20/242 (8%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREG                    DIPTYVVGVNADAY+PDEPIISNASCT
Sbjct  159  VIEGTGVFVDREG--------------------DIPTYVVGVNADAYNPDEPIISNASCT  198

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  199  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  258

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEE+NAAFR+SA  EL GIL
Sbjct  259  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEINAAFRDSAEKELKGIL  318

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN 
Sbjct  319  EVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANN  378

Query  166  WK  161
            WK
Sbjct  379  WK  380



>gb|ABD37963.1| glyceraldehyde-3-phosphate dehydrogenase subunit A2 [Physcomitrella 
patens]
Length=323

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 203/243 (84%), Positives = 223/243 (92%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD  GAGKHI+AGAKKV ITAPGKG IPTYVVGVN   Y   + IISNASCT
Sbjct  81   VIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGPIPTYVVGVNEQDYKHSDTIISNASCT  140

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  141  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  200

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESA-ANELDGI  350
            KAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT AEEVN AFR++   ++L G+
Sbjct  201  KAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTSAEEVNQAFRDACNTDQLKGV  260

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMG+DMVKV+AWYDNEWGYSQRVVDLA++VA 
Sbjct  261  LAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAE  320

Query  169  QWK  161
            +W+
Sbjct  321  KWQ  323



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   321 bits (822),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 203/243 (84%), Positives = 223/243 (92%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD  GAGKHI+AGAKKV ITAPGKG IPTYVVGVN   Y   + IISNASCT
Sbjct  134  VIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGPIPTYVVGVNEQDYKHSDTIISNASCT  193

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  194  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  253

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESA-ANELDGI  350
            KAVALVLP+LKGK+NGIALRVPTPNVSVVDLVVQV KKT AEEVN AFR++   ++L G+
Sbjct  254  KAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTSAEEVNQAFRDACNTDQLKGV  313

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVSSTVDSSLTMVMG+DMVKV+AWYDNEWGYSQRVVDLA++VA 
Sbjct  314  LAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAE  373

Query  169  QWK  161
            +W+
Sbjct  374  KWQ  376



>gb|ACX37507.1| chloroplast glyceraldehyde 3-phosphate dehydrogenase [Botryococcus 
braunii]
Length=411

 Score =   318 bits (816),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 201/242 (83%), Positives = 217/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVFV  EGAGKHI AGAKKV ITAP KG D+PTYVVGVNAD Y   + IISNASC
Sbjct  169  VIEGTGVFVSSEGAGKHIAAGAKKVLITAPAKGSDVPTYVVGVNADQYKHSDNIISNASC  228

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPFVKVLD+K GI+KGT+TTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGA
Sbjct  229  TTNCLAPFVKVLDEKLGIVKGTVTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGA  288

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP+LKGKLNGIALRVPTPNVSVVDLV+QV KKTFAEEVN AFRE+A   + GI
Sbjct  289  AKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVIQVEKKTFAEEVNEAFREAANGPMKGI  348

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L V DEPLVS DF CSD SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+IVA 
Sbjct  349  LVVSDEPLVSKDFACSDQSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEIVAK  408

Query  169  QW  164
            +W
Sbjct  409  KW  410



>gb|ABD37956.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Spermatozopsis 
similis]
Length=263

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 190/242 (79%), Positives = 217/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GAGKH+ AGAKKV ITAP K   IPT+V+GVN   Y  + PI+SNASC
Sbjct  21   VIEGTGVFIDEAGAGKHLTAGAKKVIITAPAKDKSIPTFVIGVNDKDYKHEYPIVSNASC  80

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNC+APF KVLD KFGI+KG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGA
Sbjct  81   TTNCMAPFCKVLDAKFGIVKGVMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGA  140

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP+LKGKLNG ALRVPTPNVS+VDLV+QV KKTFAEEVN AFRE+AA E+ G+
Sbjct  141  AKAVALVLPNLKGKLNGFALRVPTPNVSIVDLVIQVEKKTFAEEVNNAFREAAAGEMKGV  200

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+VCDEPLVSVDFRC+DVS ++DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA++ A+
Sbjct  201  LAVCDEPLVSVDFRCTDVSVSIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAELAAS  260

Query  169  QW  164
            +W
Sbjct  261  KW  262



>gb|ACA35006.1| glyceraldehyde-3-phosphate dehydrogenase [Dunaliella salina]
Length=376

 Score =   315 bits (808),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 215/242 (89%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GAGKHI+AGAKKV ITAP KG DIPT+VVGVN D Y  D PI+SNASC
Sbjct  133  VIEGTGVFIDTPGAGKHIQAGAKKVLITAPAKGSDIPTFVVGVNCDGYKHDYPIVSNASC  192

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPFVKVL +KFG++KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGA
Sbjct  193  TTNCLAPFVKVLHEKFGVVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGA  252

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNG+ALRVPTPNVS+VDLVVQV KKTFAEEVN AFRE+AA  +  +
Sbjct  253  AKAVALVLPELKGKLNGVALRVPTPNVSIVDLVVQVEKKTFAEEVNNAFREAAAGPMKNV  312

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+V DEPLVS DF+  D S+ +DS+LTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+I A 
Sbjct  313  LAVADEPLVSADFKGMDQSTAIDSALTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAQ  372

Query  169  QW  164
            +W
Sbjct  373  RW  374



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 193/243 (79%), Positives = 215/243 (88%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGD-IPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GA KH+ AGAKKV ITAP KGD IPTYV+GVNAD Y   + IISNASC
Sbjct  137  VIEGTGVFIDTPGASKHLTAGAKKVVITAPAKGDDIPTYVLGVNADQYKNSDKIISNASC  196

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTN LAPFVKVL+ KFG++KG MTTTHSYTGDQ++LDASHRDLRRARAAALNIVPTSTGA
Sbjct  197  TTNGLAPFVKVLNDKFGLVKGLMTTTHSYTGDQKILDASHRDLRRARAAALNIVPTSTGA  256

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+Q SKK  AEEVN AFRESAA  L GI
Sbjct  257  AKAVALVLPELKGKLNGIALRVPTPNVSVVDLVIQTSKKVTAEEVNNAFRESAAGPLKGI  316

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            LSVCDEPLVSVDFRC+D S+T+DS+LTMV+GDDM+KV+AWYDNEWGYSQRVVDLA++ A 
Sbjct  317  LSVCDEPLVSVDFRCTDQSTTIDSALTMVIGDDMLKVVAWYDNEWGYSQRVVDLAELTAA  376

Query  169  QWK  161
             W+
Sbjct  377  NWE  379



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 217/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGK-GDIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D+ GAGKHI+AGAKKV ITAP K  DIPT+VVGVN   Y  + PIISNASC
Sbjct  131  VIEGTGVFIDKVGAGKHIQAGAKKVLITAPAKDKDIPTFVVGVNEADYKHEYPIISNASC  190

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPFVKVL +KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGA
Sbjct  191  TTNCLAPFVKVLQEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGA  250

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTP VSVVDLVVQV KKTFAEEVNAAFRE+AA  + G+
Sbjct  251  AKAVALVLPQLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAAAGPMKGV  310

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L V D PLVS+DF+C+D S+++DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++ A 
Sbjct  311  LHVEDAPLVSIDFKCTDQSTSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAQ  370

Query  169  QW  164
            +W
Sbjct  371  KW  372



>ref|XP_011399143.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 193/243 (79%), Positives = 220/243 (91%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVFVDR+GA KH++AGAKKV ITAP KG D+PTYV+GVNAD YS  + IISNASC
Sbjct  170  VIEGTGVFVDRKGASKHLQAGAKKVIITAPAKGSDVPTYVMGVNADQYSNSDDIISNASC  229

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPFVKVL+ +FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGA
Sbjct  230  TTNCLAPFVKVLNDRFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGA  289

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNG+ALRVPTP VSVVDLV+Q  KKTF EEVN+AFRE++   L GI
Sbjct  290  AKAVALVLPQLKGKLNGVALRVPTPTVSVVDLVIQTEKKTFTEEVNSAFREASEGYLKGI  349

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+V DEPLVS D+R +DVSST+D++LTMVMGDDMVKVIAWYDNEWGYSQRVVDLA++VA 
Sbjct  350  LAVSDEPLVSCDYRMTDVSSTIDAALTMVMGDDMVKVIAWYDNEWGYSQRVVDLAELVAQ  409

Query  169  QWK  161
            +W+
Sbjct  410  KWE  412



>gb|ABD37958.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Chara vulgaris]
Length=318

 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 199/226 (88%), Positives = 208/226 (92%), Gaps = 0/226 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVDREGAGKH++AGAKKV ITAPGKGDIPTYVVGVN   Y P E IISNASCT
Sbjct  93   VIEGTGVFVDREGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNDADYDPSETIISNASCT  152

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD KF I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  153  TNCLAPFVKVLDNKFTIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  212

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQ +KKTFAEEVN AFRESA   L GIL
Sbjct  213  KAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTAKKTFAEEVNNAFRESADGPLKGIL  272

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGY  209
            +VCDEPLVSVDFRC+DVSSTVDSSLTMVMGDDMVKV+AWYDNE GY
Sbjct  273  AVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNELGY  318



>emb|CAC80394.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=283

 Score =   310 bits (794),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 199/226 (88%), Positives = 213/226 (94%), Gaps = 0/226 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD+EGAGKH++AGAKKV ITAPGKG IPTYVVGVN + YS  + IISNASCT
Sbjct  58   VIEGTGVFVDKEGAGKHLQAGAKKVLITAPGKGAIPTYVVGVNEEQYSHRDEIISNASCT  117

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  118  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  177

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFR+++A  L GIL
Sbjct  178  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRDASAGALKGIL  237

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGY  209
            +VCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKV+AWYD EWGY
Sbjct  238  AVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDXEWGY  283



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 194/242 (80%), Positives = 217/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGK-GDIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D+ GAGKHI+AGA KV ITAP K  DIPT+VVGVN   Y  + PIISNASC
Sbjct  126  VIEGTGVFIDKVGAGKHIQAGAHKVLITAPAKDKDIPTFVVGVNDADYKHEYPIISNASC  185

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPFVKVL+QKFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGA
Sbjct  186  TTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGA  245

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLPSLKGKLNGIALRVPTP VSVVDLVVQV KKTFAEEVNAAFRE+A   + G+
Sbjct  246  AKAVALVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAANGPMKGV  305

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L V D PLVS+DF+C+D S+++D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+I A 
Sbjct  306  LHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAK  365

Query  169  QW  164
            +W
Sbjct  366  KW  367



>emb|CAC80393.1| glyceraldehyde-3-phosphate dehydrogenase [Sphagnum cuspidatum]
Length=318

 Score =   311 bits (796),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 199/226 (88%), Positives = 214/226 (95%), Gaps = 0/226 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD+EGAGKH++AGAKKV ITAPGKG IPTYVVGVNAD Y+  + IISNASCT
Sbjct  93   VIEGTGVFVDKEGAGKHLKAGAKKVLITAPGKGAIPTYVVGVNADEYNHGDEIISNASCT  152

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLD+KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  153  TNCLAPFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  212

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP+LKGKLNGIALRVPTPNVSVVDLVVQV KKTFAEEVNAAFR+++A  L GIL
Sbjct  213  KAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRDASAGPLKGIL  272

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGY  209
            +VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWY NEWGY
Sbjct  273  AVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYXNEWGY  318



>gb|ABD37957.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cladophora 
rupestris]
Length=376

 Score =   313 bits (801),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 193/242 (80%), Positives = 220/242 (91%), Gaps = 0/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFV  EGAGKH++AGAKKV ITAPGKGDIPT+V+GVN+D Y  + PIISNASCT
Sbjct  135  VIEGTGVFVSEEGAGKHLQAGAKKVIITAPGKGDIPTFVMGVNSDDYKHEYPIISNASCT  194

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKV+ +KFG++KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAA
Sbjct  195  TNCLAPFVKVIVEKFGVVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAA  254

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQV KKT AEEVN AFR++AA  L G+L
Sbjct  255  KAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTLAEEVNQAFRDAAAGPLKGVL  314

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             V D PLVS+DF+ SDVS+T+DS+LTMVMGDDMVKV+AWYDNEWGYSQRV+DLA++ A +
Sbjct  315  GVADIPLVSMDFKKSDVSTTIDSALTMVMGDDMVKVVAWYDNEWGYSQRVLDLAELCAEK  374

Query  166  WK  161
            W+
Sbjct  375  WE  376



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   312 bits (800),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 217/242 (90%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGK-GDIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D+ GAGKHI+AGA KV ITAP K  DIPT+VVGVN   Y  + PIISNASC
Sbjct  131  VIEGTGVFIDKVGAGKHIQAGASKVLITAPAKDKDIPTFVVGVNEGDYKHEYPIISNASC  190

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPFVKVL+QKFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGA
Sbjct  191  TTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGA  250

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAV+LVLPSLKGKLNGIALRVPTP VSVVDLVVQV KKTFAEEVNAAFRE+A   + G+
Sbjct  251  AKAVSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAANGPMKGV  310

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L V D PLVS+DF+C+D S+++D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++ A 
Sbjct  311  LHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAK  370

Query  169  QW  164
            +W
Sbjct  371  KW  372



>emb|CAC80392.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Spirogyra 
sp.]
Length=318

 Score =   310 bits (795),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 195/226 (86%), Positives = 210/226 (93%), Gaps = 0/226 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVF+D  GAGKHIEAGAKKV ITAPGKG IPTYVVGVNAD Y   EPIISNASCT
Sbjct  93   VIEGTGVFIDGPGAGKHIEAGAKKVLITAPGKGPIPTYVVGVNADKYVHSEPIISNASCT  152

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVK+L++KFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA
Sbjct  153  TNCLAPFVKILEEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAA  212

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAV+LVLPSLKGKLNGIALRVPTPNVSVVDLV+Q  KKTFAEEVNAAFRE+AA  + G+L
Sbjct  213  KAVSLVLPSLKGKLNGIALRVPTPNVSVVDLVIQTEKKTFAEEVNAAFREAAAGPMKGVL  272

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGY  209
            +VCDEPLVS+DFRCSDVS T+DSSLTMVMGDDMVKV+AWYDNE GY
Sbjct  273  AVCDEPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYDNELGY  318



>ref|XP_005644071.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19527.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=393

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 215/239 (90%), Gaps = 1/239 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVFV  +GAGKHI+AGAKKV ITAP KG DIPTYV+GVN D + P  PIISNASC
Sbjct  152  VIEGTGVFVSSDGAGKHIKAGAKKVLITAPAKGNDIPTYVIGVNDDTFDPSAPIISNASC  211

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPF KVL +KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGA
Sbjct  212  TTNCLAPFAKVLHEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGA  271

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+QV KKT AEEVN AFR +AANEL GI
Sbjct  272  AKAVALVLPELKGKLNGIALRVPTPNVSVVDLVIQVEKKTLAEEVNEAFRNAAANELKGI  331

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVA  173
            L+V D PLVS DF  +DVS+T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA
Sbjct  332  LAVSDVPLVSRDFALTDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAELVA  390



>gb|ABC00187.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
 gb|ABC00188.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
Length=376

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 214/242 (88%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPT+VVGVN D Y+   PIISNASC
Sbjct  133  VIEGTGVFVDTPGAGKHIQAGAKKVLITAPAKGNDIPTFVVGVNCDGYNHSYPIISNASC  192

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPFVKVL +KF I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGA
Sbjct  193  TTNCLAPFVKVLHEKFRIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGA  252

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNG+ALRVPTPNVS+VDLVVQV KKTFAEEVN AFRE+AA  +  +
Sbjct  253  AKAVALVLPDLKGKLNGVALRVPTPNVSIVDLVVQVEKKTFAEEVNNAFREAAAGPMSNV  312

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+V DEPLVS DF+  D S+ +DS+LTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++ A 
Sbjct  313  LAVADEPLVSADFKGMDQSTAIDSALTMVMGDDMVKVVAWYDNEWGYSQRVVDLAELTAQ  372

Query  169  QW  164
            +W
Sbjct  373  RW  374



>gb|ABD37953.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorella 
sp. JP-2005]
Length=316

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 197/243 (81%), Positives = 213/243 (88%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D +GA KHIEAGAKKV ITAP KG DIPTYVVGVN   Y   + IISNASC
Sbjct  74   VIEGTGVFIDTKGASKHIEAGAKKVLITAPAKGSDIPTYVVGVNEQDYKHSDAIISNASC  133

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPFVKVLD+KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGA
Sbjct  134  TTNCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGA  193

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNG+ALRVPTP VSVVDLVVQV KKTFAEEVN AFRE+A   L GI
Sbjct  194  AKAVALVLPKLKGKLNGVALRVPTPTVSVVDLVVQVEKKTFAEEVNEAFREAANGPLKGI  253

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L V DEPLVS DF+ ++VSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA   A 
Sbjct  254  LGVSDEPLVSCDFKMTNVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAAYTAK  313

Query  169  QWK  161
             W+
Sbjct  314  HWE  316



>gb|ABD37954.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cyanophora 
paradoxa]
Length=412

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 216/241 (90%), Gaps = 2/241 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++  TGVF+D  GAGKHI AGAKKV ITAP KG DIPTYVVGVN   Y+P  + I+SNAS
Sbjct  170  VIESTGVFIDGPGAGKHIAAGAKKVVITAPAKGSDIPTYVVGVNHKDYNPSTDHIVSNAS  229

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKVLD+KF IIKGTMTTTHSYTGDQRLLDASHRDLRRARAAA+NIVPTSTG
Sbjct  230  CTTNCLAPFVKVLDEKFKIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTG  289

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDG  353
            AAKAVALVLP+LKGKLNG+ALRVPTPNVS+VDLVVQV KKTFA+EVNAA RE+A  +L G
Sbjct  290  AAKAVALVLPNLKGKLNGLALRVPTPNVSIVDLVVQVEKKTFADEVNAALREAANTDLKG  349

Query  352  ILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVA  173
            +L V DEPLVS DFRC+D SST+D+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA+IVA
Sbjct  350  VLVVSDEPLVSCDFRCTDQSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAEIVA  409

Query  172  N  170
             
Sbjct  410  Q  410



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 196/209 (94%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -3

Query  787  DIPTYVVGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQr  608
            DIPTYVVGVNADAY+PD+PIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQR
Sbjct  160  DIPTYVVGVNADAYNPDKPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQR  219

Query  607  lldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvv  428
            LLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK NGIALRVPTPNVSVVDLVV
Sbjct  220  LLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKHNGIALRVPTPNVSVVDLVV  279

Query  427  qVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDM  248
            QV+KKTFAEEVNAAFR SA  EL GIL VCDEPLVSVDF+CSDVSST+DSSLTMVMGDDM
Sbjct  280  QVTKKTFAEEVNAAFRNSAEKELKGILKVCDEPLVSVDFKCSDVSSTIDSSLTMVMGDDM  339

Query  247  VKVIAWYDNEWGYSQRVVDLADIVANQWK  161
            VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  340  VKVIAWYDNEWGYSQRVVDLADIVANNWK  368



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 187/242 (77%), Positives = 214/242 (88%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGD-IPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GA KH+EAGA+KV ITAP KGD IPTYV+GVNAD Y+  + IISNASC
Sbjct  134  VIEGTGVFIDTPGASKHLEAGAEKVLITAPAKGDDIPTYVMGVNADQYTHADKIISNASC  193

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTN LAPF KVLD KFGI+KG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGA
Sbjct  194  TTNGLAPFAKVLDDKFGIVKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGA  253

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVD+ +Q  KK  AEE+NAAFRE+A   + GI
Sbjct  254  AKAVALVLPQLKGKLNGIALRVPTPNVSVVDMCIQTEKKCTAEEINAAFREAAEGPMKGI  313

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+V DEPLVS+DFRCSDVS+T+D++LTMVMGDD++KV+AWYDNEWGYSQRVVDLA++ A 
Sbjct  314  LAVADEPLVSIDFRCSDVSTTIDAALTMVMGDDLIKVVAWYDNEWGYSQRVVDLAELTAT  373

Query  169  QW  164
            +W
Sbjct  374  KW  375



>ref|XP_001420043.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98336.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=341

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 190/243 (78%), Positives = 215/243 (88%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGD-IPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GA KH+ AGAKKV ITAP KGD IPTYV+GVNAD Y   + I+SNASC
Sbjct  99   VIEGTGVFIDTPGASKHLTAGAKKVVITAPAKGDDIPTYVLGVNADQYKNTDKIVSNASC  158

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTN LAPFVKVLD +FGI+KG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGA
Sbjct  159  TTNGLAPFVKVLDDRFGIVKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGA  218

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+Q SKK  A+EVNAAFRE AA +L GI
Sbjct  219  AKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTSKKVTADEVNAAFREEAAGKLKGI  278

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+V DEPLVS DF+CSDVS+++D++LTMVMGDDM+KV+AWYDNEWGYSQRVVDLA++ A 
Sbjct  279  LAVADEPLVSCDFKCSDVSTSIDAALTMVMGDDMLKVVAWYDNEWGYSQRVVDLAELCAA  338

Query  169  QWK  161
             W+
Sbjct  339  NWE  341



>gb|ABG85190.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus 'lucimarinus']
Length=380

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 190/243 (78%), Positives = 215/243 (88%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGD-IPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GA KH+ AGAKKV ITAP KGD IPTYV+GVNAD Y   + I+SNASC
Sbjct  138  VIEGTGVFIDTPGASKHLTAGAKKVVITAPAKGDDIPTYVLGVNADQYKNTDKIVSNASC  197

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTN LAPFVKVLD +FGI+KG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGA
Sbjct  198  TTNGLAPFVKVLDDRFGIVKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGA  257

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+Q SKK  A+EVNAAFRE AA +L GI
Sbjct  258  AKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTSKKVTADEVNAAFREEAAGKLKGI  317

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+V DEPLVS DF+CSDVS+++D++LTMVMGDDM+KV+AWYDNEWGYSQRVVDLA++ A 
Sbjct  318  LAVADEPLVSCDFKCSDVSTSIDAALTMVMGDDMLKVVAWYDNEWGYSQRVVDLAELCAA  377

Query  169  QWK  161
             W+
Sbjct  378  NWE  380



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 220/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  178  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  237

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPF K+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  238  CTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  297

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L+
Sbjct  298  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLSAEDVNAAFRKAADGPLN  357

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCDEPLVSVDFRCSDVS+T+DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA +V
Sbjct  358  GILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLV  417

Query  175  ANQW  164
            AN+W
Sbjct  418  ANKW  421



>gb|ABW89099.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89100.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89101.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89102.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89103.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89105.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89106.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89107.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89108.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89109.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89110.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89111.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89112.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89113.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89114.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89115.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89116.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89117.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=206

 Score =   299 bits (766),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 195/206 (95%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  778  TYVVGVNADAYSPDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlld  599
            TYVVGVNA+ Y+  E IISNASCTTNCLAPFVKV+DQKFGIIKGTMTTTHSYTGDQRLLD
Sbjct  1    TYVVGVNAELYNHSEAIISNASCTTNCLAPFVKVIDQKFGIIKGTMTTTHSYTGDQRLLD  60

Query  598  ashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVS  419
            ASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVS
Sbjct  61   ASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVS  120

Query  418  KKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKV  239
            KKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKV
Sbjct  121  KKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKV  180

Query  238  IAWYDNEWGYSQRVVDLADIVANQWK  161
            IAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  181  IAWYDNEWGYSQRVVDLADIVANNWK  206



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score =   303 bits (777),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 200/250 (80%), Positives = 220/250 (88%), Gaps = 3/250 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  45   VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNAS  104

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  105  CTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  164

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L 
Sbjct  165  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLK  224

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  225  GVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  284

Query  175  ANQWK*MPAS  146
            AN+W   P +
Sbjct  285  ANKWPGTPQA  294



>gb|ABD37955.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Scherffelia 
dubia]
Length=390

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 192/242 (79%), Positives = 219/242 (90%), Gaps = 2/242 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVF+D EGAGKHI AGAKKV ITAP KG D+PTYV+GVN   Y+P  + I+SNAS
Sbjct  148  VIEGTGVFLDSEGAGKHITAGAKKVVITAPAKGKDVPTYVIGVNDKDYNPKTDHIVSNAS  207

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D+KFGI+KG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TG
Sbjct  208  CTTNCLAPFVKVVDEKFGIVKGMMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTG  267

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDG  353
            AAKAVALVLP LKGKLNG ALRVPTPNVSVVDLVVQV KKTFAEEVN AFR++AA  + G
Sbjct  268  AAKAVALVLPGLKGKLNGFALRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDAAAGPMKG  327

Query  352  ILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVA  173
            +L++ D PLVSVDFRC+DVS+TVD++LTMVMGDDMVK++AWYDNEWGYSQRVVDLA++VA
Sbjct  328  VLAITDIPLVSVDFRCTDVSTTVDAALTMVMGDDMVKIVAWYDNEWGYSQRVVDLAELVA  387

Query  172  NQ  167
             +
Sbjct  388  KK  389



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   306 bits (784),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 219/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  141  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEGDYSDEVSNIVSNAS  200

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  201  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  260

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+SA   L 
Sbjct  261  AAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKSAEGPLK  320

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  321  GILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  380

Query  175  ANQW  164
            A++W
Sbjct  381  ASKW  384



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   307 bits (786),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 220/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  177  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVADIISNAS  236

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  237  CTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  296

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L 
Sbjct  297  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLK  356

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L+VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  357  GVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  416

Query  175  ANQW  164
            AN+W
Sbjct  417  ANKW  420



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 219/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  148  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVADIISNAS  207

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  208  CTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  267

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L 
Sbjct  268  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLK  327

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L+VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  328  GVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  387

Query  175  ANQW  164
            AN W
Sbjct  388  ANNW  391



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 220/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  177  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVADIISNAS  236

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  237  CTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  296

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L 
Sbjct  297  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLK  356

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L+VCDEPLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  357  GVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  416

Query  175  ANQW  164
            AN+W
Sbjct  417  ANKW  420



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 218/246 (89%), Gaps = 3/246 (1%)
 Frame = -3

Query  877  GTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNASCTT  704
            GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  +   IISNASCTT
Sbjct  129  GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNASCTT  188

Query  703  NCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAK  524
            NCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK
Sbjct  189  NCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK  248

Query  523  AVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGIL  347
            AV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L
Sbjct  249  AVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAKGPLKGVL  308

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  167
             VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++
Sbjct  309  DVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  368

Query  166  WK*MPA  149
            W  MPA
Sbjct  369  WPGMPA  374



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 220/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  178  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  237

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPF K+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  238  CTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  297

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L+
Sbjct  298  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAADGPLN  357

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCDEPLVSVDFRCSDVS+T+DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA +V
Sbjct  358  GILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLV  417

Query  175  ANQW  164
            A++W
Sbjct  418  ADKW  421



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 216/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYV+GVN   YS +   IISNAS
Sbjct  185  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVMGVNEGDYSHEVANIISNAS  244

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKVLD+KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  245  CTTNCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  304

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+   KK   AE+VN AFRE+A   L 
Sbjct  305  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGLTAEDVNNAFREAANGPLK  364

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVS+DFRCSDVSSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  365  GILAVCDIPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  424

Query  175  ANQW  164
            A QW
Sbjct  425  AAQW  428



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score =   303 bits (777),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 189/243 (78%), Positives = 212/243 (87%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGD-IPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GA KHI AGA KV ITAP KGD IPTYV+GVNAD Y   + IISNASC
Sbjct  138  VIEGTGVFIDTPGASKHITAGASKVLITAPAKGDDIPTYVLGVNADGYKHSDKIISNASC  197

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTN LAPFVKV+D+KFG++KG MTTTHSYTGDQR+LDASHRDLRRARAA LNIVPTSTGA
Sbjct  198  TTNGLAPFVKVIDEKFGLVKGLMTTTHSYTGDQRILDASHRDLRRARAACLNIVPTSTGA  257

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQ SKK  A+EVNAAFRE+A   L GI
Sbjct  258  AKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKKCTADEVNAAFREAANGPLKGI  317

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+V DEPLVS DFRC+DVS T+D++LTMVMGDDM+KV++WYDNEWGYSQRVVDLA++ A 
Sbjct  318  LAVADEPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSWYDNEWGYSQRVVDLAELCAA  377

Query  169  QWK  161
             W+
Sbjct  378  NWE  380



>gb|ADB81491.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Klebsormidium 
flaccidum]
Length=314

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 192/224 (86%), Positives = 207/224 (92%), Gaps = 0/224 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGDIPTYVVGVNADAYSPDEPIISNASCT  707
            ++ GTGVFVD  GAGKH++AGAKKV ITAPGKG+IPTYVVGV+ + Y   E IISNASCT
Sbjct  91   VIEGTGVFVDEAGAGKHLQAGAKKVLITAPGKGNIPTYVVGVSEEKYKHSEAIISNASCT  150

Query  706  TNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAA  527
            TNCLAPFVKVLDQKFG+IKGTMTTTHSYTGDQRLLDASHRDLRRARAAAL+IVPTSTGAA
Sbjct  151  TNCLAPFVKVLDQKFGVIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALSIVPTSTGAA  210

Query  526  KAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGIL  347
            KAVALVLP LKGKLNGIALRVPTPNVSVVDLV+Q  KKTFAEEVN AFRE+A NEL GIL
Sbjct  211  KAVALVLPQLKGKLNGIALRVPTPNVSVVDLVIQTEKKTFAEEVNNAFREAANNELKGIL  270

Query  346  SVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEW  215
            +V DEPLVS+DFRCSDVSSTVDSSLTMV+GDDMVKV+AWYDNEW
Sbjct  271  AVNDEPLVSIDFRCSDVSSTVDSSLTMVLGDDMVKVVAWYDNEW  314



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 221/244 (91%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYV+GVN   YS +   I+SNAS
Sbjct  178  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVIGVNEQDYSHEVANIVSNAS  237

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPF K+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  238  CTTNCLAPFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  297

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L+
Sbjct  298  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLN  357

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCDEPLVSVDFRCSDVS+T+DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA +V
Sbjct  358  GILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLV  417

Query  175  ANQW  164
            A++W
Sbjct  418  ASKW  421



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 220/249 (88%), Gaps = 3/249 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  182  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNAS  241

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  242  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  301

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L 
Sbjct  302  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAKGPLK  361

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  362  GVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  421

Query  175  ANQWK*MPA  149
            A++W  MPA
Sbjct  422  ASKWPGMPA  430



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYV+GVN   YS +   IISNAS
Sbjct  45   VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNAS  104

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  105  CTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  164

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+   K    A++VNAAFR++AA  L 
Sbjct  165  AAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLS  224

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  225  GILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  284

Query  175  ANQW  164
            A++W
Sbjct  285  ASKW  288



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score =   303 bits (776),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 189/243 (78%), Positives = 212/243 (87%), Gaps = 1/243 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGD-IPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GA KHI AGA KV ITAP KGD IPTYV+GVNAD Y   + IISNASC
Sbjct  136  VIEGTGVFIDTPGASKHITAGASKVLITAPAKGDDIPTYVLGVNADGYKHSDKIISNASC  195

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTN LAPFVKV+D+KFG++KG MTTTHSYTGDQR+LDASHRDLRRARAA LNIVPTSTGA
Sbjct  196  TTNGLAPFVKVIDEKFGLVKGLMTTTHSYTGDQRILDASHRDLRRARAACLNIVPTSTGA  255

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVDLVVQ SKK  A+EVNAAFRE+A   L GI
Sbjct  256  AKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKKCTADEVNAAFREAANGPLKGI  315

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L+V DEPLVS DFRC+DVS T+D++LTMVMGDDM+KV++WYDNEWGYSQRVVDLA++ A 
Sbjct  316  LAVADEPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSWYDNEWGYSQRVVDLAELCAA  375

Query  169  QWK  161
             W+
Sbjct  376  NWE  378



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 220/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  180  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYSHEVANIVSNAS  239

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  240  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  299

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A+  L+
Sbjct  300  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAASGPLN  359

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  360  GILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  419

Query  175  ANQW  164
            A++W
Sbjct  420  ASKW  423



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   306 bits (783),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 202/249 (81%), Positives = 220/249 (88%), Gaps = 3/249 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  182  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNAS  241

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  242  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  301

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L 
Sbjct  302  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLK  361

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  362  GVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  421

Query  175  ANQWK*MPA  149
            A++W  MPA
Sbjct  422  ASKWPGMPA  430



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 219/248 (88%), Gaps = 3/248 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLK  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQWK*MP  152
            AN+W   P
Sbjct  419  ANKWPGTP  426



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS D   IISNAS
Sbjct  167  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHDVSDIISNAS  226

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKVLD++FGI KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  227  CTTNCLAPFVKVLDEEFGIEKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  286

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFA-EEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK  A E++N+AFR++A   L 
Sbjct  287  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGIAAEDINSAFRKAAEGPLK  346

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  347  GVLDVCDAPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  406

Query  175  ANQW  164
            AN+W
Sbjct  407  ANKW  410



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 220/248 (89%), Gaps = 3/248 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAAEGPLQ  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GILAVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQWK*MP  152
            A++W   P
Sbjct  419  ASKWPGTP  426



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   308 bits (788),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 219/248 (88%), Gaps = 3/248 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  D   IISNAS
Sbjct  253  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHDVADIISNAS  312

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  313  CTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  372

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L 
Sbjct  373  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAAEGPLK  432

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  433  GVLDVCDLPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  492

Query  175  ANQWK*MP  152
            AN+W   P
Sbjct  493  ANKWPGTP  500



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 219/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAAEGPLQ  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQW  164
            A++W
Sbjct  419  ASKW  422



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 220/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  177  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  236

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  237  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  296

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV + KK   AE+VNAAFR++A   L+
Sbjct  297  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISAEDVNAAFRKAADGPLN  356

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  357  GILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  416

Query  175  ANQW  164
            A++W
Sbjct  417  ASKW  420



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 220/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  177  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEVANIVSNAS  236

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  237  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  296

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L+
Sbjct  297  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRKAADGPLN  356

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  357  GILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  416

Query  175  ANQW  164
            A++W
Sbjct  417  ASKW  420



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   305 bits (781),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 202/250 (81%), Positives = 220/250 (88%), Gaps = 3/250 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  181  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNAS  240

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  241  CTTNCLAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  300

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+SA   L 
Sbjct  301  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKSAEGPLK  360

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  361  GVLEVCDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  420

Query  175  ANQWK*MPAS  146
            A++W  MP +
Sbjct  421  ASKWPGMPVA  430



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   305 bits (780),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 221/249 (89%), Gaps = 3/249 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVN-ADAYSPDEPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN  D +     I+SNAS
Sbjct  176  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYHHEASNIVSNAS  235

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  236  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  295

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR++A   L 
Sbjct  296  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKAAQGPLK  355

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  356  GILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  415

Query  175  ANQWK*MPA  149
            A++W  +PA
Sbjct  416  ASKWPGVPA  424



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   305 bits (780),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 199/248 (80%), Positives = 219/248 (88%), Gaps = 3/248 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   I+SNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYSHEVSNIVSNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKAANGPLK  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL VCD PLVSVDFRC+DVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GILDVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQWK*MP  152
            A++W  MP
Sbjct  419  ASKWPGMP  426



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   305 bits (780),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS     I+SNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYSHQVANIVSNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK++D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLK  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GILDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQW  164
            AN+W
Sbjct  419  ANEW  422



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   304 bits (779),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 218/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQGYSHEVSDIISNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLA  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQW  164
            A++W
Sbjct  419  ADKW  422



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 200/248 (81%), Positives = 218/248 (88%), Gaps = 3/248 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYV+GVN   Y  +   IISNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEVADIISNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPF KVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLK  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL VCD PLVSVDFRCSDVS+T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GILDVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQWK*MP  152
            AN+W   P
Sbjct  419  ANKWPGTP  426



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 199/244 (82%), Positives = 219/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  D   I+SNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHDVANIVSNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLK  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQW  164
            A++W
Sbjct  419  ASKW  422



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 201/250 (80%), Positives = 220/250 (88%), Gaps = 3/250 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  181  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIISNAS  240

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  241  CTTNCLAPFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  300

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L 
Sbjct  301  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLK  360

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  361  GVLEVCDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  420

Query  175  ANQWK*MPAS  146
            A++W  MP +
Sbjct  421  ASKWPGMPVA  430



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 200/249 (80%), Positives = 221/249 (89%), Gaps = 3/249 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVN-ADAYSPDEPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN  D +     I+SNAS
Sbjct  174  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYHHEASNIVSNAS  233

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  234  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  293

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR++A   L 
Sbjct  294  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKAAQGPLK  353

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  354  GILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  413

Query  175  ANQWK*MPA  149
            A++W  +PA
Sbjct  414  ASKWPGVPA  422



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 201/244 (82%), Positives = 218/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYV GVN   YS +   IISNAS
Sbjct  180  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVYGVNETDYSHEVANIISNAS  239

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKVLD+KFGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  240  CTTNCLAPFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  299

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L 
Sbjct  300  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRDAAEGPLK  359

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD+PLVSVDFRCSDVSST+DSSL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  360  GILAVCDDPLVSVDFRCSDVSSTIDSSLSMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  419

Query  175  ANQW  164
            A +W
Sbjct  420  AVKW  423



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 198/247 (80%), Positives = 214/247 (87%), Gaps = 3/247 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVF+D  GAGKHI AGAKKV ITAP KG +IPTYVVGVN   Y+ D   IISNAS
Sbjct  142  VIEGTGVFIDGPGAGKHIIAGAKKVLITAPAKGAEIPTYVVGVNEKDYTHDVSNIISNAS  201

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPF KVLD+ FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  202  CTTNCLAPFAKVLDENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  261

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+  +KK   AEEVNAAFR+ A   + 
Sbjct  262  AAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKEANGAMK  321

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+V D PLVS+DFRCSDVS T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIV
Sbjct  322  GILAVSDLPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIV  381

Query  175  ANQWK*M  155
            AN W  M
Sbjct  382  ANNWPGM  388



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 187/242 (77%), Positives = 213/242 (88%), Gaps = 1/242 (0%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKGD-IPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GA KH+ AGA KV ITAP KGD IPTYV+GVNAD Y   + IISNASC
Sbjct  136  VIEGTGVFIDTPGASKHLTAGASKVIITAPAKGDDIPTYVMGVNADDYKDSDKIISNASC  195

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTN LAPF KVLD  FGIIKG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGA
Sbjct  196  TTNGLAPFAKVLDDSFGIIKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGA  255

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGI  350
            AKAVALVLP LKGKLNGIALRVPTPNVSVVD+V+QV KK  AE+VNAAFRE+AA  + GI
Sbjct  256  AKAVALVLPQLKGKLNGIALRVPTPNVSVVDMVIQVEKKCTAEDVNAAFREAAAGPMKGI  315

Query  349  LSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  170
            L V DEPLVS+DFRC+DVS+++DS+LTMVMG+D+VK++AWYDNEWGYSQRVVDLA++ A+
Sbjct  316  LQVVDEPLVSIDFRCTDVSTSIDSALTMVMGEDLVKIVAWYDNEWGYSQRVVDLAELTAS  375

Query  169  QW  164
            +W
Sbjct  376  KW  377



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 200/250 (80%), Positives = 221/250 (88%), Gaps = 3/250 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  +   I+SNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYDHEVSNIVSNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLK  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQWK*MPAS  146
            A++W  +PA+
Sbjct  419  ASKWPGVPAA  428



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 219/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYV+GVN + Y  D   I+SNAS
Sbjct  174  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVLGVNEEGYDHDVANIVSNAS  233

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
             TTNCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  234  WTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  293

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+  +K    A++VNAAFR++AA  L+
Sbjct  294  AAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTAKTGITADDVNAAFRKAAAGPLN  353

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL VCDEPLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  354  GILDVCDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  413

Query  175  ANQW  164
            A++W
Sbjct  414  ASKW  417



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 219/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  D   I+SNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYGHDVANIVSNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLK  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQW  164
            A++W
Sbjct  419  ASKW  422



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 199/247 (81%), Positives = 218/247 (88%), Gaps = 3/247 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS D   IISNAS
Sbjct  178  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYSHDVANIISNAS  237

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK++D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  238  CTTNCLAPFVKIMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  297

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV + KK   AE+VN AFR++AA    
Sbjct  298  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNNAFRKAAAGPSK  357

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  358  GVLEVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  417

Query  175  ANQWK*M  155
            AN+W  M
Sbjct  418  ANKWPGM  424



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 219/244 (90%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  D   I+SNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYGHDVANIVSNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLK  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQW  164
            A++W
Sbjct  419  ASKW  422



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  178  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEIANIISNAS  237

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  238  CTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  297

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L 
Sbjct  298  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLK  357

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL VCD PLVSVDFRCSDVS+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA +V
Sbjct  358  GILDVCDAPLVSVDFRCSDVSATIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHLV  417

Query  175  ANQW  164
            A++W
Sbjct  418  ASKW  421



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYV+GVN   YS +   IISNAS
Sbjct  171  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNAS  230

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  231  CTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  290

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+   K    A++VNAAFR++AA  L 
Sbjct  291  AAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLS  350

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  351  GILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  410

Query  175  ANQW  164
            A++W
Sbjct  411  ASKW  414



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score =   303 bits (775),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKH++AGAKKV ITAP KG +IPTYVVGVN D Y  D   IISNAS
Sbjct  182  VIEGTGVFVDGPGAGKHLQAGAKKVLITAPAKGAEIPTYVVGVNEDQYDHDASAIISNAS  241

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TG
Sbjct  242  CTTNCLAPFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTG  301

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+   KK   A++VNAAFR++A   L+
Sbjct  302  AAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGITADQVNAAFRKAAEGPLN  361

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L+V D PLVS+DFRCSDVSST+DSSLTMVMGDDM+KV+AWYDNEWGYSQRVVDLA IV
Sbjct  362  GVLAVSDLPLVSIDFRCSDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHIV  421

Query  175  ANQW  164
            AN W
Sbjct  422  ANNW  425



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 199/248 (80%), Positives = 218/248 (88%), Gaps = 3/248 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y  +   IISNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYGHEVADIISNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLK  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEW YSQRVVDLA +V
Sbjct  359  GVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWDYSQRVVDLAHLV  418

Query  175  ANQWK*MP  152
            AN+W   P
Sbjct  419  ANKWPGTP  426



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   300 bits (767),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 197/244 (81%), Positives = 214/244 (88%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGA KV ITAP KG DIPTYVVGVN   YS D   IISNAS
Sbjct  95   VIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVVGVNEQDYSHDVANIISNAS  154

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPF KVLD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  155  CTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  214

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V KK   AE+VN AFR++AA  L 
Sbjct  215  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAAAGPLK  274

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVS DFRCSDVS+T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  275  GVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  334

Query  175  ANQW  164
            A +W
Sbjct  335  AAKW  338



>ref|XP_002507103.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
 gb|ACO68361.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
Length=405

 Score =   301 bits (770),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 191/240 (80%), Positives = 212/240 (88%), Gaps = 2/240 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPDEPIISNASC  710
            ++ GTGVF+D  GAGKHI+AGAKKV ITAP KG DIPTYVVGVNAD Y P   I+SNASC
Sbjct  135  VIEGTGVFLDGPGAGKHIQAGAKKVVITAPAKGNDIPTYVVGVNADQYDPSANIVSNASC  194

Query  709  TTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGA  530
            TTNCLAPF KVLD+KFGIIKGTMTT HSYTGDQR+LDASHRDLRRARAAALNIVPTSTGA
Sbjct  195  TTNCLAPFAKVLDEKFGIIKGTMTTCHSYTGDQRILDASHRDLRRARAAALNIVPTSTGA  254

Query  529  AKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKK-TFAEEVNAAFRESAANELDG  353
            AKAVALVLP LKGKLNGIALRVPTPNVS+VDLV  V KK   AEEVNAAF+E+A   + G
Sbjct  255  AKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVCNVEKKGVTAEEVNAAFKEAADGPMKG  314

Query  352  ILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVA  173
            +L++ + PLVSVDFRCSDVS+T+D++LTMVMGDDMVKV+AWYDNEWGY+QRVVDL  IVA
Sbjct  315  VLAITETPLVSVDFRCSDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVVDLTHIVA  374



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   302 bits (773),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 200/244 (82%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   YS +   IISNAS
Sbjct  178  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEQDYSHEIANIISNAS  237

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++ GI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  238  CTTNCLAPFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  297

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L 
Sbjct  298  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLK  357

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  358  GILDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  417

Query  175  ANQW  164
            A++W
Sbjct  418  ASKW  421



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   302 bits (773),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 196/244 (80%), Positives = 218/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYV+GVN   YS +   IISNAS
Sbjct  171  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVLGVNEGDYSHEVANIISNAS  230

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  231  CTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  290

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAVALVLP LKGKLNGIALRVPTPNVSVVDLV+   K    A++VNAAFR++A+  L+
Sbjct  291  AAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAASGPLN  350

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  351  GILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  410

Query  175  ANQW  164
            A++W
Sbjct  411  ASKW  414



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score =   302 bits (773),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 198/244 (81%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYVVGVN   Y+     IISNAS
Sbjct  181  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEGDYTHQISNIISNAS  240

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVK+LD++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  241  CTTNCLAPFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  300

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L 
Sbjct  301  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLK  360

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            G+L VCD PLVS+DFRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  361  GVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  420

Query  175  ANQW  164
            A++W
Sbjct  421  ASKW  424



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   302 bits (773),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 220/248 (89%), Gaps = 3/248 (1%)
 Frame = -3

Query  886  LLRGTGVFVDREGAGKHIEAGAKKVXITAPGKG-DIPTYVVGVNADAYSPD-EPIISNAS  713
            ++ GTGVFVD  GAGKHI+AGAKKV ITAP KG DIPTYV+GVN   Y+ +   I+SNAS
Sbjct  179  VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVLGVNEGDYNHEVANIVSNAS  238

Query  712  CTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTG  533
            CTTNCLAPFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG
Sbjct  239  CTTNCLAPFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG  298

Query  532  AAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELD  356
            AAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR++A   L 
Sbjct  299  AAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKAADGPLK  358

Query  355  GILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIV  176
            GIL+VCD PLVSVDFRC+DVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +V
Sbjct  359  GILAVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV  418

Query  175  ANQWK*MP  152
            A++W  MP
Sbjct  419  ASKWPGMP  426



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1995669393600