BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038B20

Length=833
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    332   1e-107   Populus euphratica
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    330   3e-107   Populus euphratica
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    329   9e-107   Populus trichocarpa [western balsam poplar]
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             328   1e-106   
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             329   2e-106   
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    328   4e-106   
gb|KJB14201.1|  hypothetical protein B456_002G114000                    327   1e-105   Gossypium raimondii
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    326   1e-105   Gossypium arboreum [tree cotton]
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    326   2e-105   Tarenaya hassleriana [spider flower]
gb|KJB57938.1|  hypothetical protein B456_009G186400                    324   2e-105   Gossypium raimondii
emb|CDP07271.1|  unnamed protein product                                325   5e-105   Coffea canephora [robusta coffee]
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    325   6e-105   Gossypium arboreum [tree cotton]
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    324   8e-105   
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    324   8e-105   
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    324   8e-105   
gb|ACU20783.1|  unknown                                                 324   9e-105   Glycine max [soybeans]
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    324   9e-105   Glycine soja [wild soybean]
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    323   2e-104   Malus domestica [apple tree]
gb|KJB57936.1|  hypothetical protein B456_009G186400                    323   2e-104   Gossypium raimondii
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    322   4e-104   
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    323   4e-104   Pyrus x bretschneideri [bai li]
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    322   4e-104   Populus euphratica
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    322   6e-104   Camelina sativa [gold-of-pleasure]
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    322   7e-104   Sesamum indicum [beniseed]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              322   8e-104   Pyrus x bretschneideri [bai li]
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    322   8e-104   Nicotiana tomentosiformis
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    322   9e-104   Nicotiana sylvestris
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         322   9e-104   Jatropha curcas
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    322   1e-103   Nelumbo nucifera [Indian lotus]
ref|NP_001240080.1|  uncharacterized protein LOC100806482               321   1e-103   Glycine max [soybeans]
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    321   1e-103   Glycine max [soybeans]
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    321   2e-103   Prunus mume [ume]
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    320   2e-103   
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    320   2e-103   Pyrus x bretschneideri [bai li]
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    320   3e-103   Nicotiana sylvestris
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    320   3e-103   Nicotiana tomentosiformis
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      318   4e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    320   4e-103   Elaeis guineensis
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    320   4e-103   Citrus sinensis [apfelsine]
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    320   5e-103   Ricinus communis
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             320   5e-103   Capsella rubella
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            319   5e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             319   8e-103   Citrus clementina [clementine]
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              319   9e-103   Scoparia dulcis [escobilla]
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    319   9e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              314   1e-102   Medicago truncatula
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    318   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    318   1e-102   Fragaria vesca subsp. vesca
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             318   1e-102   Phaseolus vulgaris [French bean]
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    317   1e-102   Camelina sativa [gold-of-pleasure]
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    318   2e-102   Vitis vinifera
emb|CAN69459.1|  hypothetical protein VITISV_021576                     318   2e-102   Vitis vinifera
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    318   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             318   2e-102   Prunus persica
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    318   2e-102   Arabis alpina [alpine rockcress]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    317   3e-102   Brassica rapa
emb|CDY69523.1|  BnaC08g46180D                                          316   4e-102   Brassica napus [oilseed rape]
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           317   7e-102   Medicago truncatula
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              313   1e-101   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    316   1e-101   Phoenix dactylifera
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             315   2e-101   Eutrema salsugineum [saltwater cress]
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               315   2e-101   Solanum tuberosum [potatoes]
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    315   3e-101   Solanum tuberosum [potatoes]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    315   4e-101   Pisum sativum [garden pea]
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    314   8e-101   
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    316   8e-101   Cicer arietinum [garbanzo]
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    314   9e-101   Solanum lycopersicum
gb|ACJ84309.1|  unknown                                                 314   9e-101   Medicago truncatula
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    313   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS70760.1|  hypothetical protein M569_03997                         312   2e-100   Genlisea aurea
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    308   3e-100   Oryza sativa Japonica Group [Japonica rice]
emb|CAA33262.1|  unnamed protein product                                311   9e-100   Pisum sativum [garden pea]
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    310   2e-99    
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    310   2e-99    Cucumis sativus [cucumbers]
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    310   2e-99    
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    310   2e-99    Cucumis melo [Oriental melon]
dbj|BAJ86633.1|  predicted protein                                      310   3e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             309   4e-99    
ref|NP_001048847.1|  Os03g0129300                                       309   4e-99    
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             309   4e-99    Selaginella moellendorffii
dbj|BAJ87214.1|  predicted protein                                      308   1e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    308   1e-98    
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    308   2e-98    Triticum urartu
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    308   2e-98    Eucalyptus grandis [rose gum]
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   1e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          304   2e-97    
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         320   2e-96    
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    292   2e-93    Spinacia oleracea
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    294   4e-93    Spinacia oleracea
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           295   4e-93    
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               290   5e-91    Chara vulgaris
gb|KGN49135.1|  hypothetical protein Csa_6G514950                       278   3e-90    Cucumis sativus [cucumbers]
gb|ABK24645.1|  unknown                                                 287   3e-90    Picea sitchensis
gb|ACN40006.1|  unknown                                                 287   3e-90    Picea sitchensis
gb|ACN40526.1|  unknown                                                 287   3e-90    Picea sitchensis
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    286   5e-90    
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    286   6e-90    
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      283   1e-88    Chlorokybus atmophyticus
ref|XP_002540513.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    273   2e-88    Ricinus communis
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               277   3e-86    Marchantia polymorpha
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      275   5e-86    Mesostigma viride
gb|ABF74607.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    266   7e-86    Agave tequilana
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    273   7e-86    Spinacia oleracea
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    272   7e-85    Nicotiana tabacum [American tobacco]
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    269   3e-84    Mesostigma viride
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   2e-81    Setaria italica
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           259   6e-80    Bathycoccus prasinos
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             256   4e-79    Micromonas pusilla CCMP1545
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         255   1e-78    Micromonas commoda
ref|XP_001415434.1|  predicted protein                                  255   1e-78    Ostreococcus lucimarinus CCE9901
gb|ABS72003.1|  putative chloroplast glyceradehyde-3-phosphate de...    245   5e-78    Olea europaea
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    250   2e-76    Ostreococcus tauri
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    248   2e-75    Ostreococcus tauri
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    248   2e-75    
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    243   6e-75    Chlorokybus atmophyticus
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    244   1e-74    Marchantia polymorpha
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...    239   1e-74    Sinapis alba [bai jie]
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               244   3e-74    Marchantia polymorpha
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   3e-74    
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      242   5e-74    Chlorokybus atmophyticus
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     241   6e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   6e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   8e-74    Camelina sativa [gold-of-pleasure]
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase                238   2e-73    Mesostigma viride
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    240   2e-73 
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   3e-73    Brassica rapa
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              242   3e-73    Medicago truncatula
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    238   3e-73    Mesostigma viride
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    239   3e-73    Spinacia oleracea
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   3e-73    Camelina sativa [gold-of-pleasure]
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             241   3e-73    Selaginella moellendorffii
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   4e-73    Camelina sativa [gold-of-pleasure]
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase                237   4e-73    Mesostigma viride
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             240   1e-72    Selaginella moellendorffii
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    238   1e-72    Spinacia oleracea
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    238   1e-72    Spinacia oleracea
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    238   1e-72    Spinacia oleracea
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      237   2e-72    Mesostigma viride
dbj|BAK02737.1|  predicted protein                                      236   2e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   2e-72    
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     238   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             237   2e-72    
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             239   2e-72    Nicotiana benthamiana
gb|EPS59235.1|  hypothetical protein M569_15573                         239   3e-72    Genlisea aurea
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   3e-72    Nicotiana sylvestris
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   3e-72    Camelina sativa [gold-of-pleasure]
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   3e-72    Nicotiana tomentosiformis
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   3e-72    Camelina sativa [gold-of-pleasure]
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        239   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             239   3e-72    Eutrema salsugineum [saltwater cress]
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   3e-72    Brassica rapa
ref|XP_002892719.1|  GAPA-2                                             238   3e-72    Arabidopsis lyrata subsp. lyrata
emb|CDY19412.1|  BnaC05g09210D                                          238   4e-72    Brassica napus [oilseed rape]
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             238   4e-72    
gb|AAG23800.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    231   4e-72    Cucurbita pepo
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              236   4e-72    Brassica rapa subsp. chinensis [bok-choy]
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    238   4e-72    Spinacia oleracea
gb|KJB11770.1|  hypothetical protein B456_001G276400                    235   4e-72    Gossypium raimondii
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    237   5e-72    Micromonas commoda
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   238   7e-72    Citrus sinensis [apfelsine]
emb|CDY16038.1|  BnaC08g40850D                                          238   8e-72    Brassica napus [oilseed rape]
emb|CDY26599.1|  BnaA09g46780D                                          238   9e-72    Brassica napus [oilseed rape]
emb|CDX83635.1|  BnaC07g23750D                                          236   1e-71    
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   1e-71    Eucalyptus grandis [rose gum]
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    237   1e-71    Glycine soja [wild soybean]
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   1e-71    Brachypodium distachyon [annual false brome]
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    237   1e-71    Glycine soja [wild soybean]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    237   1e-71    
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    237   1e-71    Arabis alpina [alpine rockcress]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             237   1e-71    Eutrema salsugineum [saltwater cress]
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    237   2e-71    Arabis alpina [alpine rockcress]
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   2e-71    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    237   2e-71    Brassica rapa
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   2e-71    Brassica rapa
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   3e-71    Camelina sativa [gold-of-pleasure]
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   3e-71    Solanum tuberosum [potatoes]
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   3e-71    Camelina sativa [gold-of-pleasure]
dbj|BAH57068.1|  AT1G12900                                              234   3e-71    Arabidopsis thaliana [mouse-ear cress]
emb|CDY13649.1|  BnaA06g32740D                                          235   4e-71    Brassica napus [oilseed rape]
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    234   4e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             235   4e-71    Micromonas pusilla CCMP1545
gb|KIY93372.1|  NADP-dependent glyceraldehydephosphatedehydrogena...    228   4e-71    Monoraphidium neglectum
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   4e-71    
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    236   4e-71    Ricinus communis
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             236   5e-71    Phaseolus vulgaris [French bean]
gb|ACU21011.1|  unknown                                                 236   5e-71    Glycine max [soybeans]
emb|CDY28536.1|  BnaC02g36240D                                          235   5e-71    Brassica napus [oilseed rape]
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                235   5e-71    Syntrichia caninervis
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               233   5e-71    Brassica rapa subsp. chinensis [bok-choy]
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      234   6e-71    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ90530.1|  predicted protein                                      235   6e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   7e-71    Nelumbo nucifera [Indian lotus]
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   7e-71    Solanum lycopersicum
dbj|BAJ90885.1|  predicted protein                                      235   8e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    235   8e-71    Arabidopsis thaliana [mouse-ear cress]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                235   8e-71    Arabidopsis thaliana [mouse-ear cress]
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      233   8e-71    Spirogyra sp. SAG 170.80
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   8e-71    
ref|XP_002875330.1|  gapa                                               235   8e-71    Arabidopsis lyrata subsp. lyrata
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    235   9e-71    
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         235   1e-70    Jatropha curcas
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               234   1e-70    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_001771209.1|  predicted protein                                  234   1e-70    
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          234   1e-70    Chlamydomonas sp. W80
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    234   2e-70    
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              233   2e-70    Volvox carteri f. nagariensis
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    234   2e-70    Oryza brachyantha
ref|XP_001771246.1|  predicted protein                                  234   3e-70    
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             233   3e-70    Capsella rubella
gb|KJB11771.1|  hypothetical protein B456_001G276400                    233   3e-70    Gossypium raimondii
gb|KJB70724.1|  hypothetical protein B456_011G088800                    230   3e-70    Gossypium raimondii
ref|XP_001779769.1|  predicted protein                                  233   4e-70    
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           232   4e-70    Chlamydomonas reinhardtii
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               230   5e-70    Capsicum annuum
dbj|BAJ34149.1|  unnamed protein product                                233   6e-70    Eutrema halophilum
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   6e-70    Fragaria vesca subsp. vesca
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    232   6e-70    Ostreococcus tauri
emb|CDY48981.1|  BnaA02g28150D                                          232   7e-70    Brassica napus [oilseed rape]
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    232   7e-70    
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      228   8e-70    Spermatozopsis similis
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    230   9e-70    Miscanthus sinensis
ref|XP_001779753.1|  predicted protein                                  232   1e-69    
ref|XP_001753934.1|  predicted protein                                  232   1e-69    
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     231   1e-69    Physcomitrella patens
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    231   1e-69    Chlamydomonas incerta
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    232   1e-69    Setaria italica
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     229   1e-69    Physcomitrella patens
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                232   2e-69    Arachis hypogaea [goober]
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   2e-69    
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    231   2e-69    Marchantia polymorpha
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         231   2e-69    
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           230   3e-69    Bathycoccus prasinos
ref|XP_001766703.1|  predicted protein                                  230   3e-69    
emb|CAA30152.1|  GADPH (383 AA)                                         231   3e-69    Zea mays [maize]
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    231   3e-69    Zea mays [maize]
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   5e-69    Pyrus x bretschneideri [bai li]
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    230   5e-69    Theobroma cacao [chocolate]
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    230   7e-69    Pyrus x bretschneideri [bai li]
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    230   7e-69    Malus domestica [apple tree]
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    230   7e-69    Malus domestica [apple tree]
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             230   8e-69    Prunus persica
ref|NP_001052984.1|  Os04g0459500                                       230   8e-69    
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    230   8e-69    Prunus mume [ume]
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    229   1e-68    Botryococcus braunii
gb|KJB70723.1|  hypothetical protein B456_011G088800                    229   2e-68    Gossypium raimondii
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    229   2e-68    Auxenochlorella protothecoides
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         228   3e-68    Morus notabilis
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      226   4e-68    Chlorella sp. JP-2005
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      227   4e-68    Cladophora rupestris
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       228   7e-68    Medicago sativa [alfalfa]
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   7e-68    Cicer arietinum [garbanzo]
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         227   8e-68    Medicago truncatula
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                227   8e-68    Bruguiera gymnorhiza [Burma mangrove]
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    227   1e-67    Pyrus x bretschneideri [bai li]
emb|CAA33264.1|  unnamed protein product                                227   1e-67    Pisum sativum [garden pea]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    227   1e-67    Pisum sativum [garden pea]
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                226   2e-67    Vicia sativa [spring vetch]
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    225   4e-67    Ostreococcus sp. 'lucimarinus'
ref|XP_001420043.1|  predicted protein                                  224   4e-67    Ostreococcus lucimarinus CCE9901
gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase                218   7e-67    Helianthus annuus
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase                218   7e-67    Helianthus annuus
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              224   8e-67    Phaseolus vulgaris [French bean]
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   1e-66    Tarenaya hassleriana [spider flower]
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      223   2e-66    Scherffelia dubia
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase                218   2e-66    Helianthus annuus
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase                218   3e-66    Helianthus annuus
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               220   4e-66    Coleochaete scutata
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    221   4e-66    
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase                216   1e-65    Helianthus annuus
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          221   2e-65    Amborella trichopoda
gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                   217   3e-65    Citrus sinensis [apfelsine]
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               218   4e-65    Sphagnum cuspidatum
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              220   5e-65    Scoparia dulcis [escobilla]
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    218   7e-65    Chamaesiphon minutus
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   8e-65    Tarenaya hassleriana [spider flower]
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   8e-65    Sesamum indicum [beniseed]
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                217   1e-64    Lilium regale
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                220   3e-64    Erythranthe guttata [common monkey flower]
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           217   4e-64    Coccomyxa subellipsoidea C-169
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    218   5e-64    
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    216   5e-64    
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      218   5e-64    
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                217   6e-64    
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    217   7e-64    
gb|ACN39951.1|  unknown                                                 214   9e-64    
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    217   9e-64    
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  217   1e-63    
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    216   1e-63    
gb|ABK25233.1|  unknown                                                 216   1e-63    
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             216   1e-63    
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   1e-63    
gb|ACN40537.1|  unknown                                                 216   1e-63    
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                215   2e-63    
gb|ABK96233.1|  unknown                                                 216   2e-63    
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   2e-63    
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             216   2e-63    
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    211   2e-63    
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               213   3e-63    
gb|ABK96725.1|  unknown                                                 216   3e-63    
gb|ABK94956.1|  unknown                                                 215   3e-63    
gb|ERT05629.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        212   4e-63    
gb|ACN40000.1|  unknown                                                 215   6e-63    
gb|ABK24313.1|  unknown                                                 215   6e-63    
dbj|BAD93961.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit     207   6e-63    
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             214   9e-63    
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    214   1e-62    
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      211   1e-62    
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             214   1e-62    
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    215   1e-62    
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase           212   2e-62    
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    213   2e-62    
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   2e-62    
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   2e-62    
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   2e-62    
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   2e-62    
gb|ADB81490.1|  glyceraldehyde-3-phosphate dehydrogenase                206   2e-62    
emb|CAN78872.1|  hypothetical protein VITISV_021726                     213   2e-62    
dbj|BAK05515.1|  predicted protein                                      204   3e-62    
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   3e-62    
gb|AGJ50596.1|  GAPDH                                                   213   3e-62    
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   3e-62    
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase           211   4e-62    
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   4e-62    
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+         211   4e-62    
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase           210   6e-62    
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    212   7e-62    
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    212   7e-62    
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    211   9e-62    
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                209   1e-61    
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    211   1e-61    
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    211   2e-61    
gb|ADB81483.1|  glyceraldehyde-3-phosphate dehydrogenase                203   2e-61    
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           207   1e-60    
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    207   1e-60    
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           207   1e-60    
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [         206   2e-60    
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2              204   2e-60    
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    206   2e-60    
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               205   3e-60    
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                205   4e-60    
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    205   5e-60    
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase           205   6e-60    
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    205   7e-60    
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase           205   7e-60    
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   207   8e-60    
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           204   9e-60    
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    205   1e-59    
gb|AHJ31016.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    202   1e-59    
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    204   1e-59    
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    204   1e-59    
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           204   1e-59    
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           204   1e-59    
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         204   1e-59    
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase           204   1e-59    
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           204   1e-59    
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             204   2e-59    
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           204   2e-59    
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           204   2e-59    
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             204   2e-59    
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    204   2e-59    
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             204   2e-59    
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase           204   2e-59    
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    205   3e-59    
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           203   4e-59    
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase    203   4e-59    
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    203   4e-59    
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           203   4e-59    
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    202   4e-59    
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           202   4e-59    
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           202   5e-59    
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           202   5e-59    
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           202   5e-59    
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    202   5e-59    
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           202   5e-59    
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           202   6e-59    
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           202   6e-59    
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             203   7e-59    
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           202   7e-59    
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    202   7e-59    
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           202   8e-59    
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           202   9e-59    
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           201   1e-58    
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase           201   1e-58    
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    201   1e-58    
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    201   1e-58    
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        202   1e-58    
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           201   1e-58    
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase           201   1e-58    
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           201   1e-58    
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    200   2e-58    
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    201   2e-58    
gb|ADB81480.1|  glyceraldehyde-3-phosphate dehydrogenase                195   2e-58    
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           201   3e-58    
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    201   3e-58    
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase           201   3e-58    
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           201   3e-58    
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           201   3e-58    
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase           200   3e-58    
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    202   4e-58    
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           202   4e-58    
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           200   4e-58    
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    200   5e-58    
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           200   5e-58    
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           200   5e-58    
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           200   5e-58    
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase           200   5e-58    
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase                200   6e-58    
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               199   6e-58    
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           199   7e-58    
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        199   7e-58    
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    199   7e-58    
gb|ADB81495.1|  glyceraldehyde-3-phosphate dehydrogenase                194   8e-58    
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    199   8e-58    
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    199   8e-58    
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                199   9e-58    
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    199   9e-58    
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           199   1e-57    
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           199   1e-57    
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    199   1e-57    
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    201   1e-57    
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...    199   1e-57    
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    199   2e-57    
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    199   2e-57    
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           198   2e-57    
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           198   2e-57    
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           198   2e-57    
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    198   2e-57    
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    198   2e-57    
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           198   3e-57    
ref|WP_042341685.1|  glyceraldehyde-3-phosphate dehydrogenase           198   3e-57    
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    198   3e-57    
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           198   3e-57    
gb|EDX87031.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        197   3e-57    
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        197   4e-57    
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           197   5e-57    
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    197   6e-57    
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           197   6e-57    
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           197   6e-57    
gb|AFY30551.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        197   8e-57    
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           197   8e-57    
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    197   9e-57    
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase               197   9e-57    
gb|ABY20971.1|  glyceraldehyde-3-phosphate dehydrogenase A subunit      190   9e-57    
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           197   1e-56    
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase               195   1e-56    
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           196   1e-56    
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           196   1e-56    
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           196   1e-56    
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    196   1e-56    
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           196   1e-56    
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           196   1e-56    
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           196   1e-56    
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   199   2e-56    
dbj|BAN09110.1|  glyceraldehyde-3-phosphate dehydrogenase               193   2e-56    
ref|WP_007133015.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    196   2e-56    
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    196   3e-56    
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase           195   3e-56    
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    195   3e-56    
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           195   4e-56    
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    195   5e-56    
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase                193   8e-56    
emb|CDP18560.1|  unnamed protein product                                195   9e-56    
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           194   1e-55    
dbj|GAK42869.1|  glyceraldehyde-3-phosphate dehydrogenase               194   1e-55    
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    194   1e-55    
gb|AAG23799.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    188   1e-55    
gb|ADB81481.1|  glyceraldehyde-3-phosphate dehydrogenase                188   1e-55    
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    194   1e-55    
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           193   2e-55    
ref|WP_009593640.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    193   2e-55    
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           193   2e-55    
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           193   3e-55    
ref|WP_016423763.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    192   3e-55    
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                192   5e-55    
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    192   5e-55    
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase           192   7e-55    
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase           191   9e-55    
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase           191   1e-54    
gb|AAM68969.1|AF406629_1  glyceraldehyde-3-phosphate dehydrogenase      186   2e-54    
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase           191   2e-54    
gb|ADB81482.1|  glyceraldehyde-3-phosphate dehydrogenase                185   2e-54    
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase                191   2e-54    
ref|WP_036655810.1|  glyceraldehyde-3-phosphate dehydrogenase           190   2e-54    
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase           192   3e-54    
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase                193   3e-54    
ref|WP_012818436.1|  glyceraldehyde-3-phosphate dehydrogenase           189   5e-54    
ref|WP_010272964.1|  glyceraldehyde-3-phosphate dehydrogenase           189   6e-54    
ref|WP_006207583.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    189   7e-54    
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    189   8e-54    
ref|WP_039728353.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    189   8e-54    
ref|WP_042118357.1|  glyceraldehyde-3-phosphate dehydrogenase           189   9e-54    
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase                188   9e-54    
gb|AHD04124.1|  glyceraldehyde-3-phosphate dehydrogenase Gap            189   1e-53    
gb|ADB81493.1|  glyceraldehyde-3-phosphate dehydrogenase                183   1e-53    
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           188   1e-53    
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    188   2e-53    
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase           188   2e-53    
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    188   2e-53    
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase           188   2e-53    
ref|WP_038262010.1|  glyceraldehyde-3-phosphate dehydrogenase [         188   2e-53    



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 196/207 (95%), Positives = 204/207 (99%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVASKWPGV
Sbjct  366  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  426  AAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   330 bits (847),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 195/207 (94%), Positives = 203/207 (98%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA++GPLKGVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVASKWPGV
Sbjct  366  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  426  AAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   329 bits (844),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 194/207 (94%), Positives = 203/207 (98%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA++GPLKGVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPGV
Sbjct  366  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVANKWPGV  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  426  AAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 194/207 (94%), Positives = 203/207 (98%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  215  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  274

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA++GPLKGVLDVCD
Sbjct  275  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKAAEGPLKGVLDVCD  334

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPGV
Sbjct  335  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVANKWPGV  394

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  395  AAAGSGDPLEDFCKTNPADEECKVYEA  421



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 195/207 (94%), Positives = 203/207 (98%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  268  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  327

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVLDVCD
Sbjct  328  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDVCD  387

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDL HLVASKWPGV
Sbjct  388  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLGHLVASKWPGV  447

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  448  AAAGSGDPLEDFCKTNPADEECKVYEA  474



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   328 bits (840),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 195/207 (94%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV
Sbjct  366  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
              AGS DPLED+CKTNP D+ECKV+EA
Sbjct  426  PAAGSADPLEDFCKTNPADEECKVYEA  452



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 194/207 (94%), Positives = 204/207 (99%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  248  PFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  307

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRK+++GPLKGVL+VCD
Sbjct  308  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKSAEGPLKGVLEVCD  367

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+
Sbjct  368  IPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGM  427

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
             VAGSGDPLEDYCKTNP D+ECKV+EA
Sbjct  428  PVAGSGDPLEDYCKTNPADEECKVYEA  454



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 194/207 (94%), Positives = 203/207 (98%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  248  PFVKVIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  307

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVL+VCD
Sbjct  308  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLEVCD  367

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+
Sbjct  368  IPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGM  427

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
             VAGSGDPLEDYCK NP D+ECKV+EA
Sbjct  428  PVAGSGDPLEDYCKANPADEECKVYEA  454



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 194/207 (94%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  247  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  306

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA+ GPL G+LDVCD
Sbjct  307  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAASGPLNGILDVCD  366

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  367  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  426

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A   SGDPLED+C+TNP DKECKVFEA
Sbjct  427  AAGSSGDPLEDFCETNPADKECKVFEA  453



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 193/207 (93%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  193  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  252

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+ GPLKGVLDVCD
Sbjct  253  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAKGPLKGVLDVCD  312

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+
Sbjct  313  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGM  372

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
               GS DPLED+CKTNP D+ECKV+EA
Sbjct  373  PAGGSSDPLEDFCKTNPADEECKVYEA  399



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 192/207 (93%), Positives = 203/207 (98%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  252  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  311

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+K+GLTAEDVNAAFRKA+DGPLKG+LDVCD
Sbjct  312  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKRGLTAEDVNAAFRKAADGPLKGILDVCD  371

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
            APLVSVDF+C+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+
Sbjct  372  APLVSVDFKCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGL  431

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
             + GSGDPLEDYCKTN  D+ECKV+EA
Sbjct  432  FIDGSGDPLEDYCKTNAADEECKVYEA  458



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   325 bits (832),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 193/207 (93%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  249  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  308

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVLDVCD
Sbjct  309  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDVCD  368

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+
Sbjct  369  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGM  428

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
               GS DPLED+CKTNP D+ECKV+EA
Sbjct  429  PAGGSSDPLEDFCKTNPADEECKVYEA  455



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 202/206 (98%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  248  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  307

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDVCD
Sbjct  308  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDVCD  367

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  368  VPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  427

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  428  AKAGSGDPLEEFCETNPADEECKVYE  453



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 202/206 (98%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  366  VPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  426  AKAGSGDPLEEFCETNPADEECKVYE  451



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 202/206 (98%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  245  PFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  304

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+DGPLKG+LDVCD
Sbjct  305  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILDVCD  364

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
            APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV
Sbjct  365  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  424

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            A  GSGDPL+++C+TNP D+ECKV+E
Sbjct  425  AAPGSGDPLDEFCETNPSDEECKVYE  450



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score =   324 bits (831),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 202/206 (98%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  247  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  306

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDVCD
Sbjct  307  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDVCD  366

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  367  VPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGT  426

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  427  AKAGSGDPLEEFCETNPADEECKVYE  452



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score =   324 bits (830),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 202/206 (98%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  247  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  306

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDVCD
Sbjct  307  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDVCD  366

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  367  VPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  426

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  427  AKAGSGDPLEEFCETNPADEECKVYE  452



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 190/207 (92%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            AVAGSGDPLED+C+TNP D+ECKV+EA
Sbjct  426  AVAGSGDPLEDFCQTNPADEECKVYEA  452



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 193/207 (93%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  249  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  308

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+ GPLKGVLDVCD
Sbjct  309  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAKGPLKGVLDVCD  368

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+
Sbjct  369  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGM  428

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
               GS DPLED+CKTNP D+ECKV+EA
Sbjct  429  PAGGSSDPLEDFCKTNPADEECKVYEA  455



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   322 bits (826),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 202/206 (98%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  245  PFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  304

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+DGPLKG+LDVCD
Sbjct  305  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILDVCD  364

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
            APLVSVDFRCSDVS+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLAHLVASKWPGV
Sbjct  365  APLVSVDFRCSDVSATIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHLVASKWPGV  424

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            A  GSGDPL+++C+TNP D+ECKV+E
Sbjct  425  AAPGSGDPLDEFCETNPSDEECKVYE  450



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   323 bits (827),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 191/207 (92%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGT  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  426  AQAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   322 bits (826),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 194/207 (94%), Positives = 202/207 (98%), Gaps = 2/207 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKGVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGY  RVVDLAHLVASKWPGV
Sbjct  366  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGY--RVVDLAHLVASKWPGV  423

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  424  AAAGSGDPLEDFCKTNPADEECKVYEA  450



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  242  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  301

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDVCD
Sbjct  302  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDVCD  361

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
            APLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  362  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGE  421

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               G+GDPLED+C+TNPGD+ECKVFE
Sbjct  422  KAVGTGDPLEDFCQTNPGDEECKVFE  447



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   322 bits (825),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 191/207 (92%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPL GVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLAGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG 
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVADKWPGA  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
               GSGDPLED+CKTNP D+ECKV+EA
Sbjct  426  TAEGSGDPLEDFCKTNPADEECKVYEA  452



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   322 bits (824),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            AV GSGDPLED+C+TNP D+ECKV+EA
Sbjct  426  AVVGSGDPLEDFCQTNPADEECKVYEA  452



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   322 bits (824),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  244  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  303

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFRKA+DGPL G+L VCD
Sbjct  304  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRKAADGPLNGILAVCD  363

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  364  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGS  423

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            +V GSGD LEDYCKTNP DKECKV+E
Sbjct  424  SVEGSGDSLEDYCKTNPADKECKVYE  449



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  244  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  303

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++AEDVNAAFRKA+DGPL G+L VCD
Sbjct  304  VLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISAEDVNAAFRKAADGPLNGILAVCD  363

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  364  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGS  423

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            +V GSGD LEDYCKTNP DKECKV+E
Sbjct  424  SVEGSGDALEDYCKTNPADKECKVYE  449



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+DGPLKG+LDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA++WPGV
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANEWPGV  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A  GSGDPLE++C+ NP D+ECKV+EA
Sbjct  426  AATGSGDPLEEFCEKNPADEECKVYEA  452



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKG+L VCD
Sbjct  306  VLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  366  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A +GSGDPLED+CKTNP D+ECKV+EA
Sbjct  426  AASGSGDPLEDFCKTNPADEECKVYEA  452



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   321 bits (822),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++D EFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKILDAEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  366  VPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
              AGSGDPLED+C+TNP D+ECKV+E
Sbjct  426  PKAGSGDPLEDFCETNPADEECKVYE  451



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   321 bits (822),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 190/206 (92%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++D EFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  247  PFVKILDAEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  306

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKGVLDVCD
Sbjct  307  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDVCD  366

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  367  VPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  426

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
              AGSGDPLED+C+TNP D+ECKV+E
Sbjct  427  PKAGSGDPLEDFCETNPADEECKVYE  452



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFRKA++GPL+G+L VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAAEGPLQGILAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGT  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            + AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  426  SQAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  242  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  301

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDVCD
Sbjct  302  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDVCD  361

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
            APLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  362  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGE  421

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLED+CKTNP D+ECKV+E
Sbjct  422  EAVGSGDPLEDFCKTNPADEECKVYE  447



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  426  AEVGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  244  PFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  303

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+DGPLKGVL VCD
Sbjct  304  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAVCD  363

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPGV
Sbjct  364  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGV  423

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            AV GSGDPL+++CKTNP D+ECKV+E
Sbjct  424  AVPGSGDPLDEFCKTNPADEECKVYE  449



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  244  PFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  303

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+DGPLKGVL VCD
Sbjct  304  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAVCD  363

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPGV
Sbjct  364  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGV  423

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            AV GSGDPL+++CKTNP D+ECKV+E
Sbjct  424  AVPGSGDPLDEFCKTNPADEECKVYE  449



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  197  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  256

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDVCD
Sbjct  257  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDVCD  316

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
            APLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  317  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  376

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLED+CKTNP D+ECKV++
Sbjct  377  EAVGSGDPLEDFCKTNPADEECKVYD  402



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA++GPLKG+LDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKAANGPLKGILDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+
Sbjct  366  VPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGM  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
             V GSGDPLED+CKT+P  +ECKV+EA
Sbjct  426  PVQGSGDPLEDFCKTSPATEECKVYEA  452



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEE GIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  247  PFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  306

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            V+PQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKG+L VCD
Sbjct  307  VMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCD  366

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPGV
Sbjct  367  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGV  426

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A  GSGDPLED+C+TNP D+ECKV+EA
Sbjct  427  AAGGSGDPLEDFCQTNPADEECKVYEA  453



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 202/213 (95%), Gaps = 6/213 (3%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGD------QrlldashrdlrraraaaLNIVPTSTGA  631
            PFVKVMDEEFGIVKGTMTTTHSYTGD      QRLLDASHRDLRRARAAALNIVPTSTGA
Sbjct  246  PFVKVMDEEFGIVKGTMTTTHSYTGDXSYTGDQRLLDASHRDLRRARAAALNIVPTSTGA  305

Query  630  AKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKG  451
            AKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRKA++GPLKG
Sbjct  306  AKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKG  365

Query  450  VLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA  271
            +LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA
Sbjct  366  ILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA  425

Query  270  SKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  172
            +KWPG + AGSGD LED+C+TNP DKECKVFE+
Sbjct  426  AKWPGASAAGSGDALEDFCETNPADKECKVFES  458



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  242  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  301

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAE+VN AFRKA++GP+KG+LDVCD
Sbjct  302  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEEVNEAFRKAANGPMKGILDVCD  361

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
            APLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  362  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGE  421

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLED+C+TNPG++ECKVFE
Sbjct  422  KAVGSGDPLEDFCQTNPGEEECKVFE  447



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score =   319 bits (818),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  242  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  301

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDVCD
Sbjct  302  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDVCD  361

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
            APLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  362  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  421

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLED+CKTNP D+ECKV++
Sbjct  422  EAVGSGDPLEDFCKTNPADEECKVYD  447



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   319 bits (817),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEE GIVKG +TTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  247  PFVKVMDEELGIVKGAITTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  306

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKG+L VCD
Sbjct  307  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCD  366

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPGV
Sbjct  367  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKWPGV  426

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A  GSGDPLED+C+TNP D+ECKV+EA
Sbjct  427  AAGGSGDPLEDFCQTNPADEECKVYEA  453



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   319 bits (817),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN+AFRKA++GPL GVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNSAFRKAANGPLAGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMV+GDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG 
Sbjct  366  VPLVSVDFRCSDVSSTIDSSLTMVLGDDMVKVVAWYDNEWGYSQRVVDLAHLVAYKWPGA  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
             V+GSGDPLED+CKTNP D+ECKV+E
Sbjct  426  TVSGSGDPLEDFCKTNPADEECKVYE  451



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   319 bits (817),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 191/207 (92%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  243  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  302

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVN AFRKA+ GPLKG+L VCD
Sbjct  303  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKAAQGPLKGILAVCD  362

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV
Sbjct  363  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  422

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
               GSGDPLED+C+TNP  KECKV+EA
Sbjct  423  PAQGSGDPLEDFCQTNPETKECKVYEA  449



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  112  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  171

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKGVLDVCD
Sbjct  172  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDVCD  231

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  232  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGT  291

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
              AGSGDPLED+C+TNP   ECKVFE
Sbjct  292  PQAGSGDPLEDFCETNPSTDECKVFE  317



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 191/207 (92%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  241  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  300

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVN AFRKA+ GPLKG+L VCD
Sbjct  301  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKAAQGPLKGILAVCD  360

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV
Sbjct  361  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  420

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
               GSGDPLED+C+TNP  KECKV+EA
Sbjct  421  PAQGSGDPLEDFCQTNPETKECKVYEA  447



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG+TAEDVN AFRKA+DGPLKG+L VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGITAEDVNGAFRKAADGPLKGILAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGT  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
             V GSGDPLED+CK NP D+ECKV+EA
Sbjct  426  PVEGSGDPLEDFCKDNPADEECKVYEA  452



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVN AFRKA++GPLKGVLDVCD
Sbjct  306  VLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNGAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  366  VPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGT  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
              AGSGDPLE++C+TNP D+ECKV+E
Sbjct  426  PKAGSGDPLEEFCETNPADEECKVYE  451



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  197  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  256

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDVCD
Sbjct  257  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDVCD  316

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
            APLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  317  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGE  376

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLED+C+TNP ++ECKV+E
Sbjct  377  KAVGSGDPLEDFCQTNPANEECKVYE  402



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  247  PFVKILDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  306

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+DGPLKG+L VCD
Sbjct  307  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILAVCD  366

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  367  VPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGF  426

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  427  AAEGSGDPLEDFCKTNPADEECKVYEA  453



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  247  PFVKILDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  306

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA+DGPLKG+L VCD
Sbjct  307  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILAVCD  366

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  367  VPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGF  426

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  427  AAEGSGDPLEDFCKTNPADEECKVYEA  453



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  240  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  299

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA++GP+KG+LDVCD
Sbjct  300  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDVCD  359

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
            APLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  360  APLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGE  419

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLED+C+TNP ++ECKV+E
Sbjct  420  KAVGSGDPLEDFCQTNPANEECKVYE  445



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFRKA++GPL+G+L VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAAEGPLQGILAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  366  IPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGT  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
              AGSGDPLE++CKTNP D+ECKV+EA
Sbjct  426  PQAGSGDPLEEFCKTNPADEECKVYEA  452



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  242  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  301

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+ GP+KG+LDVCD
Sbjct  302  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAAAGPMKGILDVCD  361

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  362  TPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGE  421

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
              AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  422  VAAGSGDPLEDFCKTNPADEECKVYEA  448



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  242  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  301

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+ GPLKGVL+VCD
Sbjct  302  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAAAGPLKGVLEVCD  361

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  362  TPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGE  421

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
              AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  422  VAAGSGDPLEDFCKTNPADEECKVYEA  448



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   316 bits (809),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  196  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  255

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+ GPLKGVL+VCD
Sbjct  256  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAAAGPLKGVLEVCD  315

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  316  TPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGE  375

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
              AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  376  VAAGSGDPLEDFCKTNPADEECKVYEA  402



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   317 bits (811),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKGVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGT  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
              AGSGDPLED+C+TNP   ECKVFE
Sbjct  426  PQAGSGDPLEDFCETNPSTDECKVFE  451



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  162  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  221

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFRKA+ GPLKGVL+VCD
Sbjct  222  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAAAGPLKGVLEVCD  281

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  282  TPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGE  341

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
              AGSGDPLED+CKTNP D+ECKV+E
Sbjct  342  VAAGSGDPLEDFCKTNPADEECKVYE  367



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   316 bits (809),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA+DGPLKG+L VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKAADGPLKGILAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+
Sbjct  366  VPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGM  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
             V GSGDPLED+C+T+P  +ECKV+EA
Sbjct  426  PVQGSGDPLEDFCQTSPDTEECKVYEA  452



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  242  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  301

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKGLTAEDVN AFRKA+DGPLKGVL VCD
Sbjct  302  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGLTAEDVNEAFRKAADGPLKGVLAVCD  361

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  362  IPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGE  421

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
              AGSGDPLED+CKTNP D+ECKV+E
Sbjct  422  VAAGSGDPLEDFCKTNPADEECKVYE  447



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  245  PFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  304

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGL+AEDVNAAFRKA+DGPL G+L VCD
Sbjct  305  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLSAEDVNAAFRKAADGPLNGILAVCD  364

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  365  EPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVANKWPGS  424

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            A  GSGD LEDYCKTNP DKECKV+E
Sbjct  425  AAEGSGDALEDYCKTNPADKECKVYE  450



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  245  PFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  304

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPL G+L VCD
Sbjct  305  VLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLNGILAVCD  364

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  365  EPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVASKWPGS  424

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            A  GSGD LEDYCKTNP DKECKV+E
Sbjct  425  AAEGSGDALEDYCKTNPADKECKVYE  450



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   315 bits (806),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKG+LDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGILDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  366  VPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGT  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLED+C+TNP D+ECKV+E
Sbjct  426  PKVGSGDPLEDFCETNPADEECKVYE  451



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score =   314 bits (804),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 199/207 (96%), Gaps = 2/207 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  RVVDLAHLVASKWPG 
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY--RVVDLAHLVASKWPGT  423

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  424  AQAGSGDPLEDFCKTNPADEECKVYEA  450



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   316 bits (810),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 186/206 (90%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  320  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  379

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA++GPLKGVLDVCD
Sbjct  380  VLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAAEGPLKGVLDVCD  439

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  440  LPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGT  499

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLED+C+TNP D ECKV+E
Sbjct  500  PQKGSGDPLEDFCETNPADDECKVYE  525



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   314 bits (804),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  245  PFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  304

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFRKA+DGPL G+L VCD
Sbjct  305  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAADGPLNGILAVCD  364

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQRVVDLAHLVA KWPG 
Sbjct  365  EPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVADKWPGS  424

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            A  GSGD LEDYCKTNP DKECKV+E
Sbjct  425  AAEGSGDALEDYCKTNPADKECKVYE  450



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   314 bits (804),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKGVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEW YSQRVVDLAHLVA+KWPG 
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWDYSQRVVDLAHLVANKWPGT  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
              AGSGDPLED+C+TNP   ECKVFE
Sbjct  426  PQAGSGDPLEDFCETNPSTDECKVFE  451



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFRKA++GP  GVL VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGMTAEDVNDAFRKAANGPSNGVLAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG+
Sbjct  366  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGI  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLED+C+TNP  KECKV+E
Sbjct  426  PAQGSGDPLEDFCQTNPETKECKVYE  451



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 200/207 (97%), Gaps = 1/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGI KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  234  PFVKVLDEEFGIEKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  293

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+ AED+N+AFRKA++GPLKGVLDVCD
Sbjct  294  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGIAAEDINSAFRKAAEGPLKGVLDVCD  353

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
            APLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  354  APLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGA  413

Query  252  AVA-GSGDPLEDYCKTNPGDKECKVFE  175
              A GSGDPLEDYCKT+P D+ECKV+E
Sbjct  414  TPAEGSGDPLEDYCKTSPADEECKVYE  440



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   308 bits (788),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  112  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  171

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+ GPL G+LDVCD
Sbjct  172  VLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLSGILDVCD  231

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  232  VPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  291

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            AV GSGDPLED+CK NP   ECKV+E
Sbjct  292  AVQGSGDPLEDFCKDNPETDECKVYE  317



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   311 bits (797),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  242  PFAKVLDEESGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  301

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKG+LDVCD
Sbjct  302  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGILDVCD  361

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  362  VPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGT  421

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLED+C+TNP D+ECKV+E
Sbjct  422  PKVGSGDPLEDFCETNPADEECKVYE  447



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  238  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  297

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+ GPL G+LDVCD
Sbjct  298  VLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAASGPLNGILDVCD  357

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV
Sbjct  358  VPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  417

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            A  GSGDPLED+CK NP   ECKV+E
Sbjct  418  AAQGSGDPLEDFCKDNPETDECKVYE  443



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  245  PFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  304

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL VCD
Sbjct  305  VLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAVCD  364

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA KWPG 
Sbjct  365  IPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVADKWPGA  424

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
                SGDPLED+C+TNP D+ECKV+EA
Sbjct  425  GSGKSGDPLEDFCQTNPADEECKVYEA  451



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  366  IPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVATKWPGA  425

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
                SGDPLED+C+TNP D+ECKV+EA
Sbjct  426  GSGKSGDPLEDFCQTNPADEECKVYEA  452



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  245  PFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  304

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL VCD
Sbjct  305  VLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAVCD  364

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  365  IPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVATKWPGA  424

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
                SGDPLED+C+TNP D+ECKV+EA
Sbjct  425  GSGKSGDPLEDFCQTNPADEECKVYEA  451



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAVSL
Sbjct  238  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAELNIVPTSTGAAKAVSL  297

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+DGPLKG+LDVCD
Sbjct  298  VLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAADGPLKGILDVCD  357

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  358  EPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGA  417

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLEDYCKT+P   ECKVF+
Sbjct  418  GTGGSGDPLEDYCKTDPNAVECKVFD  443



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  225  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  284

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+DGPLKG+L VCD
Sbjct  285  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFRKAADGPLKGILAVCD  344

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG 
Sbjct  345  IPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAEKWPGG  404

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A A SGDPL+++CKTNP   ECKV++A
Sbjct  405  APAPSGDPLDEFCKTNPDTDECKVYDA  431



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  238  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  297

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+ GPL G+LDVCD
Sbjct  298  VLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLSGILDVCD  357

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  358  VPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGA  417

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            AV GSGDPLED+CK NP   ECKV+E
Sbjct  418  AVQGSGDPLEDFCKDNPETDECKVYE  443



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  225  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  284

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+DGPLKG+L VCD
Sbjct  285  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFRKAADGPLKGILAVCD  344

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG 
Sbjct  345  IPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVADKWPGG  404

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A A SGDPL+++CKTNP   EC+V++A
Sbjct  405  AAAPSGDPLDEFCKTNPDTDECRVYDA  431



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  238  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  297

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+DGPLKG+LDVCD
Sbjct  298  VLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAADGPLKGILDVCD  357

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  358  EPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGA  417

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLEDYCKT+P   ECKVF+
Sbjct  418  GTGGSGDPLEDYCKTDPNAVECKVFD  443



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 183/206 (89%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  241  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  300

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+ GPL G+LDVCD
Sbjct  301  VLPQLKGKLNGIALRVPTPNVSVVDLVINTAKTGITADDVNAAFRKAAAGPLNGILDVCD  360

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  361  EPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGS  420

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
             V G+GDPLEDYCKTNP   ECKV++
Sbjct  421  EVKGTGDPLEDYCKTNPETDECKVYD  446



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 181/206 (88%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  238  PFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  297

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+DGPLKG+LDVCD
Sbjct  298  VLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAADGPLKGILDVCD  357

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  358  EPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGA  417

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               GSGDPLEDYCKT+P   ECKVF+
Sbjct  418  GTGGSGDPLEDYCKTDPNAVECKVFD  443



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 1/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  247  PFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  306

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR A++GPLKG+L VCD
Sbjct  307  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRDAAEGPLKGILAVCD  366

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSL+MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWPG+
Sbjct  367  DPLVSVDFRCSDVSSTIDSSLSMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAVKWPGI  426

Query  252  AVAGS-GDPLEDYCKTNPGDKECKVFE  175
             + GS GDPLED+CK NP D+ECKV+E
Sbjct  427  EIPGSTGDPLEDFCKKNPADEECKVYE  453



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 197/207 (95%), Gaps = 1/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK+MDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  245  PFVKIMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  304

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVN AFRKA+ GP KGVL+VCD
Sbjct  305  VLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNNAFRKAAAGPSKGVLEVCD  364

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG+
Sbjct  365  IPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGM  424

Query  252  AVA-GSGDPLEDYCKTNPGDKECKVFE  175
              A  SGDPLED+CK NP D+ECKV+E
Sbjct  425  EGAISSGDPLEDFCKDNPADEECKVYE  451



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 1/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  208  PFVKVMDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  267

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFRK+++GPLKG+L VCD
Sbjct  268  VLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKSAEGPLKGILAVCD  327

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW G 
Sbjct  328  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWSGA  387

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A +G GDPLE++C+T+P   ECKV+EA
Sbjct  388  AKSG-GDPLEEFCQTSPETVECKVYEA  413



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score =   320 bits (819),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  249  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  308

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFRK ++GPLKG+LDVCD
Sbjct  309  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFRKEAEGPLKGILDVCD  368

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG 
Sbjct  369  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGS  428

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA*FTTNF  154
               GSGDPLED+CKTNP D+ECK+  A F   F
Sbjct  429  GTGGSGDPLEDFCKTNPADEECKIVIASFIGCF  461



>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|Q Chain Q, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|T Chain T, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=368

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 192/207 (93%), Gaps = 1/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  162  PFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  221

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFRKA+ GPLKGVLDVCD
Sbjct  222  VLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCD  281

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSD SSTIDSSLTMVMG DMVKVVAWYDNEWGYSQRVVDLA LVA+KWPG+
Sbjct  282  IPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGL  341

Query  252  -AVAGSGDPLEDYCKTNPGDKECKVFE  175
                 SGDPLED+CK NP D+ECK++E
Sbjct  342  EGSVASGDPLEDFCKDNPADEECKLYE  368



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   294 bits (753),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 192/207 (93%), Gaps = 1/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  245  PFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  304

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFRKA+ GPLKGVLDVCD
Sbjct  305  VLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCD  364

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSD SSTIDSSLTMVMG DMVKVVAWYDNEWGYSQRVVDLA LVA+KWPG+
Sbjct  365  IPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGL  424

Query  252  -AVAGSGDPLEDYCKTNPGDKECKVFE  175
                 SGDPLED+CK NP D+ECK++E
Sbjct  425  EGSVASGDPLEDFCKDNPADEECKLYE  451



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 186/245 (76%), Positives = 198/245 (81%), Gaps = 39/245 (16%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKGVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG-------------------  310
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWG                   
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGAHFVWAFSLMFLFSGRGYW  425

Query  309  --------------------YSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKE  190
                                ++QRVVDLAHLVA+KWPG   AGSGDPLED+C+TNP   E
Sbjct  426  QELIESIVWAHNKLKYKVCFHNQRVVDLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDE  485

Query  189  CKVFE  175
            CKVFE
Sbjct  486  CKVFE  490



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   290 bits (741),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 192/209 (92%), Gaps = 3/209 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+L
Sbjct  272  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVAL  331

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLVVNV+ KG TAEDVN AFRKA++GPLKGVL VCD
Sbjct  332  VLPKLKGKLNGIALRVPTPNVSVVDLVVNVENKGCTAEDVNDAFRKAANGPLKGVLAVCD  391

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  392  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGA  451

Query  252  AVAGSG---DPLEDYCKTNPGDKECKVFE  175
              A  G   DPL  YC++NP D EC+VFE
Sbjct  452  KPAPDGKDADPLGTYCESNPDDAECRVFE  480



>gb|KGN49135.1| hypothetical protein Csa_6G514950 [Cucumis sativus]
Length=191

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  744  MTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSLVLPQLKGKLNGIALRv  565
            MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRV
Sbjct  1    MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRV  60

Query  564  ptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSST  385
            PTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL VCD PLVSVDF+C+DVSST
Sbjct  61   PTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAVCDIPLVSVDFKCTDVSST  120

Query  384  IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTN  205
            IDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAHLVA KWPG     SGDPLED+C+TN
Sbjct  121  IDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVADKWPGAGSGKSGDPLEDFCQTN  180

Query  204  PGDKECKVFEA  172
            P D+ECKV+EA
Sbjct  181  PADEECKVYEA  191



>gb|ABK24645.1| unknown [Picea sitchensis]
Length=460

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVSL
Sbjct  254  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVSL  313

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A+DGPLKG+L VCD
Sbjct  314  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSAADGPLKGILAVCD  373

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  374  VPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGA  433

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
               GS DPL+++CKTNP   EC+V+EA
Sbjct  434  GKGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|ACN40006.1| unknown [Picea sitchensis]
Length=460

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVSL
Sbjct  254  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVSL  313

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A+DGPLKG+L VCD
Sbjct  314  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSAADGPLKGILAVCD  373

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  374  VPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGA  433

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
               GS DPL+++CKTNP   EC+V+EA
Sbjct  434  GKGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|ACN40526.1| unknown [Picea sitchensis]
Length=460

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVSL
Sbjct  254  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVSL  313

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR A+DGPLKG+L VCD
Sbjct  314  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRSAADGPLKGILAVCD  373

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  374  VPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGA  433

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
               GS DPL+++CKTNP   EC+V+EA
Sbjct  434  GKGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score =   286 bits (731),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 178/206 (86%), Positives = 190/206 (92%), Gaps = 2/206 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  238  PFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  297

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+DGPLKG+LDVCD
Sbjct  298  VLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAADGPLKGILDVCD  357

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  358  EPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGA  417

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
               G G   EDYCKT+P   ECKVF+
Sbjct  418  GTGGGG--GEDYCKTDPNAVECKVFD  441



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   286 bits (732),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  243  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  302

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFRKA+ GPL+G+L+VCD
Sbjct  303  VLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLQGILEVCD  362

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS TID+SL+MVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG 
Sbjct  363  VPLVSVDFRCSDVSCTIDASLSMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGA  422

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
            A AGSGDPLED+CK NP   ECKV+EA
Sbjct  423  AAAGSGDPLEDFCKDNPETDECKVYEA  449



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 189/209 (90%), Gaps = 3/209 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+L
Sbjct  249  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVAL  308

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKG+TA+ VNAAFRKA++GPL GVL V D
Sbjct  309  VLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGITADQVNAAFRKAAEGPLNGVLAVSD  368

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQRVVDLAH+VA+ WPG 
Sbjct  369  LPLVSIDFRCSDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHIVANNWPGQ  428

Query  252  AVAG---SGDPLEDYCKTNPGDKECKVFE  175
                   SGDPL+ YC TNP   EC+V++
Sbjct  429  KADSEEESGDPLDKYCATNPEADECRVYD  457



>ref|XP_002540513.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF21870.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=193

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  657  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  478
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  32   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  91

Query  477  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  298
            KA++GPLKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  92   KAAEGPLKGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  151

Query  297  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  172
            VVDLAHLVA+KWPG + AGSGD LED+C+TNP DKECKVFE+
Sbjct  152  VVDLAHLVAAKWPGASAAGSGDALEDFCETNPADKECKVFES  193



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 194/206 (94%), Gaps = 1/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  252  PFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  311

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKGLTAEDVN AFR+A++GPLKG+L VCD
Sbjct  312  VLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGLTAEDVNNAFREAANGPLKGILAVCD  371

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA++WPGV
Sbjct  372  IPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAQWPGV  431

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
            A   SGDPLE++C TNP   EC++ +
Sbjct  432  A-KPSGDPLEEFCVTNPDTDECRLHD  456



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 166/206 (81%), Positives = 182/206 (88%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DE FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  209  PFAKVLDENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  268

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFRK ++G +KG+L V D
Sbjct  269  VLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKEANGAMKGILAVSD  328

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRCSDVS TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ WPG+
Sbjct  329  LPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWPGM  388

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
                  DPLE +C TNP   EC+V+ 
Sbjct  389  VQETGSDPLETFCNTNPDADECRVYN  414



>gb|ABF74607.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase B subunit 
[Agave tequilana]
Length=174

 Score =   266 bits (680),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  657  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  478
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  11   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  70

Query  477  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  298
            KA++GPLKG+L VCD PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  71   KAANGPLKGILAVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  130

Query  297  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA*F  166
            VVDLAHLVASKWPG+   GS DPLED+CKTNP  +ECKV+EA F
Sbjct  131  VVDLAHLVASKWPGMPAQGSSDPLEDFCKTNPETEECKVYEAGF  174



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 187/207 (90%), Gaps = 2/207 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV+L
Sbjct  160  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVAL  219

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  220  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSVCD  278

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW G+
Sbjct  279  EPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQGL  338

Query  252  -AVAGSGDPLEDYCKTNPGDKECKVFE  175
                 SGDPLED+CK NP D+ECK++E
Sbjct  339  EGSVASGDPLEDFCKDNPADEECKLYE  365



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   272 bits (696),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEE GIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  215  PFVKVMDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  274

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFRKA+DGPLKGVL VCD
Sbjct  275  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAVCD  334

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  256
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+ WPG
Sbjct  335  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANNWPG  393



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DE FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAA NIVPTSTGAAKAVSL
Sbjct  181  PFAKVLDENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAAFNIVPTSTGAAKAVSL  240

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFRK ++G +KG+L V D
Sbjct  241  VLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKEANGAMKGILAVSD  300

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVS+DFRCSDVS TIDSSLTMVMGDDMVKVVAWY NEWGYSQRVVDLA +VA+ WPG+
Sbjct  301  LPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYGNEWGYSQRVVDLADIVANNWPGM  360

Query  252  AVAGSGDPLEDYCKTNPGDKECKV  181
                  DPLE +C TNP   EC+V
Sbjct  361  VQETGSDPLETFCNTNPDADECRV  384



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 191/208 (92%), Gaps = 1/208 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  238  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  297

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKG+TA+DVNAAFRKA+ GPLKGVL VCD
Sbjct  298  VLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGMTADDVNAAFRKAAAGPLKGVLQVCD  357

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV-ASKWPG  256
             PLVSVDFRCSDVSS+IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLV A     
Sbjct  358  EPLVSVDFRCSDVSSSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGA  417

Query  255  VAVAGSGDPLEDYCKTNPGDKECKVFEA  172
             A  GSGDPLED+CK NP   ECKV+EA
Sbjct  418  AAAGGSGDPLEDFCKDNPETDECKVYEA  445



>ref|XP_007515295.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO14174.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=405

 Score =   259 bits (661),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DE FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  201  PFAKVLDESFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVAL  260

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAFR+A +GP+KGVL + D
Sbjct  261  VLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGITAEEVNAAFREAQNGPMKGVLAITD  320

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVVDL  L+ +K    
Sbjct  321  TPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVVDLT-LIVAKALVT  379

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
             V    DP++  C ++PG +ECKVF+
Sbjct  380  GVENFSDPMDALCASDPGAEECKVFD  405



>ref|XP_003056194.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
 gb|EEH59570.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
Length=406

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 185/206 (90%), Gaps = 0/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+D++FGIVKGTMTT HSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  201  PFAKVLDDKFGIVKGTMTTCHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVAL  260

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++AS+GP+KG+L + +
Sbjct  261  VLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEASEGPMKGILAITE  320

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVVDL H+VA+     
Sbjct  321  TPLVSVDFRCSDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVVDLTHIVAAGLIEG  380

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
                 GDP++ +C  +P  +ECKVF+
Sbjct  381  GEVTVGDPMDAFCADDPSAEECKVFD  406



>ref|XP_002507103.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
 gb|ACO68361.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
Length=405

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 185/208 (89%), Gaps = 5/208 (2%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DE+FGI+KGTMTT HSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  201  PFAKVLDEKFGIIKGTMTTCHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVAL  260

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVS+VDLV NV+KKG+TAE+VNAAF++A+DGP+KGVL + +
Sbjct  261  VLPQLKGKLNGIALRVPTPNVSIVDLVCNVEKKGVTAEEVNAAFKEAADGPMKGVLAITE  320

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRCSDVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVVDL H+VA    G+
Sbjct  321  TPLVSVDFRCSDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVVDLTHIVAK---GL  377

Query  252  AVAG--SGDPLEDYCKTNPGDKECKVFE  175
               G  S DP++  C  +P  +ECKVF+
Sbjct  378  IEGGDVSADPMDALCADDPSAEECKVFD  405



>ref|XP_001415434.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABG85192.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus 'lucimarinus']
 gb|ABO93726.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=406

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 185/206 (90%), Gaps = 1/206 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  202  PFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVAL  261

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAE+VNAAF++A DGP+KGVL + D
Sbjct  262  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGVTAEEVNAAFKEAQDGPMKGVLAITD  321

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVVDL+ +VA+     
Sbjct  322  VPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVVDLSLIVANGLINE  381

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFE  175
             VA S DP++  C  +P   ECKVF+
Sbjct  382  GVA-SADPMDQLCADDPSADECKVFD  406



>gb|ABS72003.1| putative chloroplast glyceradehyde-3-phosphate dehydrogenase 
subunit B [Olea europaea]
Length=149

 Score =   245 bits (625),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -3

Query  618  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  439
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVNAAFRKA+DGPLKGVL V
Sbjct  1    SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNAAFRKAADGPLKGVLAV  60

Query  438  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  259
            CD PLVSVDFRC+DVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWP
Sbjct  61   CDVPLVSVDFRCTDVSATIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAYKWP  120

Query  258  GVAVAGSGDPLEDYCKTNPGDKECKVFEA  172
            G+A   SGDPLED+CKTNP D+ECKV+EA
Sbjct  121  GMAAQESGDPLEDFCKTNPADEECKVYEA  149



>emb|CEF96577.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=407

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  202  PFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVAL  261

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++ +DGP+KGVL + D
Sbjct  262  VLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEYADGPMKGVLAITD  321

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QRVVDL  +VA+     
Sbjct  322  TPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQRVVDLTLIVANSLINE  381

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
              + + DPL+  C  +P   ECKVF++
Sbjct  382  G-SVTLDPLDQLCSDDPSADECKVFDS  407



>gb|ABG85191.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus tauri]
Length=439

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  234  PFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVAL  293

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++ +DGP+KGVL + D
Sbjct  294  VLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEYADGPMKGVLAITD  353

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVS+TID++LTMV+GDDMVKVVAWYDNEWGY+QRVVDL  +VA+     
Sbjct  354  TPLVSVDFRCTDVSTTIDAALTMVIGDDMVKVVAWYDNEWGYTQRVVDLTLIVANSLINE  413

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
              + + DPL+  C  +P   ECKVF++
Sbjct  414  G-SVTLDPLDQLCSDDPSADECKVFDS  439



>ref|XP_003074208.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC) [Ostreococcus 
tauri]
Length=434

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 184/207 (89%), Gaps = 1/207 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+D++FGIVKGTMTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  229  PFAKVIDDKFGIVKGTMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVAL  288

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF++ +DGP+KGVL + D
Sbjct  289  VLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFKEYADGPMKGVLAITD  348

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGV  253
             PLVSVDFRC+DVS+TID++LTMV+GDDMVKVVAWYDNEWGY+QRVVDL  +VA+     
Sbjct  349  TPLVSVDFRCTDVSTTIDAALTMVIGDDMVKVVAWYDNEWGYTQRVVDLTLIVANSLINE  408

Query  252  AVAGSGDPLEDYCKTNPGDKECKVFEA  172
              + + DPL+  C  +P   ECKVF++
Sbjct  409  G-SVTLDPLDQLCSDDPSADECKVFDS  434



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 167/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++ ++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  137  PFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  196

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVS+VDLV+  +KK   AE+VNAAFR+A++GPLKG+L VCD
Sbjct  197  VLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTF-AEEVNAAFREAANGPLKGILAVCD  255

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  256  EPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  312



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 169/179 (94%), Gaps = 1/179 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  181  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  240

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A++G +KG+L VCD
Sbjct  241  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREAANGDMKGILAVCD  299

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  256
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW G
Sbjct  300  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWTG  358



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  57   PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  116

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  117  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  175

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  176  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  232



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 169/179 (94%), Gaps = 1/179 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  222  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  281

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A++G +KG+L VCD
Sbjct  282  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREAANGDMKGILAVCD  340

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPG  256
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW G
Sbjct  341  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWTG  399



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  141  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  200

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  201  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  259

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  260  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 167/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++ ++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  159  PFVKILSDKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  218

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVS+VDLV+  +KK   AE+VNAAFR+A++GPLKG+L VCD
Sbjct  219  VLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTF-AEEVNAAFREAANGPLKGILAVCD  277

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA+ W
Sbjct  278  EPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  334



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score =   241 bits (614),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  141  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  200

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  201  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  259

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  260  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  141  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  200

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  201  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  259

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  260  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   240 bits (612),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  141  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  200

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  201  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  259

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  260  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  316



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 1/176 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  110  PFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  169

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A++GP+KGVL VCD
Sbjct  170  VLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREAANGPMKGVLAVCD  228

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  265
             PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH++A +
Sbjct  229  EPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  284



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV+L
Sbjct  160  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVAL  219

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  220  VLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSVCD  278

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  279  EPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>ref|XP_009118049.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  141  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  200

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDVCD
Sbjct  201  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANELKGILDVCD  259

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDL+ +VA+ W
Sbjct  260  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANNW  316



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFRKA++GPLKGVLDVCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  307
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  407



>gb|ABK00056.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Mesostigma viride]
Length=310

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 1/176 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  136  PFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  195

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A++GP+KGVL VCD
Sbjct  196  VLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREAANGPMKGVLAVCD  254

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  265
             PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH++A +
Sbjct  255  EPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  310



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV+L
Sbjct  158  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVAL  217

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  218  VLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADQELKGILSVCD  276

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  277  EPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  333



>ref|XP_010425376.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  141  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  200

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDVCD
Sbjct  201  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDVCD  259

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  260  EPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  316



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  226  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  285

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+A+D  L G+L VCD
Sbjct  286  VLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFREAADKALNGILAVCD  344

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA++VA +W
Sbjct  345  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQW  401



>ref|XP_010502598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  141  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  200

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDVCD
Sbjct  201  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDVCD  259

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  260  EPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  316



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 168/176 (95%), Gaps = 1/176 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  110  PFAKVLDDKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  169

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A++GP+KGVL VCD
Sbjct  170  VLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREAANGPMKGVLAVCD  228

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  265
             PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH++A++
Sbjct  229  EPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMANQ  284



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 167/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  226  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  285

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++D  L G+L VCD
Sbjct  286  VLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESADKALNGILAVCD  344

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA++VA +W
Sbjct  345  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQW  401



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDA+HRDLRRARAA LNIVPTSTGAAKAV+L
Sbjct  160  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDAAHRDLRRARAACLNIVPTSTGAAKAVAL  219

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  220  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSVCD  278

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  279  EPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV+L
Sbjct  160  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVAL  219

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  220  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSVCD  278

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  279  EPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV+L
Sbjct  160  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVAL  219

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  220  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSVCD  278

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  279  EPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  335



>gb|ABD37961.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Mesostigma 
viride]
Length=333

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 1/176 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  157  PFAKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  216

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R+A++GP+KGVL VCD
Sbjct  217  VLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALREAANGPMKGVLAVCD  275

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASK  265
             PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH++A +
Sbjct  276  EPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  331



>dbj|BAK02737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  130  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  189

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   LKG+LDVCD
Sbjct  190  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELKGILDVCD  248

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  249  EPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  305



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  246  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  305

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFRKA+DGPLKG+L VCD
Sbjct  306  VLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAVCD  365

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  307
             PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  366  VPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  407



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  174  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  233

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  234  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  292

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  293  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  349



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  174  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  233

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  234  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  292

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  293  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  349



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  225  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  284

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+D  LKG+LDVCD
Sbjct  285  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAADKELKGILDVCD  343

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  344  EPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+F I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  219  PFVKVLDEKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  278

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  279  VLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESADKELKGILSVCD  337

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  338  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  394



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  225  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  284

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+D  LKG+LDVCD
Sbjct  285  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFREAADKELKGILDVCD  343

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  344  EPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 167/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  225  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  284

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+D  LKG+LDVCD
Sbjct  285  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFREAADKELKGILDVCD  343

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  344  EPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>gb|AAG23800.1| chloroplast NADP-dependent glyceraldehyde 3-phosphate dehydrogenase 
B subunit [Cucurbita pepo]
Length=171

 Score =   231 bits (588),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 147/161 (91%), Positives = 159/161 (99%), Gaps = 0/161 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  11   PFVKIIDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  70

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFRKA+DGPLKGVL VCD
Sbjct  71   VLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAVCD  130

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG  310
             PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDN+WG
Sbjct  131  IPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNDWG  171



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  160  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  219

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDVCD
Sbjct  220  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANELKGILDVCD  278

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  279  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  335



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAV+L
Sbjct  225  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVAL  284

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  285  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSVCD  343

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  344  EPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  400



>gb|KJB11770.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=305

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  129  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  188

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L VCD
Sbjct  189  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELKGILSVCD  247

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  248  EPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  304



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+D++FGIVKG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  200  PFAKVLDDKFGIVKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVAL  259

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVD+ +  +KK  TAE++NAAFR+A++GP+KG+L V D
Sbjct  260  VLPQLKGKLNGIALRVPTPNVSVVDMCIQTEKK-CTAEEINAAFREAAEGPMKGILAVAD  318

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS+DFRCSDVS+TID++LTMVMGDD++KVVAWYDNEWGYSQRVVDLA L A+KW
Sbjct  319  EPLVSIDFRCSDVSTTIDAALTMVMGDDLIKVVAWYDNEWGYSQRVVDLAELTATKW  375



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score =   238 bits (607),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKVMDEE GIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  247  PFVKVMDEELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  306

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            V+PQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFRKA++GPLKG+L VCD
Sbjct  307  VMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCD  366

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  307
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  367  VPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  408



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   238 bits (606),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   238 bits (606),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  204  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  263

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L+VCD
Sbjct  264  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESAEKELKGILEVCD  322

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  323  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  226  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  285

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNA FR+++D  LKG+L VCD
Sbjct  286  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAGFRESADNELKGILSVCD  344

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLAH+VA  W
Sbjct  345  EPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADNW  401



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  287  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  346  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR A+   LKG+LDVCD
Sbjct  287  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDAAANELKGILDVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  346  EPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  402



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  287  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  346  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  287  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  346  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   +KG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANEMKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  224  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  283

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+L+VCD
Sbjct  284  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILEVCD  342

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  224  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  283

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L+VCD
Sbjct  284  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELKGILEVCD  342

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  225  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  284

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  285  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESADNELKGILSVCD  343

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA KW
Sbjct  344  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVADKW  400



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  224  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  283

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L+VCD
Sbjct  284  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESAEKELKGILEVCD  342

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAANELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDL+ +VA+ W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANNW  398



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  224  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  283

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDVCD
Sbjct  284  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDVCD  342

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  343  EPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+A+D  L G+L VCD
Sbjct  283  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFREAADKELNGILAVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  342  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  398



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  224  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  283

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDVCD
Sbjct  284  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDVCD  342

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  343  EPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  174  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  233

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+LDVCD
Sbjct  234  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILDVCD  292

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR VDLA +VA+ W
Sbjct  293  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRDVDLADIVANNW  349



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  204  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  263

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+L+VCD
Sbjct  264  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSAEKELKGILEVCD  322

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  323  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  161  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  220

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDVCD
Sbjct  221  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDVCD  279

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  280  EPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  336



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+D+ FGI+KG MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  202  PFAKVLDDSFGIIKGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVAL  261

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVD+V+ V+KK  TAEDVNAAFR+A+ GP+KG+L V D
Sbjct  262  VLPQLKGKLNGIALRVPTPNVSVVDMVIQVEKK-CTAEDVNAAFREAAAGPMKGILQVVD  320

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS+DFRC+DVS++IDS+LTMVMG+D+VK+VAWYDNEWGYSQRVVDLA L ASKW
Sbjct  321  EPLVSIDFRCTDVSTSIDSALTMVMGEDLVKIVAWYDNEWGYSQRVVDLAELTASKW  377



>gb|KIY93372.1| NADP-dependent glyceraldehydephosphatedehydrogenase subunit A 
[Monoraphidium neglectum]
Length=176

 Score =   228 bits (582),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 161/173 (93%), Gaps = 1/173 (1%)
 Frame = -3

Query  780  VMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSLVLPQ  601
            V+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+LVLP+
Sbjct  4    VLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPK  63

Query  600  LKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCDAPLV  421
            LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR+A+ GP+ GVL V D PLV
Sbjct  64   LKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAAFREAAAGPMAGVLAVADEPLV  122

Query  420  SVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            SVDFRC+DVS++IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA L A KW
Sbjct  123  SVDFRCTDVSTSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAELTAQKW  175



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  L+G+L VCD
Sbjct  287  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELQGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  346  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  228  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  287

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  288  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFRESADKELKGILSVCD  346

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L VCD
Sbjct  287  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELKGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  346  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  402



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   236 bits (601),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  287  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELKGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR VDLA +VA+KW
Sbjct  346  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRAVDLADIVANKW  402



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  204  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  263

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE++NAAFR +++  LKG+L+VCD
Sbjct  264  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEINAAFRDSAEKELKGILEVCD  322

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  323  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  379



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 2/178 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  200  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  259

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGP-LKGVLDVC  436
            VLP+LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A + P LKG+L VC
Sbjct  260  VLPRLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACETPQLKGILAVC  318

Query  435  DAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            D PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  319  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  376



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  152  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  211

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDVCD
Sbjct  212  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRGAAANELKGILDVCD  270

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSV FRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  271  EPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  327



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   234 bits (596),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  174  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  233

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDVCD
Sbjct  234  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDVCD  292

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  293  EPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  349



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  225  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  284

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   LKG+LDVCD
Sbjct  285  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELKGILDVCD  343

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  344  EPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  226  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  285

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  286  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADKELKGILSVCD  344

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  345  EPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  401



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  233  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  292

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  L G+L VCD
Sbjct  293  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADNELAGILSVCD  351

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA++W
Sbjct  352  EPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLANIVANQW  408



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  225  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  284

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   LKG+LDVCD
Sbjct  285  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELKGILDVCD  343

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  344  EPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  220  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  279

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDVCD
Sbjct  280  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDVCD  338

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  339  EPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  220  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  279

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDVCD
Sbjct  280  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDVCD  338

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  339  EPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>gb|ABD37966.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Spirogyra 
sp. SAG 170.80]
Length=321

 Score =   233 bits (593),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  160  PFVKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  219

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLV+N +KKG+TAE+VNAAFRKA+DGP+KG+L VCD
Sbjct  220  VLPNLKGKLNGIALRVPTPNVSVVDLVINTEKKGMTAEEVNAAFRKAADGPMKGILGVCD  279

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  307
             PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNE GY
Sbjct  280  LPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNELGY  321



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  224  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  283

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+L+VCD
Sbjct  284  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILEVCD  342

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+KW
Sbjct  343  EPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKW  399



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  220  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  279

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+LDVCD
Sbjct  280  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILDVCD  338

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  339  EPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  395



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  226  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  285

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   LKG+LDVCD
Sbjct  286  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELKGILDVCD  344

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  345  EPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  401



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  235  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  294

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  LKG+L VCD
Sbjct  295  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESADKELKGILSVCD  353

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  354  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  410



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A+   LKG+LDVCD
Sbjct  283  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRGAAANELKGILDVCD  341

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSV FRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  342  EPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  398



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 164/178 (92%), Gaps = 2/178 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  222  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  281

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA-SDGPLKGVLDVC  436
            VLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A +   LKGVL VC
Sbjct  282  VLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACATEELKGVLAVC  340

Query  435  DAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            D PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH+VA KW
Sbjct  341  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKW  398



>dbj|BAA94304.1| NADP-glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
sp. W80]
Length=369

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV++E+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAA+NIVPTSTGAAKAV+L
Sbjct  193  PFVKVLEEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVAL  252

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP +KGKLNGIALRVPTPNVS+VDLVV V+KK   AE+VNAAFR+A++G  KGVL V D
Sbjct  253  VLPSMKGKLNGIALRVPTPNVSIVDLVVQVEKKTF-AEEVNAAFREAANGAQKGVLAVSD  311

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  312  EPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAQKW  368



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR ++   L+G+L+VCD
Sbjct  287  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDSAANELQGILEVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  346  VPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  402



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+ E+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+L
Sbjct  197  PFVKVLQEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVAL  256

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR+A+ GP+KGVL V D
Sbjct  257  VLPQLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFREAAAGPMKGVLHVED  315

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            APLVS+DF+C+D S++IDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  316  APLVSIDFKCTDQSTSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAQKW  372



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 166/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  225  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  284

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR ++   L+G+L+VCD
Sbjct  285  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFRDSAANELQGILEVCD  343

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  344  VPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  400



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 164/178 (92%), Gaps = 2/178 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  229  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  288

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKA-SDGPLKGVLDVC  436
            VLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A +   LKGVL VC
Sbjct  289  VLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACATEELKGVLAVC  347

Query  435  DAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            D PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH+VA KW
Sbjct  348  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKW  405



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  224  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  283

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+L+VCD
Sbjct  284  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELKGILEVCD  342

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  EPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  LKG+L VCD
Sbjct  287  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELKGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  346  EPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>gb|KJB70724.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=303

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  127  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  186

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAF+++++  L+G+L VC+
Sbjct  187  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFKESAEKELQGILSVCE  245

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  246  EPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSW  302



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 164/178 (92%), Gaps = 2/178 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  223  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGP-LKGVLDVC  436
            VLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A +   LKGVL VC
Sbjct  283  VLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACETEQLKGVLAVC  341

Query  435  DAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            D PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  342  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  399



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV++++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVSL
Sbjct  197  PFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVSL  256

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR+A++GP+KGVL V D
Sbjct  257  VLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFREAANGPMKGVLHVED  315

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            APLVS+DF+C+D S++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  316  APLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAKKW  372



>emb|CAC80374.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=317

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 146/160 (91%), Positives = 156/160 (98%), Gaps = 0/160 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF K++DEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  157  PFAKILDEEFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  216

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFRK++DGPL G+L VCD
Sbjct  217  VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFRKSADGPLNGILAVCD  276

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEW  313
             PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEW
Sbjct  277  VPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEW  316



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTT SYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  224  PFVKVLDQKFGIIKGTMTTTPSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  283

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR A++  LKG+L+VCD
Sbjct  284  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDAAEKELKGILEVCD  342

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  343  EPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  399



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   233 bits (594),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  228  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  287

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR+++D  L G+L VCD
Sbjct  288  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRESADKELAGILSVCD  346

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FG+VKG MTTTHSYTGDQR+LDASHRDLRRARAA LNIVPTSTGAAKAV+L
Sbjct  204  PFVKVIDEKFGLVKGLMTTTHSYTGDQRILDASHRDLRRARAACLNIVPTSTGAAKAVAL  263

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVV   KK  TA++VNAAFR+A++GPLKG+L V D
Sbjct  264  VLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKK-CTADEVNAAFREAANGPLKGILAVAD  322

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS DFRC+DVS TID++LTMVMGDDM+KVV+WYDNEWGYSQRVVDLA L A+ W
Sbjct  323  EPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSWYDNEWGYSQRVVDLAELCAANW  379



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  192  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  251

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGK NGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  LKG+L VCD
Sbjct  252  VLPNLKGKHNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRNSAEKELKGILKVCD  310

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDF+CSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  311  EPLVSVDFKCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  367



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FG+VKG MTTTHSYTGDQR+LDASHRDLRRARAA LNIVPTSTGAAKAV+L
Sbjct  202  PFVKVIDEKFGLVKGLMTTTHSYTGDQRILDASHRDLRRARAACLNIVPTSTGAAKAVAL  261

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVV   KK  TA++VNAAFR+A++GPLKG+L V D
Sbjct  262  VLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKK-CTADEVNAAFREAANGPLKGILAVAD  320

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS DFRC+DVS TID++LTMVMGDDM+KVV+WYDNEWGYSQRVVDLA L A+ W
Sbjct  321  EPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSWYDNEWGYSQRVVDLAELCAANW  377



>gb|ABD37956.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Spermatozopsis 
similis]
Length=263

 Score =   228 bits (581),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PF KV+D +FGIVKG MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+L
Sbjct  87   PFCKVLDAKFGIVKGVMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVAL  146

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNG ALRVPTPNVS+VDLV+ V+KK   AE+VN AFR+A+ G +KGVL VCD
Sbjct  147  VLPNLKGKLNGFALRVPTPNVSIVDLVIQVEKKTF-AEEVNNAFREAAAGEMKGVLAVCD  205

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVS +IDSSLTMVMGDDMVK+VAWYDNEWGYSQRVVDLA L ASKW
Sbjct  206  EPLVSVDFRCTDVSVSIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAELAASKW  262



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score =   230 bits (586),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  140  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  199

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   L G+L+VCD
Sbjct  200  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELIGILEVCD  258

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A KW
Sbjct  259  VPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICAIKW  315



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 164/178 (92%), Gaps = 2/178 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  229  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  288

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGP-LKGVLDVC  436
            VLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A +   LKGVL VC
Sbjct  289  VLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACETEQLKGVLAVC  347

Query  435  DAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            D PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  348  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  405



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 163/178 (92%), Gaps = 2/178 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  229  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  288

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGP-LKGVLDVC  436
            VLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A     LKGVL VC
Sbjct  289  VLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACQTEQLKGVLAVC  347

Query  435  DAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            D PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  348  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  405



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 163/178 (92%), Gaps = 2/178 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  201  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  260

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGP-LKGVLDVC  436
            VLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR A     LKGVL VC
Sbjct  261  VLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFRDACQTEQLKGVLAVC  319

Query  435  DAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            D PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  320  DEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  377



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV++++FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+L
Sbjct  192  PFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVAL  251

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR+A++GP+KGVL V D
Sbjct  252  VLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFREAANGPMKGVLHVED  310

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            APLVS+DF+C+D S++ID+SLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA + A KW
Sbjct  311  APLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAKKW  367



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  225  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  284

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR ++   L G+L+VCD
Sbjct  285  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDSAANELAGILEVCD  343

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            APLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  344  APLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  400



>gb|ABD37963.1| glyceraldehyde-3-phosphate dehydrogenase subunit A2 [Physcomitrella 
patens]
Length=323

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 165/178 (93%), Gaps = 2/178 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  146  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  205

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASD-GPLKGVLDVC  436
            VLP LKGK+NGIALRVPTPNVSVVDLVV V+KK  +AE+VN AFR A +   LKGVL VC
Sbjct  206  VLPNLKGKINGIALRVPTPNVSVVDLVVQVEKK-TSAEEVNQAFRDACNTDQLKGVLAVC  264

Query  435  DAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            D PLVSVDFRC+DVSST+DSSLTMVMG+DMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  265  DEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  322



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  229  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  288

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  L G+L VCD
Sbjct  289  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELNGILSVCD  347

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  348  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSW  404



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  269  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  328

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR  ++  LKG+L VCD
Sbjct  329  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDTAEKELKGILSVCD  387

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  388  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  444



>gb|ABK00053.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=393

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 155/171 (91%), Positives = 165/171 (96%), Gaps = 0/171 (0%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTG AKAVSL
Sbjct  223  PFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGVAKAVSL  282

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKGLTAEDVN AFR+A++GPLKG+L VCD
Sbjct  283  VLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGLTAEDVNNAFREAANGPLKGILAVCD  342

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH  280
             PLVS+DF CSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH
Sbjct  343  IPLVSIDFHCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAH  393



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   L G+L+VCD
Sbjct  287  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELTGILEVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A++W
Sbjct  346  VPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQW  402



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV++++FG+VKG MTTTHSYTGDQ++LDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  203  PFVKVLNDKFGLVKGLMTTTHSYTGDQKILDASHRDLRRARAAALNIVPTSTGAAKAVAL  262

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNGIALRVPTPNVSVVDLV+   KK +TAE+VN AFR+++ GPLKG+L VCD
Sbjct  263  VLPELKGKLNGIALRVPTPNVSVVDLVIQTSKK-VTAEEVNNAFRESAAGPLKGILSVCD  321

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+D S+TIDS+LTMV+GDDM+KVVAWYDNEWGYSQRVVDLA L A+ W
Sbjct  322  EPLVSVDFRCTDQSTTIDSALTMVIGDDMLKVVAWYDNEWGYSQRVVDLAELTAANW  378



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 165/178 (93%), Gaps = 2/178 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  199  PFVKVLDEKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  258

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASD-GPLKGVLDVC  436
            VLP LKGK+NGIALRVPTPNVSVVDLVV V+KK  +AE+VN AFR A +   LKGVL VC
Sbjct  259  VLPNLKGKINGIALRVPTPNVSVVDLVVQVEKK-TSAEEVNQAFRDACNTDQLKGVLAVC  317

Query  435  DAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
            D PLVSVDFRC+DVSST+DSSLTMVMG+DMVKVVAWYDNEWGYSQRVVDLA+LVA KW
Sbjct  318  DEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  375



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  207  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  266

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   L G+L+VCD
Sbjct  267  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELTGILEVCD  325

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A++W
Sbjct  326  VPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQW  382



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR A+   L G+L+VCD
Sbjct  287  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDAAANELTGILEVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQRVVDLA + A++W
Sbjct  346  VPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQW  402



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  179  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  238

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  L G+L VCD
Sbjct  239  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSAEKELAGILSVCD  297

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  298  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  354



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  228  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  287

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  L G+L VCD
Sbjct  288  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRDSAEKELNGILSVCD  346

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  EPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   230 bits (587),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  L G+L VCD
Sbjct  287  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSAEKELAGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  346  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   230 bits (587),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  L G+L VCD
Sbjct  287  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSAEKELAGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  346  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   230 bits (586),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +++  L G+L VCD
Sbjct  287  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSAEKELAGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  346  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +S   L G+L VCD
Sbjct  287  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSSAKELAGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  346  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 164/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVK++D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  226  PFVKILDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  285

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR ++   LKG+L+VCD
Sbjct  286  VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFRDSAANELKGILEVCD  344

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVS TID+SL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  345  VPLVSVDFRCSDVSCTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  401



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   230 bits (586),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  227  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  286

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR +S   L G+L VCD
Sbjct  287  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFRDSSAKELAGILSVCD  345

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  346  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  402



>gb|ACX37507.1| chloroplast glyceraldehyde 3-phosphate dehydrogenase [Botryococcus 
braunii]
Length=411

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+ GIVKGT+TTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+L
Sbjct  235  PFVKVLDEKLGIVKGTVTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVAL  294

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VN AFR+A++GP+KG+L V D
Sbjct  295  VLPNLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNEAFREAANGPMKGILVVSD  353

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS DF CSD SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA +VA KW
Sbjct  354  EPLVSKDFACSDQSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEIVAKKW  410



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 165/177 (93%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  232  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  291

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAF+++++  L+G+L VC+
Sbjct  292  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFKESAEKELQGILSVCE  350

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  351  EPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSW  407



>ref|XP_011399143.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+++ FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+L
Sbjct  236  PFVKVLNDRFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVAL  295

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNG+ALRVPTP VSVVDLV+  +KK  T E+VN+AFR+AS+G LKG+L V D
Sbjct  296  VLPQLKGKLNGVALRVPTPTVSVVDLVIQTEKKTFT-EEVNSAFREASEGYLKGILAVSD  354

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS D+R +DVSSTID++LTMVMGDDMVKV+AWYDNEWGYSQRVVDLA LVA KW
Sbjct  355  EPLVSCDYRMTDVSSTIDAALTMVMGDDMVKVIAWYDNEWGYSQRVVDLAELVAQKW  411



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++F I+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  228  PFVKVLDQKFSIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  287

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++++  L G+L VCD
Sbjct  288  VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFRESAEKELNGILSVCD  346

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  EPLVSVDFRCTDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



>gb|ABD37953.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorella 
sp. JP-2005]
Length=316

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+DE+FGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+L
Sbjct  140  PFVKVLDEKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVAL  199

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP+LKGKLNG+ALRVPTP VSVVDLVV V+KK   AE+VN AFR+A++GPLKG+L V D
Sbjct  200  VLPKLKGKLNGVALRVPTPTVSVVDLVVQVEKKTF-AEEVNEAFREAANGPLKGILGVSD  258

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS DF+ ++VSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLA   A  W
Sbjct  259  EPLVSCDFKMTNVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAAYTAKHW  315



>gb|ABD37957.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cladophora 
rupestris]
Length=376

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 163/177 (92%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+ E+FG+VKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+L
Sbjct  200  PFVKVIVEKFGVVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVAL  259

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK L AE+VN AFR A+ GPLKGVL V D
Sbjct  260  VLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTL-AEEVNQAFRDAAAGPLKGVLGVAD  318

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVS+DF+ SDVS+TIDS+LTMVMGDDMVKVVAWYDNEWGYSQRV+DLA L A KW
Sbjct  319  IPLVSMDFKKSDVSTTIDSALTMVMGDDMVKVVAWYDNEWGYSQRVLDLAELCAEKW  375



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -3

Query  792  PFVKVMDEEFGIVKGTMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVSL  613
            PFVKV+D++FGI+KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+L
Sbjct  228  PFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL  287

Query  612  VLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCD  433
            VLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VN AFR ++   L G+L VCD
Sbjct  288  VLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNEAFRDSAAKELSGILSVCD  346

Query  432  APLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  262
             PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct  347  EPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW  403



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1726355462650