BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF038B15

Length=871
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611838.1|  PREDICTED: basic 7S globulin-like                  227   2e-67   Nicotiana tomentosiformis
ref|XP_004229435.1|  PREDICTED: basic 7S globulin-like                  226   7e-67   Solanum lycopersicum
ref|XP_006339396.1|  PREDICTED: basic 7S globulin-like                  223   8e-66   Solanum tuberosum [potatoes]
emb|CDO98999.1|  unnamed protein product                                194   9e-55   Coffea canephora [robusta coffee]
ref|XP_007034626.1|  Eukaryotic aspartyl protease family protein,...    191   2e-53   
ref|XP_002517162.1|  basic 7S globulin 2 precursor small subunit,...    189   6e-53   Ricinus communis
ref|XP_002272235.1|  PREDICTED: basic 7S globulin                       186   3e-51   Vitis vinifera
emb|CAN80378.1|  hypothetical protein VITISV_038701                     185   4e-51   Vitis vinifera
gb|KEH36785.1|  eukaryotic aspartyl protease family protein             184   6e-51   Medicago truncatula
emb|CDP03612.1|  unnamed protein product                                178   2e-50   Coffea canephora [robusta coffee]
ref|XP_002280508.1|  PREDICTED: basic 7S globulin                       181   3e-50   Vitis vinifera
ref|XP_010242827.1|  PREDICTED: basic 7S globulin-like                  182   7e-50   Nelumbo nucifera [Indian lotus]
gb|KDP40108.1|  hypothetical protein JCGZ_02106                         181   1e-49   Jatropha curcas
ref|XP_002284868.1|  PREDICTED: basic 7S globulin-like                  180   4e-49   Vitis vinifera
emb|CAN68736.1|  hypothetical protein VITISV_030193                     180   4e-49   Vitis vinifera
ref|XP_010255899.1|  PREDICTED: basic 7S globulin-like                  179   5e-49   Nelumbo nucifera [Indian lotus]
ref|XP_011090791.1|  PREDICTED: basic 7S globulin                       179   6e-49   Sesamum indicum [beniseed]
gb|KDP21480.1|  hypothetical protein JCGZ_21951                         179   7e-49   Jatropha curcas
ref|XP_004486144.1|  PREDICTED: basic 7S globulin-like                  178   1e-48   Cicer arietinum [garbanzo]
emb|CAN61502.1|  hypothetical protein VITISV_011733                     177   2e-48   Vitis vinifera
ref|XP_011026191.1|  PREDICTED: basic 7S globulin-like                  177   5e-48   Populus euphratica
gb|EYU38145.1|  hypothetical protein MIMGU_mgv1a006647mg                177   5e-48   Erythranthe guttata [common monkey flower]
ref|XP_011014389.1|  PREDICTED: basic 7S globulin-like                  176   7e-48   Populus euphratica
ref|XP_007154121.1|  hypothetical protein PHAVU_003G092100g             175   1e-47   Phaseolus vulgaris [French bean]
emb|CBI32364.3|  unnamed protein product                                174   1e-47   Vitis vinifera
ref|XP_002302122.1|  hypothetical protein POPTR_0002s05580g             175   2e-47   Populus trichocarpa [western balsam poplar]
ref|XP_007154122.1|  hypothetical protein PHAVU_003G092200g             175   3e-47   Phaseolus vulgaris [French bean]
ref|XP_006489581.1|  PREDICTED: basic 7S globulin-like                  174   7e-47   
gb|KDO74788.1|  hypothetical protein CISIN_1g036132mg                   174   7e-47   Citrus sinensis [apfelsine]
gb|KJB61114.1|  hypothetical protein B456_009G341600                    173   7e-47   Gossypium raimondii
gb|KDP40112.1|  hypothetical protein JCGZ_02110                         173   8e-47   Jatropha curcas
ref|XP_009411762.1|  PREDICTED: basic 7S globulin-like                  173   1e-46   
ref|XP_011082548.1|  PREDICTED: basic 7S globulin-like                  172   2e-46   Sesamum indicum [beniseed]
ref|XP_008222987.1|  PREDICTED: basic 7S globulin-like                  172   3e-46   Prunus mume [ume]
ref|XP_008810759.1|  PREDICTED: basic 7S globulin-like                  172   3e-46   
emb|CDP10858.1|  unnamed protein product                                171   5e-46   Coffea canephora [robusta coffee]
gb|KHN03053.1|  Basic 7S globulin                                       171   6e-46   Glycine soja [wild soybean]
ref|NP_001239980.1|  uncharacterized protein LOC100806719 precursor     171   6e-46   Glycine max [soybeans]
ref|XP_010255900.1|  PREDICTED: basic 7S globulin 2-like                171   9e-46   Nelumbo nucifera [Indian lotus]
ref|XP_002517165.1|  basic 7S globulin 2 precursor small subunit,...    170   1e-45   Ricinus communis
ref|XP_003590665.1|  Xyloglucan-specific endoglucanase inhibitor ...    170   1e-45   Medicago truncatula
ref|XP_010035593.1|  PREDICTED: basic 7S globulin-like                  170   1e-45   Eucalyptus grandis [rose gum]
ref|XP_011020124.1|  PREDICTED: basic 7S globulin-like                  169   3e-45   Populus euphratica
gb|AFK46427.1|  unknown                                                 169   3e-45   Medicago truncatula
ref|XP_002308984.2|  hypothetical protein POPTR_0006s06820g             169   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_006419808.1|  hypothetical protein CICLE_v10006987mg             169   3e-45   Citrus clementina [clementine]
ref|XP_006419833.1|  hypothetical protein CICLE_v10006689mg             169   4e-45   Citrus clementina [clementine]
ref|XP_003542884.1|  PREDICTED: basic 7S globulin                       168   4e-45   Glycine max [soybeans]
ref|XP_009342158.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    168   5e-45   Pyrus x bretschneideri [bai li]
gb|KJB46995.1|  hypothetical protein B456_008G005100                    169   5e-45   Gossypium raimondii
ref|XP_003518926.1|  PREDICTED: basic 7S globulin                       168   6e-45   Glycine max [soybeans]
gb|KHN03449.1|  Basic 7S globulin                                       168   6e-45   Glycine soja [wild soybean]
ref|XP_003550008.2|  PREDICTED: basic 7S globulin 2-like                168   7e-45   
ref|XP_002311834.1|  hypothetical protein POPTR_0008s20730g             168   8e-45   Populus trichocarpa [western balsam poplar]
gb|ACU24232.1|  unknown                                                 167   1e-44   Glycine max [soybeans]
ref|XP_007224886.1|  hypothetical protein PRUPE_ppa022337mg             166   2e-44   
ref|XP_010278291.1|  PREDICTED: basic 7S globulin-like                  167   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_006419831.1|  hypothetical protein CICLE_v10006962mg             167   2e-44   Citrus clementina [clementine]
ref|XP_003546133.1|  PREDICTED: basic 7S globulin                       166   3e-44   Glycine max [soybeans]
gb|KFK42681.1|  hypothetical protein AALP_AA1G026100                    166   3e-44   Arabis alpina [alpine rockcress]
ref|XP_006489295.1|  PREDICTED: basic 7S globulin-like                  166   4e-44   Citrus sinensis [apfelsine]
ref|XP_010938774.1|  PREDICTED: basic 7S globulin-like                  166   5e-44   Elaeis guineensis
ref|XP_006489296.1|  PREDICTED: basic 7S globulin-like                  166   5e-44   Citrus sinensis [apfelsine]
gb|KFK42682.1|  hypothetical protein AALP_AA1G026200                    166   5e-44   Arabis alpina [alpine rockcress]
ref|XP_006489297.1|  PREDICTED: basic 7S globulin-like                  166   5e-44   
ref|XP_004298169.1|  PREDICTED: basic 7S globulin-like                  166   5e-44   Fragaria vesca subsp. vesca
ref|XP_002277699.1|  PREDICTED: basic 7S globulin-like                  166   6e-44   Vitis vinifera
ref|XP_006419829.1|  hypothetical protein CICLE_v100071811mg            163   7e-44   
ref|XP_011011197.1|  PREDICTED: basic 7S globulin-like isoform X2       166   7e-44   Populus euphratica
ref|XP_011015097.1|  PREDICTED: basic 7S globulin-like isoform X2       165   8e-44   Populus euphratica
ref|XP_011015096.1|  PREDICTED: basic 7S globulin-like isoform X1       165   9e-44   Populus euphratica
ref|XP_011011196.1|  PREDICTED: basic 7S globulin-like isoform X1       165   1e-43   Populus euphratica
ref|XP_007201544.1|  hypothetical protein PRUPE_ppa017430mg             164   1e-43   
gb|KJB23117.1|  hypothetical protein B456_004G081800                    165   1e-43   Gossypium raimondii
ref|XP_008235257.1|  PREDICTED: basic 7S globulin 2-like                166   1e-43   Prunus mume [ume]
emb|CDX86682.1|  BnaC08g00210D                                          164   1e-43   
ref|XP_003590668.1|  Basic 7S globulin                                  165   2e-43   Medicago truncatula
ref|XP_004290668.1|  PREDICTED: basic 7S globulin 2-like                165   2e-43   Fragaria vesca subsp. vesca
emb|CDY15456.1|  BnaA08g27400D                                          164   2e-43   Brassica napus [oilseed rape]
ref|XP_006419811.1|  hypothetical protein CICLE_v10004995mg             164   2e-43   
ref|XP_006419809.1|  hypothetical protein CICLE_v10004993mg             164   2e-43   Citrus clementina [clementine]
ref|XP_008340919.1|  PREDICTED: basic 7S globulin                       162   5e-43   
ref|XP_006489309.1|  PREDICTED: basic 7S globulin-like                  163   5e-43   Citrus sinensis [apfelsine]
gb|KDO74795.1|  hypothetical protein CISIN_1g037976mg                   163   6e-43   Citrus sinensis [apfelsine]
gb|KDO74801.1|  hypothetical protein CISIN_1g040581mg                   162   7e-43   Citrus sinensis [apfelsine]
ref|XP_006489306.1|  PREDICTED: basic 7S globulin-like                  162   7e-43   Citrus sinensis [apfelsine]
ref|XP_006419821.1|  hypothetical protein CICLE_v10005127mg             162   1e-42   Citrus clementina [clementine]
ref|XP_008222998.1|  PREDICTED: basic 7S globulin 2                     162   1e-42   Prunus mume [ume]
ref|XP_006387875.1|  hypothetical protein POPTR_0509s00200g             161   1e-42   
ref|XP_008390829.1|  PREDICTED: basic 7S globulin-like                  162   2e-42   Malus domestica [apple tree]
ref|XP_007034627.1|  Eukaryotic aspartyl protease family protein,...    162   2e-42   
ref|XP_007034630.1|  Eukaryotic aspartyl protease family protein ...    160   2e-42   
gb|EMS47745.1|  Basic 7S globulin                                       159   2e-42   Triticum urartu
ref|XP_006495483.1|  PREDICTED: basic 7S globulin-like                  154   3e-42   
gb|KEH36784.1|  xyloglucanase-specific endoglucanase inhibitor pr...    161   3e-42   Medicago truncatula
ref|XP_008458562.1|  PREDICTED: basic 7S globulin-like                  160   3e-42   Cucumis melo [Oriental melon]
ref|XP_007222421.1|  hypothetical protein PRUPE_ppa006071mg             161   4e-42   
ref|NP_001241217.1|  uncharacterized protein LOC100818868 precursor     161   4e-42   Glycine max [soybeans]
ref|XP_008438716.1|  PREDICTED: basic 7S globulin-like isoform X1       160   5e-42   
ref|XP_006380060.1|  hypothetical protein POPTR_0008s20740g             160   6e-42   
ref|XP_009364261.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    160   8e-42   Pyrus x bretschneideri [bai li]
ref|XP_004134152.1|  PREDICTED: basic 7S globulin-like                  160   1e-41   Cucumis sativus [cucumbers]
ref|XP_007034629.1|  Eukaryotic aspartyl protease family protein ...    160   1e-41   
ref|XP_004236054.1|  PREDICTED: basic 7S globulin-like                  159   2e-41   Solanum lycopersicum
dbj|BAA03413.1|  EDGP precursor                                         159   2e-41   Daucus carota [carrots]
ref|XP_006418255.1|  hypothetical protein EUTSA_v10007672mg             159   2e-41   Eutrema salsugineum [saltwater cress]
gb|AAX81588.1|  nectarin IV                                             159   2e-41   Nicotiana langsdorffii x Nicotiana sanderae
pdb|3VLA|A  Chain A, Crystal Structure Of Edgp                          159   2e-41   Daucus carota [carrots]
ref|XP_007034624.1|  Eukaryotic aspartyl protease family protein,...    158   2e-41   
pdb|3VLB|A  Chain A, Crystal Structure Of Xeg-edgp                      158   2e-41   Aspergillus aculeatus
ref|XP_010522713.1|  PREDICTED: basic 7S globulin-like                  159   2e-41   Tarenaya hassleriana [spider flower]
gb|KCW49914.1|  hypothetical protein EUGRSUZ_K03381                     158   3e-41   Eucalyptus grandis [rose gum]
ref|XP_004151001.1|  PREDICTED: basic 7S globulin-like                  158   3e-41   Cucumis sativus [cucumbers]
ref|XP_009111159.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    158   4e-41   Brassica rapa
gb|KJB25917.1|  hypothetical protein B456_004G215700                    158   4e-41   Gossypium raimondii
ref|XP_010038106.1|  PREDICTED: basic 7S globulin 2-like                158   4e-41   Eucalyptus grandis [rose gum]
ref|XP_002517164.1|  basic 7S globulin 2 precursor small subunit,...    158   5e-41   Ricinus communis
ref|XP_009611839.1|  PREDICTED: basic 7S globulin-like                  157   6e-41   Nicotiana tomentosiformis
gb|ACM68432.1|  xyloglucanase-specific endoglucanase inhibitor pr...    157   6e-41   Petunia x hybrida [garden petunia]
gb|AIL30493.1|  xyloglucan-specific fungal endoglucanase inhibito...    157   7e-41   Nicotiana tabacum [American tobacco]
ref|XP_010556788.1|  PREDICTED: basic 7S globulin-like                  158   7e-41   Tarenaya hassleriana [spider flower]
ref|XP_010255898.1|  PREDICTED: basic 7S globulin-like                  157   7e-41   
ref|XP_006345120.1|  PREDICTED: basic 7S globulin-like                  157   8e-41   Solanum tuberosum [potatoes]
ref|XP_010522709.1|  PREDICTED: basic 7S globulin-like                  157   9e-41   
ref|XP_011099700.1|  PREDICTED: basic 7S globulin-like                  157   9e-41   
gb|AAP84703.1|  putative xyloglucanase inhibitor                        157   1e-40   Solanum tuberosum [potatoes]
ref|XP_004495218.1|  PREDICTED: basic 7S globulin 2-like                157   1e-40   Cicer arietinum [garbanzo]
ref|XP_006419823.1|  hypothetical protein CICLE_v10005035mg             156   2e-40   Citrus clementina [clementine]
ref|NP_001234746.1|  xyloglucan-specific fungal endoglucanase inh...    156   2e-40   
ref|XP_010457326.1|  PREDICTED: basic 7S globulin-like                  156   2e-40   
gb|AFK34779.1|  unknown                                                 156   2e-40   Medicago truncatula
ref|XP_010111673.1|  Basic 7S globulin                                  156   2e-40   Morus notabilis
ref|XP_010474940.1|  PREDICTED: basic 7S globulin-like                  156   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_003637703.1|  Basic 7S globulin                                  156   2e-40   
gb|KCW49915.1|  hypothetical protein EUGRSUZ_K03382                     155   2e-40   Eucalyptus grandis [rose gum]
gb|KDO35982.1|  hypothetical protein CISIN_1g037784mg                   151   2e-40   Citrus sinensis [apfelsine]
ref|XP_010481702.1|  PREDICTED: basic 7S globulin-like                  156   3e-40   Camelina sativa [gold-of-pleasure]
dbj|BAJ94733.1|  predicted protein                                      155   3e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK57511.1|  extracellular dermal glycoprotein                      156   3e-40   Nicotiana benthamiana
ref|NP_563679.1|  aspartyl protease-like protein                        156   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147764.1|  hypothetical protein PHAVU_006G153200g             155   3e-40   Phaseolus vulgaris [French bean]
ref|XP_009773897.1|  PREDICTED: basic 7S globulin-like                  155   3e-40   Nicotiana sylvestris
ref|XP_006419825.1|  hypothetical protein CICLE_v10007108mg             155   3e-40   
ref|XP_004170412.1|  PREDICTED: basic 7S globulin-like                  155   4e-40   
ref|XP_010278299.1|  PREDICTED: basic 7S globulin-like                  155   4e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010038107.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    155   4e-40   
ref|XP_006304586.1|  hypothetical protein CARUB_v10011636mg             155   4e-40   Capsella rubella
ref|XP_002889446.1|  EDGP precursor                                     155   5e-40   
emb|CDO98879.1|  unnamed protein product                                155   5e-40   Coffea canephora [robusta coffee]
gb|KDP40110.1|  hypothetical protein JCGZ_02108                         155   6e-40   Jatropha curcas
ref|XP_009757289.1|  PREDICTED: basic 7S globulin-like                  154   8e-40   Nicotiana sylvestris
ref|XP_004486304.1|  PREDICTED: basic 7S globulin 2-like                154   9e-40   Cicer arietinum [garbanzo]
ref|XP_006345119.1|  PREDICTED: basic 7S globulin-like                  154   9e-40   Solanum tuberosum [potatoes]
gb|ACM68431.1|  xyloglucan-specific endoglucanase inhibitor protein     154   9e-40   Capsicum annuum
ref|XP_007144622.1|  hypothetical protein PHAVU_007G170900g             154   1e-39   Phaseolus vulgaris [French bean]
ref|NP_171821.1|  aspartyl protease-like protein                        154   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008222995.1|  PREDICTED: basic 7S globulin-like                  154   1e-39   Prunus mume [ume]
ref|XP_007224945.1|  hypothetical protein PRUPE_ppa021451mg             154   2e-39   Prunus persica
ref|NP_001234249.1|  xyloglucan-specific fungal endoglucanase inh...    154   2e-39   
ref|XP_006296506.1|  hypothetical protein CARUB_v10025694mg             153   3e-39   Capsella rubella
ref|XP_004134154.1|  PREDICTED: basic 7S globulin-like                  153   3e-39   Cucumis sativus [cucumbers]
ref|XP_010483190.1|  PREDICTED: basic 7S globulin-like                  153   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006419827.1|  hypothetical protein CICLE_v10005000mg             153   3e-39   Citrus clementina [clementine]
gb|KDO74796.1|  hypothetical protein CISIN_1g038219mg                   153   3e-39   Citrus sinensis [apfelsine]
ref|XP_010457449.1|  PREDICTED: basic 7S globulin-like                  153   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010475063.1|  PREDICTED: basic 7S globulin-like                  153   3e-39   Camelina sativa [gold-of-pleasure]
gb|AAT85209.1|  unknown protein                                         149   3e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009118711.1|  PREDICTED: basic 7S globulin-like                  152   4e-39   Brassica rapa
gb|KCW58886.1|  hypothetical protein EUGRSUZ_H01512                     151   4e-39   Eucalyptus grandis [rose gum]
emb|CDY32500.1|  BnaA09g50960D                                          152   5e-39   Brassica napus [oilseed rape]
ref|XP_008438715.1|  PREDICTED: basic 7S globulin-like                  152   6e-39   Cucumis melo [Oriental melon]
ref|XP_007162407.1|  hypothetical protein PHAVU_001G149500g             152   6e-39   Phaseolus vulgaris [French bean]
gb|KCW58887.1|  hypothetical protein EUGRSUZ_H01513                     152   6e-39   Eucalyptus grandis [rose gum]
gb|KCW58889.1|  hypothetical protein EUGRSUZ_H015141                    146   9e-39   Eucalyptus grandis [rose gum]
ref|XP_010026235.1|  PREDICTED: basic 7S globulin-like                  152   9e-39   Eucalyptus grandis [rose gum]
ref|XP_004170542.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    152   1e-38   
ref|XP_009595035.1|  PREDICTED: basic 7S globulin-like                  152   1e-38   Nicotiana tomentosiformis
ref|XP_004134153.1|  PREDICTED: basic 7S globulin-like                  151   1e-38   Cucumis sativus [cucumbers]
ref|XP_002877156.1|  hypothetical protein ARALYDRAFT_484681             151   1e-38   
ref|XP_006489307.1|  PREDICTED: basic 7S globulin-like                  151   1e-38   Citrus sinensis [apfelsine]
ref|XP_010026234.1|  PREDICTED: basic 7S globulin-like                  150   1e-38   Eucalyptus grandis [rose gum]
gb|AAM61574.1|  EDGP precursor                                          151   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006489308.1|  PREDICTED: basic 7S globulin-like                  151   1e-38   Citrus sinensis [apfelsine]
ref|XP_007034628.1|  Eukaryotic aspartyl protease family protein,...    150   1e-38   
ref|XP_009356759.1|  PREDICTED: basic 7S globulin                       151   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_009342159.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    151   2e-38   Pyrus x bretschneideri [bai li]
gb|ACJ85243.1|  unknown                                                 146   2e-38   Medicago truncatula
ref|XP_008438718.1|  PREDICTED: basic 7S globulin-like                  151   2e-38   Cucumis melo [Oriental melon]
gb|ADG23123.1|  xyloglucan specific endoglucanase inhibitor             150   2e-38   Solanum melongena [aubergine]
ref|XP_008355568.1|  PREDICTED: basic 7S globulin-like                  150   2e-38   Malus domestica [apple tree]
gb|ADD71505.1|  xyloglucanase inhibitor 3                               150   3e-38   Humulus lupulus [common hop]
gb|EAY97992.1|  hypothetical protein OsI_19909                          149   6e-38   Oryza sativa Indica Group [Indian rice]
gb|KDO74797.1|  hypothetical protein CISIN_1g044303mg                   149   6e-38   Citrus sinensis [apfelsine]
ref|XP_004508379.1|  PREDICTED: basic 7S globulin-like                  149   7e-38   Cicer arietinum [garbanzo]
ref|XP_007050654.1|  Eukaryotic aspartyl protease family protein,...    149   8e-38   
ref|XP_010045852.1|  PREDICTED: basic 7S globulin-like                  149   8e-38   Eucalyptus grandis [rose gum]
gb|KCW84282.1|  hypothetical protein EUGRSUZ_B01133                     149   8e-38   Eucalyptus grandis [rose gum]
ref|XP_010678844.1|  PREDICTED: basic 7S globulin 2-like                149   1e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001055496.1|  Os05g0402900                                       149   1e-37   
gb|KJB26454.1|  hypothetical protein B456_004G242400                    149   1e-37   Gossypium raimondii
gb|EEE63670.1|  hypothetical protein OsJ_18488                          148   1e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009597883.1|  PREDICTED: basic 7S globulin-like                  149   1e-37   Nicotiana tomentosiformis
gb|KCW45638.1|  hypothetical protein EUGRSUZ_L005902                    143   3e-37   Eucalyptus grandis [rose gum]
ref|XP_008649625.1|  PREDICTED: basic 7S globulin-like                  147   3e-37   Zea mays [maize]
gb|KDP25943.1|  hypothetical protein JCGZ_22848                         147   3e-37   Jatropha curcas
ref|XP_006366973.1|  PREDICTED: basic 7S globulin-like                  146   4e-37   
ref|XP_006419822.1|  hypothetical protein CICLE_v10007187mg             147   5e-37   Citrus clementina [clementine]
ref|XP_009773278.1|  PREDICTED: basic 7S globulin-like                  147   5e-37   Nicotiana sylvestris
ref|XP_011079830.1|  PREDICTED: basic 7S globulin-like                  146   5e-37   Sesamum indicum [beniseed]
gb|KJB45207.1|  hypothetical protein B456_007G295400                    147   5e-37   Gossypium raimondii
gb|KDO74800.1|  hypothetical protein CISIN_1g036447mg                   145   5e-37   Citrus sinensis [apfelsine]
ref|XP_007030900.1|  Eukaryotic aspartyl protease family protein,...    147   6e-37   Theobroma cacao [chocolate]
gb|AAT85211.1|  hypothetical protein                                    147   7e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003520561.1|  PREDICTED: basic 7S globulin-like                  146   7e-37   Glycine max [soybeans]
gb|KDP21481.1|  hypothetical protein JCGZ_21952                         147   7e-37   Jatropha curcas
ref|XP_006472113.1|  PREDICTED: basic 7S globulin-like                  143   7e-37   
ref|XP_002272199.2|  PREDICTED: basic 7S globulin 2-like                147   8e-37   Vitis vinifera
gb|KDO74789.1|  hypothetical protein CISIN_1g014679mg                   146   1e-36   Citrus sinensis [apfelsine]
ref|XP_006489578.1|  PREDICTED: basic 7S globulin-like                  145   1e-36   Citrus sinensis [apfelsine]
ref|XP_004229432.1|  PREDICTED: basic 7S globulin-like                  146   1e-36   Solanum lycopersicum
gb|KJB70565.1|  hypothetical protein B456_011G080800                    145   2e-36   Gossypium raimondii
gb|KCW84281.1|  hypothetical protein EUGRSUZ_B01132                     143   2e-36   Eucalyptus grandis [rose gum]
ref|XP_006654378.1|  PREDICTED: basic 7S globulin-like                  145   2e-36   Oryza brachyantha
gb|AES60912.2|  xyloglucanase-specific endoglucanase inhibitor pr...    145   2e-36   Medicago truncatula
ref|XP_009625778.1|  PREDICTED: basic 7S globulin-like                  145   2e-36   Nicotiana tomentosiformis
ref|XP_010026236.1|  PREDICTED: basic 7S globulin-like                  145   2e-36   Eucalyptus grandis [rose gum]
ref|XP_010024401.1|  PREDICTED: basic 7S globulin 2-like                145   3e-36   Eucalyptus grandis [rose gum]
ref|NP_001174419.1|  Os05g0403000                                       145   3e-36   
ref|XP_004962140.1|  PREDICTED: basic 7S globulin-like                  145   3e-36   Setaria italica
ref|XP_006419826.1|  hypothetical protein CICLE_v10006501mg             144   3e-36   
ref|XP_003590661.1|  Basic 7S globulin                                  145   3e-36   
ref|XP_004229434.1|  PREDICTED: basic 7S globulin-like                  145   3e-36   Solanum lycopersicum
ref|XP_006349243.1|  PREDICTED: basic 7S globulin-like                  144   4e-36   
ref|XP_006433276.1|  hypothetical protein CICLE_v10003944mg             144   4e-36   
ref|NP_001274964.1|  xyloglucan-specific endoglucanase inhibitor ...    144   6e-36   Solanum tuberosum [potatoes]
emb|CDY15455.1|  BnaA08g27390D                                          144   7e-36   Brassica napus [oilseed rape]
ref|XP_006371344.1|  hypothetical protein POPTR_0019s09280g             144   9e-36   
ref|XP_004247154.1|  PREDICTED: basic 7S globulin-like                  143   9e-36   Solanum lycopersicum
ref|XP_002517167.1|  basic 7S globulin 2 precursor small subunit,...    143   1e-35   Ricinus communis
gb|KCW60840.1|  hypothetical protein EUGRSUZ_H03578                     142   2e-35   Eucalyptus grandis [rose gum]
ref|XP_009787261.1|  PREDICTED: basic 7S globulin-like                  142   2e-35   Nicotiana sylvestris
ref|XP_006489313.1|  PREDICTED: basic 7S globulin-like                  142   2e-35   Citrus sinensis [apfelsine]
ref|XP_011005003.1|  PREDICTED: basic 7S globulin-like                  139   2e-35   Populus euphratica
ref|XP_010026985.1|  PREDICTED: basic 7S globulin-like                  142   2e-35   
ref|XP_006419832.1|  hypothetical protein CICLE_v10005038mg             142   2e-35   Citrus clementina [clementine]
gb|EYU20615.1|  hypothetical protein MIMGU_mgv1a006692mg                142   2e-35   Erythranthe guttata [common monkey flower]
ref|XP_009111160.1|  PREDICTED: basic 7S globulin-like                  142   3e-35   Brassica rapa
ref|XP_009591595.1|  PREDICTED: basic 7S globulin-like                  142   3e-35   
ref|XP_009596039.1|  PREDICTED: basic 7S globulin-like                  142   3e-35   Nicotiana tomentosiformis
ref|XP_010035585.1|  PREDICTED: basic 7S globulin                       142   3e-35   Eucalyptus grandis [rose gum]
gb|KDP40111.1|  hypothetical protein JCGZ_02109                         139   4e-35   Jatropha curcas
gb|KCW60850.1|  hypothetical protein EUGRSUZ_H03588                     141   4e-35   Eucalyptus grandis [rose gum]
gb|EYU20619.1|  hypothetical protein MIMGU_mgv1a026442mg                141   5e-35   Erythranthe guttata [common monkey flower]
ref|XP_011082639.1|  PREDICTED: basic 7S globulin 2-like                141   5e-35   
ref|XP_010999511.1|  PREDICTED: basic 7S globulin-like                  141   7e-35   Populus euphratica
ref|XP_006349245.1|  PREDICTED: basic 7S globulin-like                  141   9e-35   Solanum tuberosum [potatoes]
ref|XP_006371346.1|  hypothetical protein POPTR_0019s09300g             141   9e-35   Populus trichocarpa [western balsam poplar]
gb|EYU20620.1|  hypothetical protein MIMGU_mgv1a006733mg                140   9e-35   Erythranthe guttata [common monkey flower]
ref|XP_003591797.1|  Xyloglucan-specific endoglucanase inhibitor ...    140   1e-34   Medicago truncatula
gb|KEH36782.1|  xyloglucanase-specific endoglucanase inhibitor pr...    140   1e-34   Medicago truncatula
ref|XP_006388012.1|  hypothetical protein POPTR_0397s00200g             140   2e-34   
gb|KDP40109.1|  hypothetical protein JCGZ_02107                         139   2e-34   Jatropha curcas
ref|XP_006850763.1|  hypothetical protein AMTR_s00025p00079140          140   2e-34   Amborella trichopoda
gb|EPS72958.1|  hypothetical protein M569_01796                         139   2e-34   Genlisea aurea
ref|XP_009769391.1|  PREDICTED: basic 7S globulin-like                  140   2e-34   Nicotiana sylvestris
ref|XP_011462765.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    139   3e-34   Fragaria vesca subsp. vesca
ref|XP_006369525.1|  hypothetical protein POPTR_0001s24740g             139   4e-34   Populus trichocarpa [western balsam poplar]
gb|AHG54973.1|  xyloglucan-specific endoglucanase inhibitor 10          139   4e-34   Solanum tuberosum [potatoes]
gb|ADD71504.1|  xyloglucanase inhibitor 2                               139   5e-34   Humulus lupulus [common hop]
ref|XP_006371347.1|  hypothetical protein POPTR_0019s09310g             139   5e-34   
gb|EPS73324.1|  hypothetical protein M569_01438                         139   5e-34   Genlisea aurea
ref|XP_010256207.1|  PREDICTED: basic 7S globulin 2-like                139   6e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006371348.1|  hypothetical protein POPTR_0019s09320g             139   6e-34   
ref|XP_010325564.1|  PREDICTED: basic 7S globulin-like                  138   6e-34   Solanum lycopersicum
ref|XP_002517163.1|  basic 7S globulin 2 precursor small subunit,...    139   7e-34   
ref|XP_010039912.1|  PREDICTED: basic 7S globulin-like                  138   7e-34   Eucalyptus grandis [rose gum]
ref|XP_006388043.1|  hypothetical protein POPTR_0382s00210g             138   8e-34   
ref|XP_006352883.1|  PREDICTED: basic 7S globulin-like isoform X1       136   2e-33   Solanum tuberosum [potatoes]
ref|XP_007143872.1|  hypothetical protein PHAVU_007G109000g             137   2e-33   Phaseolus vulgaris [French bean]
ref|XP_008363982.1|  PREDICTED: basic 7S globulin-like                  137   2e-33   
gb|ADD71503.1|  xyloglucanase inhibitor 1                               136   3e-33   
ref|XP_010420702.1|  PREDICTED: basic 7S globulin 2-like                135   3e-33   
ref|XP_003568479.1|  PREDICTED: basic 7S globulin-like                  136   3e-33   
gb|AFK42891.1|  unknown                                                 135   3e-33   
ref|XP_010045855.1|  PREDICTED: basic 7S globulin-like                  135   4e-33   
emb|CAN68737.1|  hypothetical protein VITISV_030194                     136   4e-33   
ref|XP_004495384.1|  PREDICTED: basic 7S globulin-like                  136   4e-33   
ref|XP_010659830.1|  PREDICTED: basic 7S globulin-like                  136   5e-33   
ref|XP_006371343.1|  hypothetical protein POPTR_0019s09270g             136   5e-33   
gb|EYU20616.1|  hypothetical protein MIMGU_mgv1a026206mg                135   6e-33   
gb|KCW84284.1|  hypothetical protein EUGRSUZ_B01136                     135   6e-33   
gb|KEH36786.1|  extracellular dermal glycoprotein                       135   6e-33   
ref|XP_011091047.1|  PREDICTED: basic 7S globulin 2-like                135   7e-33   
gb|ADK87883.1|  AtV9-like protein                                       129   7e-33   
gb|EYU20618.1|  hypothetical protein MIMGU_mgv1a018279mg                135   8e-33   
ref|XP_010999512.1|  PREDICTED: basic 7S globulin-like                  135   8e-33   
gb|ADK87894.1|  AtV9-like protein                                       129   8e-33   
ref|XP_004231264.1|  PREDICTED: basic 7S globulin-like                  135   1e-32   
ref|XP_004495219.1|  PREDICTED: basic 7S globulin-like                  134   2e-32   
gb|AFK42416.1|  unknown                                                 134   2e-32   
gb|EEE63673.1|  hypothetical protein OsJ_18491                          134   2e-32   
gb|EEE63672.1|  hypothetical protein OsJ_18490                          134   2e-32   
gb|ADK87882.1|  AtV9-like protein                                       128   2e-32   
gb|ADK87876.1|  AtV9-like protein                                       128   2e-32   
ref|NP_001055497.1|  Os05g0403300                                       134   2e-32   
gb|KFK26154.1|  hypothetical protein AALP_AA8G210500                    133   3e-32   
ref|XP_002517166.1|  ATP binding protein, putative                      132   3e-32   
gb|KHN30567.1|  Basic 7S globulin                                       134   3e-32   
ref|XP_004229433.1|  PREDICTED: basic 7S globulin-like                  133   4e-32   
ref|XP_003536212.1|  PREDICTED: basic 7S globulin-like                  133   4e-32   
gb|EYU41533.1|  hypothetical protein MIMGU_mgv1a011412mg                130   4e-32   
ref|XP_011011027.1|  PREDICTED: basic 7S globulin-like                  133   4e-32   
gb|EYU46598.1|  hypothetical protein MIMGU_mgv1a019870mg                132   5e-32   
gb|EYU41534.1|  hypothetical protein MIMGU_mgv1a008121mg                132   5e-32   
ref|XP_009613161.1|  PREDICTED: basic 7S globulin-like                  133   6e-32   
gb|ADK87896.1|  AtV9-like protein                                       126   7e-32   
gb|ADK87879.1|  AtV9-like protein                                       126   7e-32   
ref|XP_006654379.1|  PREDICTED: basic 7S globulin-like                  132   8e-32   
gb|ADK87880.1|  AtV9-like protein                                       126   8e-32   
ref|XP_002439768.1|  hypothetical protein SORBIDRAFT_09g019770          132   9e-32   
ref|XP_011091050.1|  PREDICTED: basic 7S globulin 2-like                132   1e-31   
ref|XP_004229563.2|  PREDICTED: basic 7S globulin-like                  130   1e-31   
emb|CBI26188.3|  unnamed protein product                                131   1e-31   
gb|KEH36787.1|  extracellular dermal glycoprotein                       132   1e-31   
gb|ABR17052.1|  unknown                                                 131   2e-31   
ref|XP_006361904.1|  PREDICTED: basic 7S globulin-like                  131   2e-31   
emb|CDX70865.1|  BnaC03g09490D                                          131   2e-31   
ref|XP_010026986.1|  PREDICTED: basic 7S globulin-like                  127   2e-31   
ref|XP_011091049.1|  PREDICTED: basic 7S globulin 2-like                130   3e-31   
ref|XP_006349258.1|  PREDICTED: basic 7S globulin-like                  130   3e-31   
ref|XP_006349246.1|  PREDICTED: basic 7S globulin-like                  131   3e-31   
ref|XP_010454178.1|  PREDICTED: basic 7S globulin 2-like                130   4e-31   
ref|XP_006850764.1|  hypothetical protein AMTR_s00025p00079520          130   5e-31   
ref|XP_009786807.1|  PREDICTED: basic 7S globulin-like                  130   5e-31   
ref|XP_003556387.1|  PREDICTED: basic 7S globulin                       130   6e-31   
ref|XP_011090790.1|  PREDICTED: basic 7S globulin-like                  130   6e-31   
ref|XP_011091048.1|  PREDICTED: basic 7S globulin-like                  129   8e-31   
ref|XP_009373976.1|  PREDICTED: basic 7S globulin-like                  129   9e-31   
ref|XP_010690125.1|  PREDICTED: basic 7S globulin-like                  129   9e-31   
ref|XP_006349244.1|  PREDICTED: basic 7S globulin-like                  129   9e-31   
ref|XP_009349976.1|  PREDICTED: basic 7S globulin-like                  129   9e-31   
ref|XP_002513220.1|  conserved hypothetical protein                     124   1e-30   
ref|XP_009615960.1|  PREDICTED: basic 7S globulin-like                  129   1e-30   
gb|AFF60302.1|  xyloglucanase-specific endoglucanase inhibitor          129   1e-30   
ref|XP_002871863.1|  pepsin A                                           128   1e-30   
ref|XP_004246190.2|  PREDICTED: basic 7S globulin-like                  129   1e-30   
ref|XP_010492960.1|  PREDICTED: basic 7S globulin 2-like                128   2e-30   
ref|XP_006388014.1|  hypothetical protein POPTR_0397s00220g             129   2e-30   
gb|EYU41536.1|  hypothetical protein MIMGU_mgv1a024772mg                128   2e-30   
ref|XP_004486143.1|  PREDICTED: basic 7S globulin-like                  128   2e-30   
gb|EYU41535.1|  hypothetical protein MIMGU_mgv1a007318mg                128   3e-30   
ref|XP_006382966.1|  hypothetical protein POPTR_0005s09840g             128   3e-30   
ref|NP_197413.1|  aspartyl protease family protein                      127   4e-30   
gb|KDP23539.1|  hypothetical protein JCGZ_23372                         123   4e-30   
ref|XP_006844967.1|  hypothetical protein AMTR_s00058p00179910          127   6e-30   
gb|KEH36777.1|  extracellular dermal glycoprotein                       127   7e-30   
emb|CAC10209.1|  putative extracellular dermal glycoprotein             126   7e-30   
emb|CDP19874.1|  unnamed protein product                                127   8e-30   
ref|XP_004246189.2|  PREDICTED: basic 7S globulin-like                  127   8e-30   
gb|AGT17598.1|  xyloglucan-specific endoglucanase inhibitor 11          127   9e-30   
ref|XP_004229431.1|  PREDICTED: basic 7S globulin-like                  126   1e-29   
ref|XP_010667343.1|  PREDICTED: basic 7S globulin-like                  126   1e-29   
ref|XP_008366845.1|  PREDICTED: basic 7S globulin-like                  126   1e-29   
ref|XP_010694712.1|  PREDICTED: basic 7S globulin-like                  125   1e-29   
ref|XP_007147760.1|  hypothetical protein PHAVU_006G152800g             126   1e-29   
ref|XP_007147763.1|  hypothetical protein PHAVU_006G153100g             126   2e-29   
ref|XP_006352950.1|  PREDICTED: basic 7S globulin-like                  125   3e-29   
emb|CDY13979.1|  BnaC09g38470D                                          125   3e-29   
ref|XP_010677554.1|  PREDICTED: basic 7S globulin-like                  125   3e-29   
emb|CDX92553.1|  BnaA10g15920D                                          124   3e-29   
emb|CDX88901.1|  BnaA03g07480D                                          124   3e-29   
dbj|BAE99306.1|  conglutin gamma - like protein                         124   4e-29   
gb|KCW85154.1|  hypothetical protein EUGRSUZ_B01995                     125   4e-29   
ref|XP_002517175.1|  pepsin A, putative                                 124   5e-29   
ref|XP_009120915.1|  PREDICTED: basic 7S globulin 2                     124   5e-29   
ref|XP_002529699.1|  basic 7S globulin 2 precursor small subunit,...    124   5e-29   
ref|XP_010046260.1|  PREDICTED: basic 7S globulin-like                  124   6e-29   
gb|KEH36779.1|  extracellular dermal glycoprotein                       124   6e-29   
ref|XP_009760543.1|  PREDICTED: basic 7S globulin-like                  124   6e-29   
ref|XP_006349239.1|  PREDICTED: basic 7S globulin-like                  124   7e-29   
emb|CDP03610.1|  unnamed protein product                                124   7e-29   
gb|AER26945.1|  xyloglucan-specific endoglucanase inhibitor 9           124   9e-29   
gb|KDO38562.1|  hypothetical protein CISIN_1g040428mg                   122   1e-28   
ref|XP_006349240.1|  PREDICTED: basic 7S globulin-like                  123   1e-28   
ref|XP_006400469.1|  hypothetical protein EUTSA_v10013774mg             122   2e-28   
gb|KHN37574.1|  Basic 7S globulin 2                                     122   2e-28   
ref|XP_010524801.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    122   2e-28   
gb|KEH36780.1|  extracellular dermal glycoprotein                       122   2e-28   
ref|XP_010693887.1|  PREDICTED: basic 7S globulin-like                  122   3e-28   
gb|KCW60844.1|  hypothetical protein EUGRSUZ_H03581                     122   3e-28   
ref|XP_010424178.1|  PREDICTED: basic 7S globulin-like                  119   3e-28   
ref|XP_010024400.1|  PREDICTED: basic 7S globulin 2-like                122   3e-28   
ref|XP_004229430.1|  PREDICTED: basic 7S globulin-like                  122   3e-28   
ref|XP_002517174.1|  conserved hypothetical protein                     122   3e-28   
ref|XP_006289450.1|  hypothetical protein CARUB_v10002965mg             121   4e-28   
ref|XP_007147762.1|  hypothetical protein PHAVU_006G153000g             122   4e-28   
ref|XP_010322595.1|  PREDICTED: basic 7S globulin-like isoform X1       122   4e-28   
ref|XP_010322603.1|  PREDICTED: basic 7S globulin-like isoform X2       122   4e-28   
ref|XP_002517173.1|  pepsin A, putative                                 121   6e-28   
gb|KHN37577.1|  Basic 7S globulin                                       121   6e-28   
ref|XP_003542883.1|  PREDICTED: basic 7S globulin-like                  121   7e-28   
gb|KHN37576.1|  Basic 7S globulin 2                                     121   8e-28   
gb|KEH36774.1|  eukaryotic aspartyl protease family protein             120   1e-27   
ref|XP_006654380.1|  PREDICTED: basic 7S globulin-like                  120   1e-27   
gb|KDP40115.1|  hypothetical protein JCGZ_02113                         120   1e-27   
ref|NP_001274881.1|  xyloglucan-specific endoglucanase inhibitor 8      120   2e-27   
ref|NP_001274908.1|  xyloglucan-specific endoglucanase inhibitor ...    119   4e-27   
emb|CDY59021.1|  BnaCnng34100D                                          119   4e-27   
gb|ADX66725.1|  xyloglucan-specific endoglucanase inhibitor prote...    119   4e-27   
gb|KHN22268.1|  Basic 7S globulin 2                                     119   5e-27   
ref|XP_006844968.1|  hypothetical protein AMTR_s00058p00180190          118   6e-27   
ref|XP_003527698.1|  PREDICTED: basic 7S globulin 2                     118   7e-27   
ref|XP_002517171.1|  basic 7S globulin 2 precursor small subunit,...    118   8e-27   
gb|AED02502.1|  xyloglucan-specific endoglucanase inhibitor             117   2e-26   
gb|AEG74550.1|  xyloglucan specific endoglucanase inhibitor             117   2e-26   
gb|AFH67006.1|  xyloglucan-specific endo-beta-1,4-glucanase inhib...    117   2e-26   
gb|KDP40116.1|  hypothetical protein JCGZ_02114                         119   2e-26   
ref|XP_009625013.1|  PREDICTED: basic 7S globulin-like                  117   2e-26   
ref|XP_004170870.1|  PREDICTED: basic 7S globulin 2-like                116   4e-26   
ref|XP_004148901.1|  PREDICTED: basic 7S globulin 2-like                116   4e-26   
gb|KDP40113.1|  hypothetical protein JCGZ_02111                         116   4e-26   
ref|XP_010492959.1|  PREDICTED: basic 7S globulin 2-like                115   5e-26   
ref|XP_010420701.1|  PREDICTED: basic 7S globulin 2-like                115   5e-26   
ref|XP_011078750.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...    115   5e-26   
ref|XP_009790669.1|  PREDICTED: basic 7S globulin-like                  111   9e-26   
gb|EYU22657.1|  hypothetical protein MIMGU_mgv1a022346mg                115   9e-26   
ref|XP_010041968.1|  PREDICTED: basic 7S globulin-like                  115   1e-25   
ref|XP_010086743.1|  Basic 7S globulin                                  115   1e-25   
ref|XP_010492957.1|  PREDICTED: basic 7S globulin 2-like                114   1e-25   
dbj|BAD33624.1|  putative dermal glycoprotein precursor, extracel...    114   1e-25   
ref|XP_010454177.1|  PREDICTED: basic 7S globulin 2-like                114   1e-25   
ref|XP_009133965.1|  PREDICTED: basic 7S globulin-like                  114   2e-25   
ref|XP_009414183.1|  PREDICTED: basic 7S globulin 2-like                114   2e-25   
ref|XP_010492950.1|  PREDICTED: basic 7S globulin-like                  114   2e-25   
ref|XP_006349257.1|  PREDICTED: basic 7S globulin-like                  113   3e-25   
ref|XP_006289574.1|  hypothetical protein CARUB_v10003127mg             113   3e-25   
ref|XP_004229562.1|  PREDICTED: basic 7S globulin-like                  113   3e-25   
ref|NP_197412.1|  Eukaryotic aspartyl protease family protein           113   4e-25   
gb|KCW58885.1|  hypothetical protein EUGRSUZ_H01511                     113   4e-25   
dbj|BAF00627.1|  dermal glycoprotein - like                             113   4e-25   
emb|CDX83218.1|  BnaA03g22880D                                          113   4e-25   
ref|XP_010546839.1|  PREDICTED: basic 7S globulin                       113   4e-25   
ref|XP_006850766.1|  hypothetical protein AMTR_s00025p00080690          113   4e-25   
ref|XP_010026233.1|  PREDICTED: basic 7S globulin-like                  113   5e-25   
emb|CDO99000.1|  unnamed protein product                                113   5e-25   
gb|KCW45650.1|  hypothetical protein EUGRSUZ_L006051                    110   6e-25   
ref|XP_008451375.1|  PREDICTED: basic 7S globulin 2                     113   6e-25   
ref|XP_009597882.1|  PREDICTED: basic 7S globulin-like                  112   6e-25   
ref|XP_010524799.1|  PREDICTED: basic 7S globulin-like                  112   6e-25   
ref|XP_010039919.1|  PREDICTED: basic 7S globulin-like                  110   6e-25   
gb|KHN33058.1|  Basic 7S globulin 2                                     112   7e-25   
ref|XP_010420698.1|  PREDICTED: uncharacterized protein LOC104706...    112   8e-25   
gb|KJB26455.1|  hypothetical protein B456_004G242500                    112   8e-25   
ref|XP_006598338.1|  PREDICTED: basic 7S globulin 2-like                112   9e-25   
ref|XP_010026990.1|  PREDICTED: basic 7S globulin-like                  110   1e-24   
gb|EEC84612.1|  hypothetical protein OsI_31447                          113   1e-24   
ref|NP_197411.1|  Eukaryotic aspartyl protease family protein           111   1e-24   
gb|ABK28703.1|  unknown                                                 111   1e-24   
ref|XP_004233956.1|  PREDICTED: basic 7S globulin-like                  111   1e-24   
ref|XP_002873929.1|  hypothetical protein ARALYDRAFT_909934             111   1e-24   
ref|XP_006346986.1|  PREDICTED: basic 7S globulin-like                  114   2e-24   
ref|XP_006432971.1|  hypothetical protein CICLE_v10003177mg             108   2e-24   
ref|XP_010497267.1|  PREDICTED: uncharacterized protein LOC104774336    108   2e-24   
ref|XP_010492954.1|  PREDICTED: basic 7S globulin-like                  110   2e-24   
ref|XP_007034631.1|  Basic 7S globulin precursor, putative              111   2e-24   
ref|XP_009126299.1|  PREDICTED: basic 7S globulin 2-like                110   3e-24   
ref|XP_004229564.1|  PREDICTED: basic 7S globulin-like                  110   3e-24   
gb|KEH16271.1|  basic 7S globulin 2 small subunit, putative             109   5e-24   
ref|XP_002873930.1|  hypothetical protein ARALYDRAFT_488794             109   6e-24   
ref|XP_010045849.1|  PREDICTED: basic 7S globulin 2-like                109   7e-24   
ref|XP_010676965.1|  PREDICTED: basic 7S globulin 2-like                109   7e-24   
ref|XP_010456587.1|  PREDICTED: uncharacterized protein LOC104738046    109   8e-24   
ref|XP_010492952.1|  PREDICTED: aspartic proteinase nepenthesin-1...    108   1e-23   
ref|XP_008246503.1|  PREDICTED: basic 7S globulin-like                  108   1e-23   
ref|XP_010492951.1|  PREDICTED: basic 7S globulin-like                  108   1e-23   
ref|XP_008222996.1|  PREDICTED: basic 7S globulin-like                  103   2e-23   
gb|KFK26148.1|  hypothetical protein AALP_AA8G210000                    108   2e-23   
ref|XP_010492955.1|  PREDICTED: basic 7S globulin-like                  108   2e-23   
ref|XP_010524796.1|  PREDICTED: basic 7S globulin-like                  108   2e-23   
ref|XP_010039917.1|  PREDICTED: basic 7S globulin 2-like                108   2e-23   
emb|CDY47196.1|  BnaAnng08660D                                          108   2e-23   
ref|XP_010420700.1|  PREDICTED: basic 7S globulin 2-like                107   3e-23   
ref|NP_199654.1|  aspartyl protease family protein                      107   3e-23   
ref|XP_007205231.1|  hypothetical protein PRUPE_ppa006032mg             107   5e-23   
ref|XP_009126297.1|  PREDICTED: basic 7S globulin-like                  106   6e-23   
ref|XP_010420697.1|  PREDICTED: basic 7S globulin-like                  106   8e-23   
ref|XP_007034625.1|  Eukaryotic aspartyl protease family protein,...    101   8e-23   
emb|CDY02589.1|  BnaC02g08460D                                          105   1e-22   
dbj|BAJ95091.1|  predicted protein                                      106   1e-22   
ref|XP_006471701.1|  PREDICTED: basic 7S globulin-like                  102   1e-22   
emb|CDY47198.1|  BnaAnng08680D                                          105   1e-22   
ref|XP_011091045.1|  PREDICTED: basic 7S globulin 2                     105   2e-22   
gb|KFK26153.1|  hypothetical protein AALP_AA8G210400                    105   2e-22   
gb|KCW84248.1|  hypothetical protein EUGRSUZ_B01106                     104   3e-22   
ref|XP_010045844.1|  PREDICTED: basic 7S globulin-like                  104   3e-22   
gb|EMT04933.1|  Basic 7S globulin                                       104   4e-22   
ref|XP_006400468.1|  hypothetical protein EUTSA_v10015503mg             104   4e-22   
emb|CDY37437.1|  BnaC08g45750D                                        99.4    5e-22   
ref|XP_010039913.1|  PREDICTED: basic 7S globulin 2-like                100   5e-22   
gb|KCW60847.1|  hypothetical protein EUGRSUZ_H03585                     103   6e-22   



>ref|XP_009611838.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=420

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 153/202 (76%), Gaps = 14/202 (7%)
 Frame = -1

Query  847  RDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYT  668
            R +  TPL S  ++G ++EYYINVKSIKIN +KL LNTSL  +D+ V GGT+IST+ P+T
Sbjct  218  RSMLYTPLISS-KDGVSEEYYINVKSIKINGKKLSLNTSLFAMDEGV-GGTKISTIPPFT  275

Query  667  TLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFS-------GVGSDVPKVEFVLQSE  509
            T+K++IY  F+++Y + A SM L++V+ +APFE+CFS        VG +VP  + VLQSE
Sbjct  276  TMKSSIYKSFIEAYEKFAISMELNKVEAIAPFELCFSTKGIDVTKVGPNVPTTDLVLQSE  335

Query  508  MVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS  338
            MVKWR+   NSMVKV D VMCLGFL+GG+ Q AS+VIGGYQLEDNLLEFNLGTSMLGFTS
Sbjct  336  MVKWRIYGRNSMVKVSDEVMCLGFLNGGVNQKASIVIGGYQLEDNLLEFNLGTSMLGFTS  395

Query  337  --LMAGTSCSHFTRFSMERDSA  278
               MA TSCS F   S+ +DSA
Sbjct  396  SLSMAETSCSDFMFHSVSKDSA  417



>ref|XP_004229435.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=417

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 145/188 (77%), Gaps = 9/188 (5%)
 Frame = -1

Query  847  RDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYT  668
            R +  TPL S  +NG ++EYYINVKS+KIN +KL LNT+LL +D E +GGTRIST+ P+T
Sbjct  220  RSMLYTPLISS-RNGVSEEYYINVKSLKINGKKLSLNTTLLTMDGEGQGGTRISTISPFT  278

Query  667  TLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSGV---GSDVPKVEFVLQSEMVKW  497
            T+KT+IY  F+++Y     SMGL++V+P+APF +CFS     G +VP V+ VLQSEMVKW
Sbjct  279  TMKTSIYKTFVEAYERFGFSMGLTKVEPIAPFGLCFSTKLEEGLNVPSVDLVLQSEMVKW  338

Query  496  RM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LM  332
            R+   NSMVKV D VMCLGFLDGG  Q AS+VIGG+QLEDNLLEFNLGTSMLGFTS   M
Sbjct  339  RIYESNSMVKVSDEVMCLGFLDGGANQKASIVIGGHQLEDNLLEFNLGTSMLGFTSSLSM  398

Query  331  AGTSCSHF  308
              TSCS F
Sbjct  399  VETSCSDF  406



>ref|XP_006339396.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=416

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 143/187 (76%), Gaps = 8/187 (4%)
 Frame = -1

Query  847  RDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYT  668
            R +  TPL S  ++G  +EYYINVKS+KIN  KL LNTSLL +D E  GGT+IST+ P+T
Sbjct  220  RSMLYTPLISS-RDGVLEEYYINVKSLKINGNKLSLNTSLLTMDGEGHGGTKISTISPFT  278

Query  667  TLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSGV--GSDVPKVEFVLQSEMVKWR  494
            T+KT+IY  F++SY     SMGL++V+P+APF +CFS    G +VP ++ VLQSEMVKWR
Sbjct  279  TMKTSIYKTFVESYERFGFSMGLTKVEPIAPFGLCFSTKVEGLNVPSIDLVLQSEMVKWR  338

Query  493  M---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMA  329
            +   NSMVKV D VMCLGFLDGG+ Q AS+VIGG+QLEDNLLEFNLGTSMLGFTS   M 
Sbjct  339  IYESNSMVKVSDEVMCLGFLDGGVNQKASIVIGGHQLEDNLLEFNLGTSMLGFTSSLAMV  398

Query  328  GTSCSHF  308
             TSCS F
Sbjct  399  ETSCSDF  405



>emb|CDO98999.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 136/204 (67%), Gaps = 22/204 (11%)
 Frame = -1

Query  859  PMMFRDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTV  680
            P++FR           +    Q YYINVKSIKIN +KL +N S+L ++QE  GGT+IST 
Sbjct  247  PLVFR-----------EGSKVQGYYINVKSIKINGKKLSINESMLSVNQEGVGGTKISTA  295

Query  679  VPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSGV-------GSDVPKVEFV  521
            VPYTT+ +T+Y+ F+ +Y+++A  M ++   PVAPF +CF           S+VP ++ V
Sbjct  296  VPYTTMVSTLYNTFIKAYIKAAIGMNMTMAPPVAPFGICFRSERLEANRDASNVPIIDLV  355

Query  520  LQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSML  350
            LQSEMVKWR+   NS V+V D VMCLGFLDGG    ASVV+GGYQLEDNL+EF LGT ML
Sbjct  356  LQSEMVKWRIEGRNSFVQVNDKVMCLGFLDGGSSSKASVVLGGYQLEDNLVEFKLGTKML  415

Query  349  GFTSLMAG-TSCSHFTRFSMERDS  281
            GF++L  G T+CS      + R++
Sbjct  416  GFSALAMGHTTCSDLRTSYIPREA  439



>ref|XP_007034626.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05552.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=420

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 134/173 (77%), Gaps = 12/173 (7%)
 Frame = -1

Query  796  QEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLES  617
             +Y+IN++SIKIN ++L ++ S+L+ D+E + GT++ST+VPYTT+K++IY  F  +Y ++
Sbjct  236  HDYFINIQSIKINGKRLAVDKSMLLGDEEGKLGTKLSTIVPYTTVKSSIYAIFSKAYAKA  295

Query  616  AASMGLSRVDPVAPFEVCFSGVGSD-------VPKVEFVLQSEMVKWRM---NSMVKVGD  467
            A SM ++RV  VAPFE+CFS  G +       VP+++ +LQSEMVKWR+   NSMVKV +
Sbjct  296  ADSMNMTRVAAVAPFELCFSSKGIENTILGPLVPEIDLILQSEMVKWRIQGRNSMVKVSN  355

Query  466  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  314
             VMCLGFLDGGL Q +S+VIGG QLEDNLLEF++G+SMLGF+S  L+  T+CS
Sbjct  356  QVMCLGFLDGGLEQSSSIVIGGLQLEDNLLEFDVGSSMLGFSSSLLLKETTCS  408



>ref|XP_002517162.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45325.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=411

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 139/204 (68%), Gaps = 20/204 (10%)
 Frame = -1

Query  868  VTLPMMFRDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRI  689
            ++ P + R L  +PL + P +G++ EY+I V+SIKIN +KL L        QE  G T+I
Sbjct  212  ISDPEILRSLSYSPLVTKP-DGSSLEYFIEVRSIKINGKKLALG-------QEGIGFTKI  263

Query  688  STVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKV  530
            ST+VPYTTL+++IY  F+ +YL++A SM L RV  VAPF +CFS        +G +VP +
Sbjct  264  STIVPYTTLESSIYETFIKAYLKAANSMNLIRVASVAPFGLCFSSKGIERSILGPNVPAI  323

Query  529  EFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGT  359
            + VLQSEMVKWR+   NSMV+V D  MCLGFLDGGL    S+VIGG QLED LLEF+LGT
Sbjct  324  DLVLQSEMVKWRLHGGNSMVEVNDEAMCLGFLDGGLDPKNSIVIGGLQLEDTLLEFDLGT  383

Query  358  SMLGFT--SLMAGTSCSHFTRFSM  293
            SMLGF+   L   TSCS+F   SM
Sbjct  384  SMLGFSLPLLQRQTSCSNFLLESM  407



>ref|XP_002272235.1| PREDICTED: basic 7S globulin [Vitis vinifera]
Length=436

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 126/180 (70%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSI+IN++ + LNTSLL +D E  GGT+ISTV PYT ++T+IY  F  
Sbjct  251  QGEPSAEYFIRVKSIRINEKAISLNTSLLSIDSEGVGGTKISTVNPYTVMETSIYKAFTK  310

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++ +AA++ ++RV  VAPF VCFS        VG  VP ++ VLQ+E V WR+   NSM
Sbjct  311  AFISAAAAINITRVAAVAPFNVCFSSKNVYSTRVGPSVPSIDLVLQNESVFWRIFGANSM  370

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V V D V+CLGF+DGG     S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  371  VYVSDDVLCLGFVDGGANPRTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRRTTCANF  430



>emb|CAN80378.1| hypothetical protein VITISV_038701 [Vitis vinifera]
Length=436

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 126/180 (70%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSI+IN++ + LNTSLL +D E  GGT+ISTV PYT ++T+IY  F  
Sbjct  251  QGEPSAEYFIRVKSIRINEKAISLNTSLLSIDSEGVGGTKISTVNPYTVMETSIYKXFTK  310

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++ +AA++ ++RV  VAPF VCFS        VG  VP ++ VLQ+E V WR+   NSM
Sbjct  311  AFISAAAAINITRVAAVAPFNVCFSSKNVYSTRVGPSVPSIDLVLQNESVFWRIFGANSM  370

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V V D V+CLGF+DGG     S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  371  VYVSDDVLCLGFVDGGANPRTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRRTTCANF  430



>gb|KEH36785.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=417

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 138/204 (68%), Gaps = 18/204 (9%)
 Frame = -1

Query  853  MFRDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVP  674
            +FR L  TPL    QN    EY+INV SIKI  +K+  NT  L L QE   GT +S++VP
Sbjct  220  IFRSLTFTPL-VTNQN---MEYFINVNSIKIGGKKVSFNT--LSLSQEGNSGTLLSSIVP  273

Query  673  YTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQ  515
            YTT++++IY  F  + L++A SM +SRVD VAPFE+CF       S +G +VP ++ VLQ
Sbjct  274  YTTMQSSIYANFKSAILKAALSMNISRVDSVAPFEICFGSNGIGASKIGPNVPVIDLVLQ  333

Query  514  SEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGF  344
            SEMVKWR+   NSMV+V D VMCLG LDGG  Q   +VIGGYQLED L++F+  +SM+GF
Sbjct  334  SEMVKWRIHGRNSMVRVSDDVMCLGILDGGDEQKNLIVIGGYQLEDVLVQFDFDSSMVGF  393

Query  343  TS--LMAGTSCSHFTRFSMERDSA  278
            +S  L+  TSCS+F   SM+  S+
Sbjct  394  SSSLLIRDTSCSNFRFGSMDVQSS  417



>emb|CDP03612.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 124/180 (69%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSIK+ND+ +PLN +LL +D    GGT+ISTV PYT L+T+IY    +
Sbjct  70   QGEPSDEYFIGVKSIKVNDKAVPLNATLLTIDSRGNGGTKISTVNPYTVLETSIYKAVTE  129

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++  AA+  +SRV  VAPFEVC S        +G  VP+++ VLQS+ V W +   NSM
Sbjct  130  AFISEAAAWNISRVAGVAPFEVCVSSKNVFSTRLGPSVPQIDLVLQSQSVVWSITGSNSM  189

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V V D V+CLGF++GG+    S+VIGGYQLED LL+F+L TS LGFTS + G  T+C++F
Sbjct  190  VYVNDNVLCLGFVNGGVNPRTSIVIGGYQLEDLLLQFDLATSRLGFTSTLLGSRTTCANF  249



>ref|XP_002280508.1| PREDICTED: basic 7S globulin [Vitis vinifera]
Length=388

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 124/168 (74%), Gaps = 14/168 (8%)
 Frame = -1

Query  832  TPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTT  653
            TPL  P Q+  ++ Y+I+VKSI+IN R + L T        + GGTR+STVVPYTT+K +
Sbjct  206  TPL-LPGQDPNSEGYFISVKSIRINGRGVSLGT--------ITGGTRLSTVVPYTTMKRS  256

Query  652  IYHPFLDSYLESAASMGLSRVDPVAPFEVCFSGVGSD--VPKVEFVLQSEMVKWRM---N  488
            +Y  F  +Y+++AASM ++RV+ +APF VCF    S+  VP ++ VLQSEMVKWR+   N
Sbjct  257  VYDIFTKAYIKAAASMNITRVESMAPFGVCFRSESSEPAVPTIDLVLQSEMVKWRILGRN  316

Query  487  SMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGF  344
            SMV+V D VMCLGFLDGG+  G ++VIGG+QLEDNLLEF+L TSMLGF
Sbjct  317  SMVRVSDKVMCLGFLDGGVDPGTAIVIGGHQLEDNLLEFDLSTSMLGF  364



>ref|XP_010242827.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=434

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 123/174 (71%), Gaps = 10/174 (6%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +YYI V SI+IN + + LNTSLL +D++  GGTRISTVVPYTTL+T+IY    D++L 
Sbjct  252  SSDYYIGVTSIRINGKPVALNTSLLSIDKKGFGGTRISTVVPYTTLETSIYEAVTDAFLT  311

Query  619  SAASMGLSRVDPVAPFEVCF----SGVGSD--VPKVEFVLQSEMVKWRM---NSMVKVGD  467
             A S G  R  PV+PFEVC      G+G D  VPK++ VLQSE V WR    NSMV VGD
Sbjct  312  EATSTGFIREAPVSPFEVCIRANVPGIGPDDHVPKLDLVLQSESVYWRFEHRNSMVTVGD  371

Query  466  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLM-AGTSCSHF  308
             V+CLG LDGGL    S+VIGG+QLEDNLL+F+L  S LGF+SL+ +  +CS F
Sbjct  372  SVLCLGMLDGGLKPETSIVIGGHQLEDNLLQFDLRGSKLGFSSLLSSAATCSSF  425



>gb|KDP40108.1| hypothetical protein JCGZ_02106 [Jatropha curcas]
Length=425

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 138/207 (67%), Gaps = 22/207 (11%)
 Frame = -1

Query  859  PMMFRDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTV  680
            P +   L  TPL + P +G +QEY INV+SI+IN ++L L           +GGT+IST 
Sbjct  226  PEILNSLTYTPLLTNP-SGESQEYLINVRSIRINGKRLALGQG------GFKGGTKISTT  278

Query  679  VPYTTLKTTIYHPFLDSYLESAASMGLSRVDP--VAPFEVCFSG-------VGSDVPKVE  527
            VPYTTL+++IY  F+ +Y ++A SM L+RVDP   +PF +CFS        +G  VP ++
Sbjct  279  VPYTTLESSIYSTFIKAYTKAANSMNLTRVDPEPSSPFGLCFSSKGIANTIMGPMVPAID  338

Query  526  FVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTS  356
             VLQSEMVKWR+   NSMV+V D +MCLG LDGGL    S+VIGG+QLED LLEF+LG S
Sbjct  339  LVLQSEMVKWRIHGRNSMVQVSDEMMCLGLLDGGLESENSIVIGGFQLEDTLLEFDLGNS  398

Query  355  MLGFT--SLMAGTSCSHFTRFSMERDS  281
            MLGF+   LM  TSCS F   SM +DS
Sbjct  399  MLGFSFPILMRQTSCSSFLD-SMGKDS  424



>ref|XP_002284868.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=441

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 128/174 (74%), Gaps = 12/174 (7%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I VKSI+IN +++PL++SLL +++   GGT+ISTV PYT L+T+IY+ F   +L+ A
Sbjct  262  EYFIRVKSIQINGKQVPLDSSLLAINKNGIGGTKISTVNPYTLLQTSIYNSFTKLFLQEA  321

Query  613  ASMGLSRVDPVAPFEVCFSGVGSD-------VPKVEFVLQSEMVKWRM---NSMVKVGDG  464
             +  ++RV PVAPF+VCFS   ++       +P ++ VLQ++ V WR+   NSMV VGD 
Sbjct  322  MAHNVTRVSPVAPFDVCFSTKNTNGAFSTPAIPVIDLVLQNKKVFWRIFETNSMVLVGDD  381

Query  463  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V CLGFLDGGL Q  S+VIGG+QLEDNLL+F+L +S LGFTS  L+  TSC++F
Sbjct  382  VACLGFLDGGLNQRTSIVIGGHQLEDNLLQFDLESSRLGFTSSLLLRETSCANF  435



>emb|CAN68736.1| hypothetical protein VITISV_030193 [Vitis vinifera]
Length=441

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 128/174 (74%), Gaps = 12/174 (7%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I VKSI+IN +++PL++SLL +++   GGT+ISTV PYT L+T+IY+ F   +L+ A
Sbjct  262  EYFIRVKSIQINGKQVPLDSSLLAINKNGIGGTKISTVNPYTLLQTSIYNSFTKLFLQEA  321

Query  613  ASMGLSRVDPVAPFEVCFSGVGSD-------VPKVEFVLQSEMVKWRM---NSMVKVGDG  464
             +  ++RV PVAPF+VCFS   ++       +P ++ VLQ++ V WR+   NSMV VGD 
Sbjct  322  MAHNVTRVSPVAPFDVCFSTKNTNGAFSTPAIPVIDLVLQNKKVFWRIFETNSMVLVGDD  381

Query  463  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V CLGFLDGGL Q  S+VIGG+QLEDNLL+F+L +S LGFTS  L+  TSC++F
Sbjct  382  VACLGFLDGGLNQRTSIVIGGHQLEDNLLQFDLESSRLGFTSSLLLRETSCANF  435



>ref|XP_010255899.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=448

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 122/176 (69%), Gaps = 12/176 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSI IN +++P+NT+LL  D++  GGT+IST  PYTTL T+IY     ++  
Sbjct  267  SDEYFIQVKSININAKRVPINTTLLSFDKDGVGGTKISTATPYTTLHTSIYKAVTQAFAN  326

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKW---RMNSMVKVG  470
            +AASM +SRV  VAPF VCFS        +G  VP ++ VL S+ V W   R NSMV+V 
Sbjct  327  AAASMKMSRVASVAPFGVCFSSKSIKRTRMGPLVPAIDLVLHSQDVYWSISRSNSMVQVK  386

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            DGVMCLG +D G     S+VIGG+QLEDNLL+F+L +SMLGFTS  L  GT+C++F
Sbjct  387  DGVMCLGLVDAGKNPRTSIVIGGHQLEDNLLQFDLASSMLGFTSSLLGHGTNCANF  442



>ref|XP_011090791.1| PREDICTED: basic 7S globulin [Sesamum indicum]
Length=417

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 133/195 (68%), Gaps = 20/195 (10%)
 Frame = -1

Query  832  TPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTT  653
            TPL S  ++G  + YY+NVKSIKI+ +KL L+   L+        T+ISTVVPYTT+++ 
Sbjct  229  TPLISK-KDGLQEGYYMNVKSIKISGKKLSLHHLGLLS-------TKISTVVPYTTMESK  280

Query  652  IYHPFLDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWR  494
            IY  F+++Y+++A SM L+ V PVAPFE+CFS        +G +VP ++ +LQSEMVKWR
Sbjct  281  IYGTFVEAYVKAATSMNLTLVTPVAPFEICFSSKGVENQRIGPNVPIIDLILQSEMVKWR  340

Query  493  M---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMA  329
            +   NSMV V D VMCL FLDGGL    S+VIGGYQ+ED LLEFNLG SMLGF+S  LM 
Sbjct  341  IYGRNSMVPVSDEVMCLAFLDGGLSPKDSIVIGGYQIEDYLLEFNLGNSMLGFSSSLLMG  400

Query  328  GTSCSHFTRFSMERD  284
               CS F    M R+
Sbjct  401  QKGCSDFEASVMSRE  415



>gb|KDP21480.1| hypothetical protein JCGZ_21951 [Jatropha curcas]
Length=434

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 125/176 (71%), Gaps = 12/176 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I V SI+IND+K+ LN SLL +D +  GGT+ISTV PYT L+++I+    ++++ 
Sbjct  253  SAEYFIGVTSIRINDKKVTLNDSLLTIDSQGNGGTKISTVNPYTVLESSIFSAVTEAFIS  312

Query  619  SAASMGLSRVDPVAPFEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             AA M +SRV  VAPFEVCFS        +G  VP +  VLQ+E V WR+   NS+V+V 
Sbjct  313  EAAEMNISRVGSVAPFEVCFSRRNVVSTRLGYRVPSISLVLQNENVVWRIFGANSIVQVS  372

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            D V+CLG ++GGL    S+VIGGYQLEDNL++F+L TS LGF+SL+ G  T+CS+F
Sbjct  373  DDVLCLGLINGGLNPRTSIVIGGYQLEDNLVQFDLATSRLGFSSLLFGRQTTCSNF  428



>ref|XP_004486144.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=411

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 136/201 (68%), Gaps = 19/201 (9%)
 Frame = -1

Query  865  TLPMMFRDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRIS  686
            T   +FR L  TPL    QN    E +INVKSIKI  +K+  NT    L QE   GT++S
Sbjct  212  TKSEIFRSLTFTPL-VESQN---HESFINVKSIKIGGKKVSFNTP--SLSQEGNSGTKLS  265

Query  685  TVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVE  527
            ++VPYTT++++IY  F  ++L++A SM ++RV  VAPF+VCF       S VG +VP ++
Sbjct  266  SIVPYTTIQSSIYGNFKSAFLKAAFSMNMTRVTSVAPFDVCFDSNGIDESKVGPNVPVID  325

Query  526  FVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTS  356
            FVLQSEMVKW +   NSMVK+ D VMCLG LDGG+ Q   +VIGGYQ ED L++F+  +S
Sbjct  326  FVLQSEMVKWSIYGRNSMVKLSDDVMCLGLLDGGVEQKNPIVIGGYQFEDVLVQFDFDSS  385

Query  355  MLGFTS--LMAGTSCSHFTRF  299
            M+GF+S  LM  +SCS+F RF
Sbjct  386  MVGFSSSLLMRDSSCSNF-RF  405



>emb|CAN61502.1| hypothetical protein VITISV_011733 [Vitis vinifera]
Length=415

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 124/180 (69%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSI+IN++ +PLNTSLL ++ +  GGT+ISTV PYT ++T+IY  F  
Sbjct  231  QGEPSAEYFIGVKSIQINEKAVPLNTSLLSINSKGVGGTKISTVNPYTVMETSIYSAFTK  290

Query  631  SYLESAASMGLSRVDPVAPFEVCFSGV-------GSDVPKVEFVLQSEMVKWRM---NSM  482
            +++ +AASM ++RV  VAPF VCFS         G+ VP +  VLQ+  V WR+   NSM
Sbjct  291  AFISAAASMNITRVAAVAPFSVCFSSKNVYSTRGGAAVPTIGLVLQNNSVVWRIFGANSM  350

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V V   V+CLGF+DGG     S+VIGGYQLEDNLL+F+L  S LGF+S  L + T+CS+F
Sbjct  351  VFVNGDVLCLGFVDGGANPRTSIVIGGYQLEDNLLQFDLAASRLGFSSSLLFSQTTCSNF  410



>ref|XP_011026191.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=438

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 127/180 (71%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSI+I+D+ +PLN +LL +D + +GGT+ISTV PYT L+++I++    
Sbjct  253  QGEPSAEYFIGVKSIRISDKTVPLNATLLSIDSQGKGGTKISTVNPYTVLESSIFNAVTR  312

Query  631  SYLESAASMGLSRVDPVAPFEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++  AA+  ++RV  VAPF+VCFS        +G+ VP +  VLQ+E V WR+   NSM
Sbjct  313  AFINEAAARNITRVASVAPFDVCFSRDNIFSTRLGAAVPTISLVLQNENVIWRIFGANSM  372

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V+V D V+CLGF++GG     S+VIGGYQLEDNL +F+L  S LGF+SL+ G  T+CS+F
Sbjct  373  VQVSDNVLCLGFVNGGSNPTTSIVIGGYQLEDNLFQFDLAASRLGFSSLLFGRQTTCSNF  432



>gb|EYU38145.1| hypothetical protein MIMGU_mgv1a006647mg [Erythranthe guttata]
Length=436

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 122/180 (68%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V SI+IND+ + +NT+LL++D E  GGT+ISTV PYT ++T+IY  F  
Sbjct  251  QGDPSDEYFIRVNSIRINDKPISINTTLLIIDSEGNGGTKISTVNPYTLMETSIYRAFSA  310

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +Y+  AA+  +SRV  VAPF+VCFS        VG  VP ++ VLQ +   W +   NSM
Sbjct  311  AYIREAAARNISRVAGVAPFDVCFSSSNVFGTRVGPAVPYIDLVLQGQNAVWTITGSNSM  370

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V+V D V+CLGFLD G     S+VIGGYQ+EDNLL+F+L  S LGF+S + G  T+C++F
Sbjct  371  VRVNDDVLCLGFLDAGSNPVTSIVIGGYQIEDNLLQFDLAASRLGFSSTLLGRQTTCANF  430



>ref|XP_011014389.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=435

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 136/203 (67%), Gaps = 24/203 (12%)
 Frame = -1

Query  847  RDL*CTPL*-SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPY  671
            R L  TPL  SP  +G++Q+Y INVKSIKIN ++L L        + + GGT+IST VPY
Sbjct  233  RSLTYTPLVTSPDGSGSSQDYSINVKSIKINGKRLSLR------QKGIGGGTKISTTVPY  286

Query  670  TTLKTTIYHPFLDSYLESAAS---MGLSRVDPVAPFEVCFSG--------VGSDVPKVEF  524
            TTL+++IY  F+ +Y E+A +   + ++ V PVAPF +CFS         +G  VP ++ 
Sbjct  287  TTLESSIYSTFIKAYKEAATNNYFLNMTVVAPVAPFGLCFSSKEVPSSMLLGPMVPAIDL  346

Query  523  VLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQ--GASVVIGGYQLEDNLLEFNLGT  359
            VLQSEMVKWR+   N+MV V D VMCLGFLDGG      +S+VIGG+QLEDNLLEFNLGT
Sbjct  347  VLQSEMVKWRVHGRNAMVPVLDEVMCLGFLDGGFKSKTSSSIVIGGFQLEDNLLEFNLGT  406

Query  358  SMLGFTSLMAGTSCSHFTRFSME  290
            SMLGF+S    TSCS +    M+
Sbjct  407  SMLGFSS-TRHTSCSDYHTRMMQ  428



>ref|XP_007154121.1| hypothetical protein PHAVU_003G092100g [Phaseolus vulgaris]
 gb|ESW26115.1| hypothetical protein PHAVU_003G092100g [Phaseolus vulgaris]
Length=416

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 125/176 (71%), Gaps = 15/176 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGG-----TRISTVVPYTTLKTTIYHPFL  635
            +QEY+INV S+KIN ++L L+ S      E EGG     T IS++VPYTT++++IY+ F 
Sbjct  233  SQEYFINVNSVKINGKRLSLDVSEF---NEQEGGGGGALTLISSIVPYTTMQSSIYNSFK  289

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG--VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            +++L++A SM ++RV  VAPFE+CFS   VG  VP +E VLQSEMVKW +   NSMV+V 
Sbjct  290  EAFLDAAVSMNMTRVASVAPFELCFSSSQVGPSVPVIELVLQSEMVKWSIHGRNSMVRVS  349

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V CLGF DGG+    S+VIGGYQLED +++F+L TSM+GF+S  L   T CS F
Sbjct  350  DEVACLGFSDGGVNLRNSIVIGGYQLEDVIVQFDLATSMVGFSSSLLTKKTKCSDF  405



>emb|CBI32364.3| unnamed protein product [Vitis vinifera]
Length=400

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 121/172 (70%), Gaps = 13/172 (8%)
 Frame = -1

Query  787  YINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESAAS  608
            YIN  SI+IN++ + LNTSLL +D E  GGT+ISTV PYT ++T+IY  F  +++ +AA+
Sbjct  224  YIN-PSIRINEKAISLNTSLLSIDSEGVGGTKISTVNPYTVMETSIYKAFTKAFISAAAA  282

Query  607  MGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  458
            + ++RV  VAPF VCFS        VG  VP ++ VLQ+E V WR+   NSMV V D V+
Sbjct  283  INITRVAAVAPFNVCFSSKNVYSTRVGPSVPSIDLVLQNESVFWRIFGANSMVYVSDDVL  342

Query  457  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            CLGF+DGG     S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  343  CLGFVDGGANPRTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRRTTCANF  394



>ref|XP_002302122.1| hypothetical protein POPTR_0002s05580g [Populus trichocarpa]
 gb|EEE81395.1| hypothetical protein POPTR_0002s05580g [Populus trichocarpa]
Length=438

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 127/180 (71%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSI+I+D+ +PLN +LL +D + +GGT+ISTV PYT L+++I++    
Sbjct  253  QGEPSAEYFIGVKSIRISDKTVPLNATLLSIDSQGKGGTKISTVNPYTVLESSIFNAVTR  312

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++  +A+  ++RV  VAPF+VCFS        +G+ VP +  VLQ+E V WR+   NSM
Sbjct  313  AFINESAARNITRVASVAPFDVCFSSDNIFSTRLGAAVPTISLVLQNENVIWRIFGANSM  372

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V+V D V+CLGF++GG     S+VIGGYQLEDNL +F+L  S LGF+SL+ G  T+C++F
Sbjct  373  VQVSDNVLCLGFVNGGSNPTTSIVIGGYQLEDNLFQFDLAASRLGFSSLLFGRQTTCANF  432



>ref|XP_007154122.1| hypothetical protein PHAVU_003G092200g [Phaseolus vulgaris]
 gb|ESW26116.1| hypothetical protein PHAVU_003G092200g [Phaseolus vulgaris]
Length=445

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 127/183 (69%), Gaps = 17/183 (9%)
 Frame = -1

Query  808  NGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDS  629
            N  + EY+I VKSIK++ + L +NTSLL +D++  GGT++STV+PYT L +++YHP L++
Sbjct  261  NDPSSEYFIGVKSIKVDGKILNVNTSLLSIDKQGNGGTKLSTVIPYTKLHSSLYHPLLNA  320

Query  628  YLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMV  479
            +++ AA M + RV PVAPF  CF+         G +VP +E VL+   V+WR+   NSMV
Sbjct  321  FVKKAAVMKMKRVSPVAPFGACFNSRTVGKTVTGPNVPTIELVLRGG-VQWRIYGVNSMV  379

Query  478  KVGDGVMCLGFLDGGL---GQGA-SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSC  317
            KV   V CLGF+D GL   G  A S+VIGGYQ+EDNLLEF+L +S LGF+S  L+   +C
Sbjct  380  KVNKKVQCLGFVDAGLELEGPAATSIVIGGYQMEDNLLEFDLASSKLGFSSSLLLHNATC  439

Query  316  SHF  308
            SHF
Sbjct  440  SHF  442



>ref|XP_006489581.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 123/176 (70%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN   +PLNTSLL +D+E  GGT+ISTV PYT L T+IY+    ++++
Sbjct  258  SAEYFIGVKSIKINGNTVPLNTSLLSIDKEGFGGTKISTVNPYTVLHTSIYNALARAFIK  317

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A+  + RV PVAPF  CF+        VG  VP+++ VLQS  V WR+   NSMV+V 
Sbjct  318  EVAN--IPRVTPVAPFGACFNSTFVGSTRVGPAVPQIDLVLQSNTVIWRIFGANSMVQVR  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  376  DDVLCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHQTTCANF  431



>gb|KDO74788.1| hypothetical protein CISIN_1g036132mg [Citrus sinensis]
Length=437

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 123/176 (70%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN   +PLNTSLL +D+E  GGT+ISTV PYT L T+IY+    ++++
Sbjct  258  SAEYFIGVKSIKINGNTVPLNTSLLSIDKEGVGGTKISTVNPYTVLHTSIYNALARAFVK  317

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A+  + RV PVAPF  CF+        VG  VP+++ VLQS  V WR+   NSMV+V 
Sbjct  318  EVAN--IPRVTPVAPFGACFNSTFVGSTRVGPAVPQIDLVLQSNTVIWRIFGANSMVQVR  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  376  DDVLCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHQTTCANF  431



>gb|KJB61114.1| hypothetical protein B456_009G341600 [Gossypium raimondii]
Length=403

 Score =   173 bits (438),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 131/183 (72%), Gaps = 17/183 (9%)
 Frame = -1

Query  847  RDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYT  668
            R L  TPL +  QN    +Y+INV+SIKIN R+L ++       ++ +   ++STVVPYT
Sbjct  221  RSLAYTPLITK-QN----DYFINVQSIKINGRRLAVH-------EQGKLEAKLSTVVPYT  268

Query  667  TLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSGVGSDVPKVEFVLQSEMVKWRM-  491
            T+ +++Y  F  +Y+E+A  M ++RV+ VAPF +CFS  G  VP+++ VLQSEMVKWR+ 
Sbjct  269  TMVSSVYAIFSKAYVEAATKMNMTRVESVAPFGLCFSSKGPLVPEIDLVLQSEMVKWRIQ  328

Query  490  --NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGT  323
              NSMVKV +  MCLGFLDGGL Q + +V+GG Q+EDNLLEF++G+SMLGF+S  L+  T
Sbjct  329  GRNSMVKVSEESMCLGFLDGGLEQSSPIVLGGLQMEDNLLEFDIGSSMLGFSSSLLLKET  388

Query  322  SCS  314
            +CS
Sbjct  389  TCS  391



>gb|KDP40112.1| hypothetical protein JCGZ_02110 [Jatropha curcas]
Length=434

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 126/176 (72%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + +PLNTSLL +D+E  GGT+ISTV PYT ++TTIY+ F++++ +
Sbjct  255  SSEYFIGVKSIKINGKAVPLNTSLLSIDKEGFGGTKISTVDPYTVMETTIYNEFINAFRK  314

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            + A  G+ +V PVAPF +CF+        VG  VP+++ VLQS  V WR+   NSMV+V 
Sbjct  315  ALA--GVPKVAPVAPFGLCFNSTNIGSTRVGPAVPQIDLVLQSSTVFWRIFGANSMVQVK  372

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              V+CLGF DGG+    SVVIGG+QLE+NLL+F+L  S LGF+S  L   T+C++F
Sbjct  373  SDVLCLGFFDGGVNPRTSVVIGGHQLENNLLQFDLAASKLGFSSSLLFRQTTCANF  428



>ref|XP_009411762.1| PREDICTED: basic 7S globulin-like [Musa acuminata subsp. malaccensis]
Length=434

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 125/180 (69%), Gaps = 14/180 (8%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSI+IN   +PLN +LL +D++  GGT+ISTV PYTTL+T+IY    +
Sbjct  251  QGEKSVEYFIEVKSIRINGNSVPLNKTLLSIDKDGVGGTKISTVTPYTTLQTSIYRAVTN  310

Query  631  SYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++  +AA  G+ RV PVAPF +CF       + VG  VP+++ VL S+ V WR+   NSM
Sbjct  311  AF--AAALAGVRRVPPVAPFGLCFDPSSIGSTRVGPAVPQIDLVLPSQNVYWRIFGANSM  368

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V+V D V+CLGF+DGG     S+VIGGYQLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  369  VQVRDKVLCLGFVDGGAEPRTSIVIGGYQLEDNLLQFDLATSRLGFSSSLLFRQTTCANF  428



>ref|XP_011082548.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=432

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 121/180 (67%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V SI+I    + +NT+LL +D +  GGT+ISTV PYT L+T+IY  F  
Sbjct  247  QGEPSTEYFIRVNSIRIEGNPITINTTLLNIDSQGNGGTKISTVNPYTLLETSIYRAFTS  306

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +Y+++AA+  +SRV  VAPF+VCFS        VG  VP ++ VLQ +   W +   NSM
Sbjct  307  AYIQAAAARNISRVAGVAPFDVCFSSENVFSTRVGPSVPYIDLVLQGQDAVWTITGSNSM  366

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V+V D V+CLGFLDGG     S+VIGGYQLEDNLL+F+L  S LGF+S + G  T+C++F
Sbjct  367  VQVNDNVLCLGFLDGGSNPRTSIVIGGYQLEDNLLQFDLAASRLGFSSTLLGRRTTCANF  426



>ref|XP_008222987.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=438

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 123/180 (68%), Gaps = 14/180 (8%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+INVKSIKI+D+ + LNTSLL +D E  GGT+ISTV PYT L+T+IY+  +D
Sbjct  255  QGEPSTEYFINVKSIKISDKAVALNTSLLKIDSEGYGGTKISTVNPYTVLETSIYNAVVD  314

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++++ A   + RV  VAPF  CF         VG  VP ++ VLQSE V WR+   NSM
Sbjct  315  AFVKTVAE--IPRVKAVAPFGACFDSKNIGSTRVGPAVPAIDLVLQSESVYWRVFGANSM  372

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V V D V+CLGF+DGG     S+VIGG+QLEDNLL+F+L  S LGF+S    + T+C++F
Sbjct  373  VAVSDDVLCLGFVDGGERPRTSIVIGGHQLEDNLLQFDLAASRLGFSSSLFFSRTTCANF  432



>ref|XP_008810759.1| PREDICTED: basic 7S globulin-like [Phoenix dactylifera]
Length=431

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 124/176 (70%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN++ +P+NT+LL +D+   GGT+ISTV PYTTL+T+IY     ++ E
Sbjct  252  SAEYFIGVKSIKINEKTVPINTTLLSIDRNGVGGTKISTVTPYTTLETSIYKAVASAFEE  311

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            S A+  ++R   V+PF VCF       + VG  VP ++ VL+SE V WR+   NSMV+V 
Sbjct  312  SLAN--ITRAAAVSPFTVCFDSKEIGSTRVGPAVPSIDLVLESESVFWRIFGSNSMVQVN  369

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGG     SVVIGG+QLEDNLL+F+L T+ LGF+S  L   T+C++F
Sbjct  370  DDVLCLGFVDGGANPRTSVVIGGHQLEDNLLQFDLATTRLGFSSSLLFRQTTCANF  425



>emb|CDP10858.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 124/180 (69%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSI++ ++ + LN +LL +D++  GGT+ISTV PYT L+T+I+    +
Sbjct  253  QGEPSDEYFIGVKSIRVGEKAVKLNNTLLTIDRQGYGGTKISTVNPYTVLETSIFKAVTN  312

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++  AA+  +SRV  VAPFEVCFS        +G+ VP ++ VLQ + V W +   NSM
Sbjct  313  AFISEAATRNISRVPGVAPFEVCFSSENVLGTRLGASVPYIDLVLQGQNVVWTITGSNSM  372

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V V D V+CLGF+DGGL    S+VIGGYQLED LL+F+L TS LGFTS + G  T+CS+F
Sbjct  373  VYVNDNVLCLGFVDGGLNPRTSIVIGGYQLEDLLLQFDLATSRLGFTSTLLGAQTTCSNF  432



>gb|KHN03053.1| Basic 7S globulin [Glycine soja]
Length=414

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 122/177 (69%), Gaps = 22/177 (12%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLD  632
            TQEY+INV S+KIN ++L           E EGG    T +ST+VPYTT++++IY+ F  
Sbjct  236  TQEYFINVNSVKINGKRL---------SNEHEGGGGVLTLLSTIVPYTTMQSSIYNSFKT  286

Query  631  SYLESAASMGLSRVDPVAPFEVCFSGVGSDV----PKVEFVLQSEMVKWRM---NSMVKV  473
            S+ ++A +M ++RV  VAPFE+CFS  GS V    P +E VLQSEMVKW +   NSMV+V
Sbjct  287  SFEDAAVAMNMTRVASVAPFELCFSSRGSQVGPSMPVIELVLQSEMVKWTIHGRNSMVRV  346

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
             D V+CLGFLDGG+    S+VIGGYQLED +++F+L TSM+GF+S +    T CS F
Sbjct  347  SDEVLCLGFLDGGVNPRNSIVIGGYQLEDVIVQFDLATSMVGFSSSLVAKNTKCSDF  403



>ref|NP_001239980.1| uncharacterized protein LOC100806719 precursor [Glycine max]
 gb|ACU23537.1| unknown [Glycine max]
Length=414

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 122/177 (69%), Gaps = 22/177 (12%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLD  632
            TQEY+INV S+KIN ++L           E EGG    T +ST+VPYTT++++IY+ F  
Sbjct  236  TQEYFINVNSVKINGKRL---------SNEHEGGGGVLTLLSTIVPYTTMQSSIYNSFKT  286

Query  631  SYLESAASMGLSRVDPVAPFEVCFSGVGSDV----PKVEFVLQSEMVKWRM---NSMVKV  473
            S+ ++A +M ++RV  VAPFE+CFS  GS V    P +E VLQSEMVKW +   NSMV+V
Sbjct  287  SFEDAAVAMNITRVASVAPFELCFSSRGSQVGPSMPVIELVLQSEMVKWTIHGRNSMVRV  346

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
             D V+CLGFLDGG+    S+VIGGYQLED +++F+L TSM+GF+S +    T CS F
Sbjct  347  SDEVLCLGFLDGGVNPRNSIVIGGYQLEDVIVQFDLATSMVGFSSSLVAKNTKCSDF  403



>ref|XP_010255900.1| PREDICTED: basic 7S globulin 2-like [Nelumbo nucifera]
Length=434

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 125/180 (69%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSIKIN++ + LN++LL +D    GGT+ISTV PYT ++++IY    +
Sbjct  249  QGEASTEYFIGVKSIKINEKAVSLNSTLLSIDNSGVGGTKISTVNPYTVMESSIYKAVTE  308

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++ A+SMG++RV  VAPF VCFS        VG  VP ++ VLQ++   WR+   NSM
Sbjct  309  AFIQEASSMGITRVAAVAPFGVCFSSKNISSTRVGPAVPTIDLVLQNQSTFWRIFGANSM  368

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V+V + V+CLG ++GG     S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  369  VQVSNDVLCLGIVNGGSNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCSNF  428



>ref|XP_002517165.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45328.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=434

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + +PLNTSLL +D+E  GGT+ISTV PYT L+TTIY      +++
Sbjct  255  SSEYFIGVKSIKINGKAVPLNTSLLFIDKEGVGGTKISTVDPYTVLETTIYQAVTKVFIK  314

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A +   RV PV+PF VCF+        VG  VP+++ VLQS  V WR+   NSMV+V 
Sbjct  315  ELAEV--PRVAPVSPFGVCFNSSNIGSTRVGPAVPQIDLVLQSSSVFWRIFGANSMVQVK  372

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              V+CLGF+DGGL    S+VIGG+Q+EDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  373  SDVLCLGFVDGGLNPRTSIVIGGHQIEDNLLQFDLAASKLGFSSSLLFRQTTCANF  428



>ref|XP_003590665.1| Xyloglucan-specific endoglucanase inhibitor protein [Medicago 
truncatula]
 gb|AES60916.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=435

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 124/178 (70%), Gaps = 10/178 (6%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VK+IKI+++ + LNTSLL +D    GGT+ISTV PYT L+ +IY    D
Sbjct  252  QGQPSAEYFIGVKTIKIDEKVVSLNTSLLSIDNNGVGGTKISTVDPYTVLEASIYKAVTD  311

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-----VGSDVPKVEFVLQSEMVKWRM---NSMVK  476
            ++++++A+  + RV  VAPFE C++      +G+ VP +E  LQ+E V WR+   NSMV 
Sbjct  312  AFVKASAARNIKRVGSVAPFEFCYTNLTGTRLGAAVPTIELFLQNENVVWRIFGANSMVS  371

Query  475  VGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            + D V+CLGF++GG     S+VIGGYQLE+NLL+F+L  S LGF+SL+ G  T+CS+F
Sbjct  372  INDEVLCLGFVNGGKNTRTSIVIGGYQLENNLLQFDLAASKLGFSSLLFGRQTTCSNF  429



>ref|XP_010035593.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=436

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 123/176 (70%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIK+N +++PLN SLL + +E  GGT+ISTV PYT ++T+IY   + ++++
Sbjct  257  STEYFIGVKSIKVNGKQVPLNASLLSIGKEGNGGTKISTVNPYTVMQTSIYKAVVGAFVK  316

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              + +   RV PV PF  CF       + VG  VP+++ VLQS  V WR+   NSMV+V 
Sbjct  317  ELSQV--RRVAPVKPFRACFDSNSIGSTRVGPGVPQIDLVLQSSSVYWRIFGANSMVQVK  374

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            +GV+CLGF+DGGL    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  375  EGVLCLGFVDGGLSPKTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCSNF  430



>ref|XP_011020124.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=431

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 121/176 (69%), Gaps = 12/176 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKSIKIN+  +PLN SLL +++E  GGT+ISTV  YT ++TTIY+   DS++ 
Sbjct  250  STDYFIGVKSIKINENVVPLNASLLSINKEGYGGTKISTVNAYTVMETTIYNAVTDSFVR  309

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A   + RV  VAPF  CF+        VG  VP+++ VLQS+ V WR+   NSMV+V 
Sbjct  310  ELAKANVPRVASVAPFGACFNSKNIVGTRVGPAVPQIDLVLQSKNVYWRIFGANSMVQVK  369

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGG+    S+VIGG+QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  370  DDVLCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLAASRLGFSSSLLFRQTTCANF  425



>gb|AFK46427.1| unknown [Medicago truncatula]
Length=435

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 123/178 (69%), Gaps = 10/178 (6%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VK+IKI+++ + LNTSLL +D    GGT+ISTV PYT L+ +IY    D
Sbjct  252  QGQPSAEYFIGVKTIKIDEKVVSLNTSLLSIDNNGVGGTKISTVDPYTVLEASIYKAVTD  311

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-----VGSDVPKVEFVLQSEMVKWRM---NSMVK  476
            +++++ A+  + RV  VAPFE C++      +G+ VP +E  LQ+E V WR+   NSMV 
Sbjct  312  AFVKAPAARNIKRVGSVAPFEFCYTNLTGTRLGAAVPTIELFLQNENVVWRIFGANSMVS  371

Query  475  VGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            + D V+CLGF++GG     S+VIGGYQLE+NLL+F+L  S LGF+SL+ G  T+CS+F
Sbjct  372  INDEVLCLGFVNGGKNTRTSIVIGGYQLENNLLQFDLAASKLGFSSLLFGRQTTCSNF  429



>ref|XP_002308984.2| hypothetical protein POPTR_0006s06820g [Populus trichocarpa]
 gb|EEE92507.2| hypothetical protein POPTR_0006s06820g [Populus trichocarpa]
Length=431

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 121/176 (69%), Gaps = 12/176 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKSIKIN+  +PLN SLL +++E  GGT+ISTV  YT ++TTIY+   DS++ 
Sbjct  250  STDYFIGVKSIKINENVVPLNASLLSINREGYGGTKISTVNAYTVMETTIYNAVTDSFVR  309

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A   + RV  VAPF  CF+        VG  VP+++ VLQS+ V WR+   NSMV+V 
Sbjct  310  ELAKANVPRVASVAPFGACFNSKNIGSTRVGPAVPQIDLVLQSKNVYWRIFGANSMVQVK  369

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGG+    S+VIGG+QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  370  DDVLCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLAASRLGFSSSLLFRQTTCANF  425



>ref|XP_006419808.1| hypothetical protein CICLE_v10006987mg [Citrus clementina]
 gb|ESR33048.1| hypothetical protein CICLE_v10006987mg [Citrus clementina]
Length=436

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 124/176 (70%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKSIKIN   +PLNTSLL +D++  GGT+ISTV PYT ++T+IY  F +++++
Sbjct  257  SSDYFIGVKSIKINGNVVPLNTSLLSVDKKGFGGTKISTVNPYTVMETSIYKAFTEAFIK  316

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A++   RV PV+PF  CFS        VG+ VP ++ VLQS  V W +   NSMV+V 
Sbjct  317  ELANV--PRVKPVSPFGTCFSSPHIGSTRVGAAVPLIDLVLQSSKVIWSIFGANSMVQVK  374

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  375  DDVLCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHRTTCSNF  430



>ref|XP_006419833.1| hypothetical protein CICLE_v10006689mg [Citrus clementina]
 gb|ESR33073.1| hypothetical protein CICLE_v10006689mg [Citrus clementina]
Length=437

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 122/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN   +PLNTSLL +D+E  GGT+ISTV PYT L T+IY+    ++++
Sbjct  258  SAEYFIGVKSIKINGNTVPLNTSLLSIDKEGFGGTKISTVNPYTVLHTSIYNALARAFIK  317

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A+  + RV PVAPF   F+        VG  VP+++ VLQS  V WR+   NSMV+V 
Sbjct  318  EVAN--IPRVTPVAPFGAYFNSTFVGSTRVGPAVPQIDLVLQSNTVIWRIFGANSMVQVR  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  376  DDVLCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHQTTCANF  431



>ref|XP_003542884.1| PREDICTED: basic 7S globulin [Glycine max]
 gb|KHN37575.1| Basic 7S globulin [Glycine soja]
Length=403

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 127/194 (65%), Gaps = 20/194 (10%)
 Frame = -1

Query  853  MFRDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVP  674
            +FR L  TPL +  Q+ T     INV S+KIN +K+  +T L        GG ++STVVP
Sbjct  216  IFRSLTFTPLVAN-QDQTQTHPSINVNSVKINGKKVSFDTPL-------GGGAQLSTVVP  267

Query  673  YTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQ  515
            YTTL+T+IY  F  +YL++A+SM + RVDPV+PF +CF       S VG +VP ++ VLQ
Sbjct  268  YTTLQTSIYANFESAYLKAASSMSMKRVDPVSPFGLCFESNGVGSSQVGPNVPVIDLVLQ  327

Query  514  SEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGF  344
            SEMVKW +   NSMV+V D VMCLGF+DGG      +VIGGYQLED L++ +  TSM+GF
Sbjct  328  SEMVKWSIHGRNSMVQVNDDVMCLGFVDGGENPRNPIVIGGYQLEDVLVQIDFDTSMVGF  387

Query  343  TS--LMAGTSCSHF  308
            +   L    +CSHF
Sbjct  388  SPSLLTKHATCSHF  401



>ref|XP_009342158.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Pyrus x bretschneideri]
Length=408

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 114/176 (65%), Gaps = 22/176 (13%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q  T  EY IN+KSIKI+ +KL L           EG  ++ST+VPYT ++++IY  F  
Sbjct  233  QVETPHEYVINLKSIKISGKKLSLGIE--------EGKIKLSTIVPYTXMESSIYATFTK  284

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +Y ++A SM ++RV PVAPF  CFS        VG  VP ++ VLQSEMVKWR+   NSM
Sbjct  285  AYEQTATSMNITRVSPVAPFGQCFSSRENDGTLVGPKVPAIDLVLQSEMVKWRIHGRNSM  344

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  314
            V+V D VMCLGFLDGGL    S+VIGGYQLED LL F++G S LGFT      SCS
Sbjct  345  VQVSDEVMCLGFLDGGLNLKTSMVIGGYQLEDTLLHFDVGASRLGFTQ----QSCS  396



>gb|KJB46995.1| hypothetical protein B456_008G005100 [Gossypium raimondii]
Length=436

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 125/181 (69%), Gaps = 12/181 (7%)
 Frame = -1

Query  814  PQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFL  635
            P    + EY+I VKSIK+N+  + LNT+LL ++ E  GGT+ISTV PYT L+++I+    
Sbjct  250  PMGEASAEYFIGVKSIKVNENPISLNTTLLSINNEGVGGTKISTVDPYTVLESSIFKAVT  309

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NS  485
            ++++  AA+M +SRV  VAPFEVCFS        +G  VP ++ VLQ++ V WRM   NS
Sbjct  310  EAFINEAAAMNISRVAGVAPFEVCFSSSNIASTRLGPTVPSIDLVLQNQNVFWRMFGSNS  369

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            MV+V   V+CLGF++GG     S+VIGG+QLE+ LL+F+L TS LGF++ + G  T+C++
Sbjct  370  MVEVNRDVLCLGFVNGGSNPTTSIVIGGHQLENTLLQFDLATSRLGFSATLLGRQTTCAN  429

Query  310  F  308
            F
Sbjct  430  F  430



>ref|XP_003518926.1| PREDICTED: basic 7S globulin [Glycine max]
Length=435

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 129/181 (71%), Gaps = 13/181 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSIKI+++ +PLNT+LL ++ +  GGT+IS+V PYT L+ +I+    +
Sbjct  249  QGEPSAEYFIGVKSIKIDEKTVPLNTTLLSINSKGVGGTKISSVNPYTVLEDSIFKAVTE  308

Query  631  SYLESAASMGLSRVDPVAPFEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++++++  ++RV  VAPFEVCFS        +G+ VP +E VLQ++   WR+   NSM
Sbjct  309  AFVKASSARNITRVASVAPFEVCFSRENVLATRLGAAVPTIELVLQNQKTVWRIFGANSM  368

Query  481  VKVG-DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            V V  D V+CLGF++GG     S+VIGGYQLEDNLL+F+L TS LGF+SL+ G  T+C++
Sbjct  369  VSVSDDKVLCLGFVNGGENPRTSIVIGGYQLEDNLLQFDLATSRLGFSSLLYGSRTTCAN  428

Query  310  F  308
            F
Sbjct  429  F  429



>gb|KHN03449.1| Basic 7S globulin [Glycine soja]
Length=410

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 121/176 (69%), Gaps = 13/176 (7%)
 Frame = -1

Query  796  QEYYINVKSIKINDRKLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLDS  629
            QEY INV S+KIN  +L L+TS      E +G     T +ST++PYTT++++IY+ F  S
Sbjct  224  QEYIINVSSVKINGNRLSLDTSSSESSNEQDGSVGALTLLSTILPYTTMQSSIYNSFKTS  283

Query  628  YLESAASMGLSRVDPVAPFEVCFSG----VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            + ++A +M ++RV  VAPFE+CFS      G  VP +E VLQSEMVKW +   NSMV+V 
Sbjct  284  FEDAAVAMNMTRVASVAPFELCFSSRGEQAGPSVPVIELVLQSEMVKWTIHGRNSMVRVS  343

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            D V+CLGFLDGG+    S+VIGGYQLED +++F+L TSM+GF+S +    T CS F
Sbjct  344  DEVVCLGFLDGGVNPRNSIVIGGYQLEDVVVQFDLATSMVGFSSSLVAKNTKCSDF  399



>ref|XP_003550008.2| PREDICTED: basic 7S globulin 2-like [Glycine max]
Length=432

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 121/176 (69%), Gaps = 13/176 (7%)
 Frame = -1

Query  796  QEYYINVKSIKINDRKLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLDS  629
            QEY INV S+KIN  +L L+TS      E +G     T +ST++PYTT++++IY+ F  S
Sbjct  246  QEYIINVSSVKINGNRLSLDTSSSESSNEQDGSVGALTLLSTILPYTTMQSSIYNSFKTS  305

Query  628  YLESAASMGLSRVDPVAPFEVCFSG----VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            + ++A +M ++RV  VAPFE+CFS      G  VP +E VLQSEMVKW +   NSMV+V 
Sbjct  306  FEDAAVAMNMTRVASVAPFELCFSSRGEQAGPSVPVIELVLQSEMVKWTIHGRNSMVRVS  365

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            D V+CLGFLDGG+    S+VIGGYQLED +++F+L TSM+GF+S +    T CS F
Sbjct  366  DEVVCLGFLDGGVNPRNSIVIGGYQLEDVVVQFDLATSMVGFSSSLVAKNTKCSDF  421



>ref|XP_002311834.1| hypothetical protein POPTR_0008s20730g [Populus trichocarpa]
 gb|EEE89201.1| hypothetical protein POPTR_0008s20730g [Populus trichocarpa]
Length=437

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 136/205 (66%), Gaps = 25/205 (12%)
 Frame = -1

Query  847  RDL*CTPL*-SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPY  671
            R L  TPL  SP  +G++Q+Y INVKSIKIN ++L L        + + GGT+IST VPY
Sbjct  233  RSLMYTPLVTSPDGSGSSQDYSINVKSIKINGKRLSLR------QKGIGGGTKISTTVPY  286

Query  670  TTLKTTIYHPFLDSYLESAAS---MGLSRVDPVAPFEVCFSG--------VGSDVPKVEF  524
            TTL+++IY  F+ +Y ESA +   + ++ V PVAPF +CFS         +G  VP ++ 
Sbjct  287  TTLESSIYSTFIKAYKESATNNYFLNMTVVAPVAPFGLCFSSKEVPSSMLLGPMVPVIDL  346

Query  523  VLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGAS--VVIGGYQLEDNLLEFNLGT  359
            VLQSEMVKWR+   N+MV V D VMCLGFLDGG     S  +VIGG+QLEDNLLEFNLGT
Sbjct  347  VLQSEMVKWRVHGRNAMVPVLDEVMCLGFLDGGSKSKTSSSIVIGGFQLEDNLLEFNLGT  406

Query  358  SMLGFTS--LMAGTSCSHFTRFSME  290
            SMLGF+S  L   TSCS +    M+
Sbjct  407  SMLGFSSSLLTRHTSCSDYHTRMMQ  431



>gb|ACU24232.1| unknown [Glycine max]
Length=403

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 126/194 (65%), Gaps = 20/194 (10%)
 Frame = -1

Query  853  MFRDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVP  674
            +FR L  TPL +  Q+ T     INV S+KIN +K+         D  + GG ++STVVP
Sbjct  216  IFRSLTFTPLVAN-QDQTQTHPSINVNSVKINGKKVSF-------DSPLGGGAQLSTVVP  267

Query  673  YTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQ  515
            YTTL+T+IY  F  +YL++A+SM + RVDPV+PF +CF       S VG +VP ++ VLQ
Sbjct  268  YTTLQTSIYANFESAYLKAASSMSMKRVDPVSPFGLCFESNGVGSSQVGPNVPVIDLVLQ  327

Query  514  SEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGF  344
            SEMVKW +   NSMV+V D VMCLGF+DGG      +VIGGYQLED L++ +  TSM+GF
Sbjct  328  SEMVKWSIHGRNSMVQVNDDVMCLGFVDGGENPRNPIVIGGYQLEDVLVQIDFDTSMVGF  387

Query  343  TS--LMAGTSCSHF  308
            +   L    +CSHF
Sbjct  388  SPSLLTKHATCSHF  401



>ref|XP_007224886.1| hypothetical protein PRUPE_ppa022337mg [Prunus persica]
 gb|EMJ26085.1| hypothetical protein PRUPE_ppa022337mg [Prunus persica]
Length=400

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 117/171 (68%), Gaps = 19/171 (11%)
 Frame = -1

Query  796  QEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLES  617
            QEY+IN+K IKI+ ++L LN       +    G ++ST VPYTT+++++Y  F  +Y ++
Sbjct  227  QEYFINLKYIKISGKRLSLN------KEGFREGIKLSTTVPYTTMESSVYVTFTRAYEQA  280

Query  616  AASMGLSRVDPVAPFEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  467
            A +M ++RV PVAPF +CFS       GVG  VP ++ VLQSEMVKWR+   NSMV+V +
Sbjct  281  AMAMNMTRVAPVAPFVLCFSSEQAEGRGVGPKVPAIDLVLQSEMVKWRIHGRNSMVQVSN  340

Query  466  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  314
             VMCLGFLDGG     S+VIGGYQLED LL F+L  S+LGF+S    TSCS
Sbjct  341  QVMCLGFLDGGSDLKTSIVIGGYQLEDTLLHFDLSASVLGFSS---QTSCS  388



>ref|XP_010278291.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=470

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 124/174 (71%), Gaps = 13/174 (7%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I VKSI+IN + + LN+ LL +D E  GGT+ISTVVPYTTL+T+IY+    +++E A
Sbjct  291  EYFIGVKSIEINKKPVLLNSDLLSIDGEGVGGTKISTVVPYTTLETSIYNSVTGAFMEEA  350

Query  613  ASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
             SMG++RV  VAPF  CFS        +G++VP ++ VLQ + V WR+   N+MV V +G
Sbjct  351  ISMGITRVGAVAPFGACFSSESIRGSRMGAEVPSIDLVLQGQSV-WRIFGKNAMVDVREG  409

Query  463  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLM--AGTSCSHF  308
            V+CLGFLDGG     S+V+GG+QLED LL+F+L TS LGF+ L+    TSC++F
Sbjct  410  VLCLGFLDGGRNPRTSIVLGGHQLEDILLQFDLKTSKLGFSPLLHYRQTSCANF  463



>ref|XP_006419831.1| hypothetical protein CICLE_v10006962mg [Citrus clementina]
 gb|ESR33071.1| hypothetical protein CICLE_v10006962mg [Citrus clementina]
Length=435

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 123/176 (70%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKSIKIN   +P+NTSLL +D++  GGT+ISTV PYT L+++IY  F++++ +
Sbjct  256  SSDYFIEVKSIKINGHVIPMNTSLLSIDKKGFGGTKISTVHPYTVLESSIYEVFIEAFTK  315

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A +   RV PV+PF  CF+         G+ VP+++ VLQS  V W +   NSMV+V 
Sbjct  316  GLAKV--PRVKPVSPFGACFNSTHIGSTRAGAAVPQIDLVLQSSKVIWSIFGANSMVQVK  373

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  374  DDVLCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHRTTCSNF  429



>ref|XP_003546133.1| PREDICTED: basic 7S globulin [Glycine max]
 gb|KHN33057.1| Basic 7S globulin [Glycine soja]
Length=403

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 127/194 (65%), Gaps = 20/194 (10%)
 Frame = -1

Query  853  MFRDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVP  674
            +FR L  TPL    Q+ T  +  INV S+KIN +K+  +T L        GG ++STVVP
Sbjct  216  IFRYLTFTPL-VANQDPTQTQSSINVNSVKINGKKVAFDTPL-------GGGAQLSTVVP  267

Query  673  YTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQ  515
            YTTL+T+IY  F  +YL++A+SM + RVDPV+PF +CF       S VG +VP ++ VLQ
Sbjct  268  YTTLQTSIYDNFESAYLKAASSMDMKRVDPVSPFGLCFESNGVGSSQVGPNVPIIDLVLQ  327

Query  514  SEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGF  344
            SEMVKW +   NSMV+V D VMCLGF+DGG     S+VIGG+QLED L++ +  TSM+GF
Sbjct  328  SEMVKWSIYGRNSMVQVSDDVMCLGFVDGGENPRNSIVIGGFQLEDVLVQIDFDTSMVGF  387

Query  343  TS--LMAGTSCSHF  308
            +   L    SCS F
Sbjct  388  SPSLLTKQASCSDF  401



>gb|KFK42681.1| hypothetical protein AALP_AA1G026100 [Arabis alpina]
Length=433

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 122/177 (69%), Gaps = 13/177 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + EY+I V +IKIND+ +P+NT+LL +D     GGT+ISTV PYT L+T+I++ F  +++
Sbjct  251  SSEYFIGVTAIKINDKTVPINTTLLKIDSVTGIGGTKISTVNPYTVLETSIFNAFTTAFV  310

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
              AA+  +SRV  VAPF  CFS        +G  VP+++ VL S  V WR+   NS+V V
Sbjct  311  REAAARNISRVASVAPFGACFSTKNVVPTRLGYAVPEIQLVLHSNNVVWRITGSNSVVSV  370

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
             D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  371  SDDVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGSRTTCANF  427



>ref|XP_006489295.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=436

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 124/176 (70%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VK+IKIN   +PLNTSLL +D++  GGT+ISTV PYT ++T+IY  F +++++
Sbjct  257  SSDYFIGVKTIKINGNVVPLNTSLLSVDKKGFGGTKISTVNPYTVMETSIYKAFTEAFIK  316

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A++   RV PV+PF  CFS        VG+ V +++ VLQS  V W +   NSMV+V 
Sbjct  317  ELANV--PRVKPVSPFGTCFSSPHIGSTRVGAAVAQIDLVLQSSKVIWSIFGANSMVQVK  374

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  375  DDVLCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFHRTTCSNF  430



>ref|XP_010938774.1| PREDICTED: basic 7S globulin-like [Elaeis guineensis]
Length=431

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN++ +P+NT LL +D+   GGT+ISTV PYT L+T+IY     ++ +
Sbjct  252  SAEYFIGVKSIKINEKTVPINTKLLSIDRNGVGGTKISTVTPYTVLETSIYKAVTSAFQK  311

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            S A++  ++   VAPF VCF+        VG  VP ++ VLQ+  V WR+   NSMV+V 
Sbjct  312  SLANV--TKAAAVAPFTVCFNSKEIGSTRVGPAVPSIDLVLQNANVFWRIFGANSMVQVN  369

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGG     SVVIGG+QLEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  370  DDVLCLGFVDGGAKPRTSVVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCANF  425



>ref|XP_006489296.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKS+KIN   +PLNTSLL +D+   GGT+ISTV PYT L+++IY  F+ ++ +
Sbjct  258  STDYFIGVKSVKINGHVVPLNTSLLSIDKNGVGGTKISTVHPYTVLESSIYEAFVKAFTK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A+    RVD V+PF  CF       + VG  VP+++ VLQS  V WR+   NSMV+V 
Sbjct  318  ELANA--PRVDSVSPFGACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVK  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              VMCLGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  376  SNVMCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNF  431



>gb|KFK42682.1| hypothetical protein AALP_AA1G026200 [Arabis alpina]
Length=433

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 127/181 (70%), Gaps = 13/181 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFL  635
            Q   + EY+I V  IKI+D+ +P+N ++L ++ +   GGT++STV PYT ++T+IY+ F 
Sbjct  247  QGEKSSEYFIGVTDIKISDKSVPINKTMLKINGDTGFGGTKLSTVNPYTVMETSIYNAFT  306

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NS  485
             +++ +A++  +SRV  V PF  CFS        VG  VP+++ VLQS+ V WR+   NS
Sbjct  307  SAFIRAASARNISRVSSVKPFGACFSTANVGVTRVGYAVPEIQLVLQSKDVVWRIFGANS  366

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            MV VG+ V+CLGF+DGG+ +  SVVIGG+QLEDNL+EF+L ++ LGF+S + G  T+C++
Sbjct  367  MVSVGNDVICLGFVDGGVNESTSVVIGGFQLEDNLIEFDLASNRLGFSSTLLGRSTNCAN  426

Query  310  F  308
            F
Sbjct  427  F  427



>ref|XP_006489297.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKS+KIN   +PLNTSLL +D+   GGT+ISTV PYT L+++IY  F+ ++ +
Sbjct  258  STDYFIGVKSVKINGHVVPLNTSLLSIDKNGVGGTKISTVHPYTVLESSIYEAFVKAFTK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A+    RVD V+PF  CF       + VG  VP+++ VLQS  V WR+   NSMV+V 
Sbjct  318  ELANA--PRVDSVSPFGACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVK  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              VMCLGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  376  SNVMCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNF  431



>ref|XP_004298169.1| PREDICTED: basic 7S globulin-like [Fragaria vesca subsp. vesca]
Length=414

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 123/176 (70%), Gaps = 19/176 (11%)
 Frame = -1

Query  802  TTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            +  EY+I++KSI++N ++L LN       +E  GG ++ST+VPY+T++ ++Y  F+ ++ 
Sbjct  233  SPHEYFIHLKSIRVNGKQLALNY------KEGLGGIKLSTIVPYSTMERSVYAVFVRAFE  286

Query  622  ESAASMGLSRVDPVAPFEVCF--------SGVGSDVPKVEFVLQSEMVKWRM---NSMVK  476
            ++A +M ++RV  VAPF +CF        + VGS VP V+  LQSEMVKWR+   NSMV+
Sbjct  287  QAAMAMNMTRVASVAPFGLCFGSKNIDGSTRVGSRVPVVDLGLQSEMVKWRLHGRNSMVQ  346

Query  475  VGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  314
            V D VMCLGFLDGGL Q  S+V+GG+QLED LL F+LG SMLGF+S  LM   +CS
Sbjct  347  VSDEVMCLGFLDGGLEQKTSIVLGGHQLEDTLLHFDLGASMLGFSSSKLMDQNTCS  402



>ref|XP_002277699.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=435

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 121/180 (67%), Gaps = 14/180 (8%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSIKIN + +PLN +LL +D +  GGT+ISTV PYT L+T+IY     
Sbjct  252  QGEASVEYFIGVKSIKINGKAVPLNATLLSIDSQGYGGTKISTVHPYTVLETSIYKAVTQ  311

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++L+  ++  ++RV  V+PF  CFS        VG  VP ++ VLQ + V WR+   NSM
Sbjct  312  AFLKELST--ITRVASVSPFGACFSSKDIGSTRVGPAVPPIDLVLQRQSVYWRVFGANSM  369

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V+V D V+CLGF+DGG+    S+VIGG QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  370  VQVSDNVLCLGFVDGGVNPRTSIVIGGRQLEDNLLQFDLATSRLGFSSSLLSRQTTCSNF  429



>ref|XP_006419829.1| hypothetical protein CICLE_v100071811mg, partial [Citrus clementina]
 gb|ESR33069.1| hypothetical protein CICLE_v100071811mg, partial [Citrus clementina]
Length=327

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKSIKIN   +P+NTSLL +D++  GGT+IST+ PYT L+++IY  F++++ +
Sbjct  148  SSDYFIEVKSIKINGHVIPMNTSLLSIDKKGFGGTKISTIRPYTVLESSIYEAFIEAFTK  207

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A +   RV PV+PF  CF+         G  VP+++ VLQS    W +   NSMV+V 
Sbjct  208  ELAKV--PRVKPVSPFGACFNSTHIGRTRAGPAVPQIDLVLQSSKAVWSIFGANSMVQVK  265

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              V+CLGF+DGG+    S+VIGG+QLEDNLL+F+LGT+ LGF+S  L   T+CS+F
Sbjct  266  RDVLCLGFVDGGVHPRTSIVIGGHQLEDNLLQFDLGTARLGFSSSLLFRQTTCSNF  321



>ref|XP_011011197.1| PREDICTED: basic 7S globulin-like isoform X2 [Populus euphratica]
Length=429

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 122/177 (69%), Gaps = 15/177 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + +Y+I VKSIKIN + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + +++
Sbjct  248  SSDYFIGVKSIKINGKAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFV  307

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
            +  A +   RV  VAPF  CF+        VG  VP+++ VLQS  V WR+   NSMV+V
Sbjct  308  KELALV--PRVASVAPFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQV  365

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
               VMCLGF+DGGL    S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  366  KSDVMCLGFVDGGLNPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  422



>ref|XP_011015097.1| PREDICTED: basic 7S globulin-like isoform X2 [Populus euphratica]
Length=429

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 122/177 (69%), Gaps = 15/177 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + +Y+I VKSIKIN + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + +++
Sbjct  248  SSDYFIGVKSIKINGKAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFV  307

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
            +  A +   RV  VAPF  CF+        VG  VP+++ VLQS  V WR+   NSMV+V
Sbjct  308  KELALV--PRVASVAPFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQV  365

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
               VMCLGF+DGGL    S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  366  KSDVMCLGFVDGGLNPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  422



>ref|XP_011015096.1| PREDICTED: basic 7S globulin-like isoform X1 [Populus euphratica]
Length=439

 Score =   165 bits (418),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 122/177 (69%), Gaps = 15/177 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + +Y+I VKSIKIN + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + +++
Sbjct  258  SSDYFIGVKSIKINGKAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFV  317

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
            +  A +   RV  VAPF  CF+        VG  VP+++ VLQS  V WR+   NSMV+V
Sbjct  318  KELALV--PRVASVAPFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQV  375

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
               VMCLGF+DGGL    S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  376  KSDVMCLGFVDGGLNPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  432



>ref|XP_011011196.1| PREDICTED: basic 7S globulin-like isoform X1 [Populus euphratica]
Length=439

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 122/177 (69%), Gaps = 15/177 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + +Y+I VKSIKIN + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + +++
Sbjct  258  SSDYFIGVKSIKINGKAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFV  317

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
            +  A +   RV  VAPF  CF+        VG  VP+++ VLQS  V WR+   NSMV+V
Sbjct  318  KELALV--PRVASVAPFGACFNSTNIGSTRVGPPVPQIDLVLQSSKVSWRIFGANSMVQV  375

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
               VMCLGF+DGGL    S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  376  KSDVMCLGFVDGGLNPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  432



>ref|XP_007201544.1| hypothetical protein PRUPE_ppa017430mg, partial [Prunus persica]
 gb|EMJ02743.1| hypothetical protein PRUPE_ppa017430mg, partial [Prunus persica]
Length=412

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 121/180 (67%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V SIK+N++ + +NT+LL +D++  GGT+ISTV PYT L+ +I+    +
Sbjct  227  QGEASSEYFIKVNSIKVNEKPVAVNTTLLSIDRDGVGGTKISTVNPYTVLEASIFKAVTE  286

Query  631  SYLESAASMGLSRVDPVAPFEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++  + SM ++RV  V PFEVCFS        VG  VP ++ VLQ+E   WR+   NSM
Sbjct  287  AFISESKSMNITRVSSVGPFEVCFSRDNVLSTRVGPAVPSIDLVLQNESTFWRVFGANSM  346

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V+V D V+CL  ++GG     S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+CS+F
Sbjct  347  VQVNDDVLCLAVVNGGESPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCSNF  406



>gb|KJB23117.1| hypothetical protein B456_004G081800 [Gossypium raimondii]
Length=433

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 123/181 (68%), Gaps = 12/181 (7%)
 Frame = -1

Query  814  PQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFL  635
            P    + EY+I VKSIK+N++ + LNT+LL ++ E  GGT+ISTV PYT L+ +I+    
Sbjct  247  PLGEPSAEYFIGVKSIKVNEKPVSLNTTLLSINSEGVGGTKISTVNPYTALEASIFKAVT  306

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NS  485
            ++++  AA+  ++RV  VAPFEVCFS        +G+ VP ++ VLQ+E   WR+   NS
Sbjct  307  EAFINEAAARNITRVAGVAPFEVCFSSRNIVGTRLGAAVPSIDLVLQNENTFWRIFGANS  366

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            MV+V   V CLGF++GG     S+VIGGYQLED LL+F+L TS LGF+S + G  T+C++
Sbjct  367  MVEVSREVSCLGFVNGGSNPMTSIVIGGYQLEDTLLQFDLATSRLGFSSTLLGRQTTCAN  426

Query  310  F  308
            F
Sbjct  427  F  427



>ref|XP_008235257.1| PREDICTED: basic 7S globulin 2-like [Prunus mume]
Length=473

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 121/180 (67%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V SIK+N++ + +NT+LL +D++  GGT+ISTV PYT L+ +I+    +
Sbjct  288  QGEASSEYFIKVNSIKVNEKSVAVNTTLLSIDRDGVGGTKISTVNPYTVLEASIFKAVTE  347

Query  631  SYLESAASMGLSRVDPVAPFEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++  + SM ++RV  V PFEVCFS        VG  VP ++ VLQ+E   WR+   NSM
Sbjct  348  AFISESKSMNITRVSSVGPFEVCFSRDNVLSTRVGPAVPSIDLVLQNESTFWRVFGANSM  407

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V+V D V+CL  ++GG     SVVIGGYQLE+NLL+F+L TS LGF+S  L   T+CS+F
Sbjct  408  VQVNDDVLCLAVVNGGESPRTSVVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCSNF  467



>emb|CDX86682.1| BnaC08g00210D [Brassica napus]
Length=415

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 120/182 (66%), Gaps = 13/182 (7%)
 Frame = -1

Query  814  PQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPF  638
            P    + EY+I V +IKI+++ +P+N +LL +D     GGT+ISTV PYT L+T+IY+ F
Sbjct  228  PSGEKSSEYFIGVTAIKIDEKTVPINATLLKIDGTTGVGGTKISTVNPYTVLETSIYNAF  287

Query  637  LDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---N  488
              +Y   AA   ++RV  VAPF  CFS        +G  VP+++ VL S  V WR+   N
Sbjct  288  TSAYAREAAGRNITRVASVAPFGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGAN  347

Query  487  SMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCS  314
            SMV V D V+CLGF+DGG+    SVVIGGYQLEDNL+EF+L ++  GF+S + G  T+C+
Sbjct  348  SMVSVSDDVICLGFVDGGVNARTSVVIGGYQLEDNLIEFDLASNRFGFSSTLLGRRTNCA  407

Query  313  HF  308
            +F
Sbjct  408  NF  409



>ref|XP_003590668.1| Basic 7S globulin [Medicago truncatula]
 gb|AES60919.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=434

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 124/175 (71%), Gaps = 12/175 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + EY+I VK+IKI+ + + L+TSLL +D     GGT+ISTV PYT L+ +IY    D+++
Sbjct  255  SAEYFIGVKTIKIDGKVVSLDTSLLSIDSSNGAGGTKISTVDPYTVLEASIYKAVTDAFV  314

Query  622  ESAASMGLSRVDPVAPFEVCFSGV-----GSDVPKVEFVLQSEMVKWRM---NSMVKVGD  467
            +++A+  + RVD VAPFE C++ V     G+DVP +E  LQ+ ++ WR+   NSMV + D
Sbjct  315  KASAARNIKRVDSVAPFEFCYTNVTGTRLGADVPTIELYLQNNVI-WRIFGANSMVNIND  373

Query  466  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
             V+CLGF+ GG    AS+VIGGYQLE+NLL+F+L  S LGF+SL+ G  T+CS+F
Sbjct  374  EVLCLGFVIGGENTWASIVIGGYQLENNLLQFDLAASKLGFSSLLFGRQTTCSNF  428



>ref|XP_004290668.1| PREDICTED: basic 7S globulin 2-like [Fragaria vesca subsp. vesca]
Length=439

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 124/181 (69%), Gaps = 13/181 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFL  635
            Q   + EY+I VKSIK+ND+ + +NT+LL ++     GGT+ISTV PYT L+ +I+    
Sbjct  253  QGDASSEYFIGVKSIKVNDKAVTINTTLLSINTTSGVGGTKISTVNPYTVLEASIFKAVT  312

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NS  485
            ++++  +A+  +SRV+ VAPFEVCFS        +G  VP+++ VLQ+E   WR+   NS
Sbjct  313  EAFITESAARNISRVNAVAPFEVCFSTENVLSTRLGPSVPEIDLVLQNESTYWRIFGANS  372

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            MV V D V+CLGF++GG     S+VIGG+QLEDNL++F+L  S +GF+S + G  T+CS+
Sbjct  373  MVYVSDNVVCLGFVNGGEDARTSIVIGGHQLEDNLVQFDLAASRVGFSSTLLGRQTTCSN  432

Query  310  F  308
            F
Sbjct  433  F  433



>emb|CDY15456.1| BnaA08g27400D [Brassica napus]
Length=415

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 121/182 (66%), Gaps = 13/182 (7%)
 Frame = -1

Query  814  PQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPF  638
            P    + EY+I V +IKI+++ +P+N +LL +D     GGT+ISTV PYT L+T+IY+ F
Sbjct  228  PSGEKSSEYFIGVTAIKIDEKTVPINATLLKIDGTTGVGGTKISTVNPYTVLETSIYNAF  287

Query  637  LDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---N  488
              +Y+  AA   ++RV  VAPF  CFS        +G  VP+++ VL S  V WR+   N
Sbjct  288  TSAYVREAAGRNITRVASVAPFGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGAN  347

Query  487  SMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCS  314
            SMV V D ++CLGF+DGG+    SVVIGGYQLEDNL+EF+L ++  GF+S + G  T+C+
Sbjct  348  SMVSVSDDIICLGFVDGGVNARTSVVIGGYQLEDNLIEFDLASNKFGFSSTLLGRRTNCA  407

Query  313  HF  308
            +F
Sbjct  408  NF  409



>ref|XP_006419811.1| hypothetical protein CICLE_v10004995mg [Citrus clementina]
 gb|ESR33051.1| hypothetical protein CICLE_v10004995mg [Citrus clementina]
Length=437

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKS+KIN   +PLNTSLL +D+   GGT+ISTV PYT L+++IY  F+ ++ +
Sbjct  258  STDYFIGVKSVKINGHVVPLNTSLLSIDKNGVGGTKISTVHPYTVLESSIYEAFVKAFTK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A+    RV+ V+PF  CF       + VG  VP+++ VLQS  V WR+   NSMV+V 
Sbjct  318  ELANA--PRVESVSPFGACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVK  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              VMCLGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  376  SNVMCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNF  431



>ref|XP_006419809.1| hypothetical protein CICLE_v10004993mg [Citrus clementina]
 gb|ESR33049.1| hypothetical protein CICLE_v10004993mg [Citrus clementina]
Length=437

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKS+KIN   +PLNTSLL +D+   GGT+ISTV PYT L+++IY  F+ ++ +
Sbjct  258  STDYFIGVKSVKINGHVVPLNTSLLSIDKNGVGGTKISTVHPYTVLESSIYEAFVKAFTK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A+    RV+ V+PF  CF       + VG  VP+++ VLQS  V WR+   NSMV+V 
Sbjct  318  ELANA--PRVESVSPFGACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVK  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              VMCLGF+DGG+    S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  376  SNVMCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRRTTCSNF  431



>ref|XP_008340919.1| PREDICTED: basic 7S globulin [Malus domestica]
Length=406

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 112/171 (65%), Gaps = 22/171 (13%)
 Frame = -1

Query  796  QEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLES  617
             EY IN+KSIKI  +K+ L+          EG  ++ST+VPYTT +++IY  F  +Y ++
Sbjct  236  HEYIINLKSIKIRGKKMSLDIE--------EGKIKLSTIVPYTTXESSIYATFTKAYEQA  287

Query  616  AASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  467
            A SM ++RV PVAPF  CFS        VG  VP ++ VLQSE+VKWR+   NSMV+V +
Sbjct  288  AMSMNMTRVSPVAPFGQCFSSRKKDGTLVGPKVPVIDLVLQSELVKWRIHGRNSMVQVRN  347

Query  466  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  314
             VMCLGFLDGGL    S+VIGGYQLED LL F++G S LGFT      SCS
Sbjct  348  EVMCLGFLDGGLNLKTSMVIGGYQLEDTLLHFDVGASRLGFTQ----QSCS  394



>ref|XP_006489309.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=435

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKSIKIN   +P+NTSLL +D++  GGT+IST+ PYT L+++IY  F++++ +
Sbjct  256  SSDYFIEVKSIKINGHVIPMNTSLLSIDKKGFGGTKISTIRPYTVLESSIYEAFIEAFTK  315

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A +   RV PV+PF  CF+         G  VP+++ VLQS    W +   NSMV+V 
Sbjct  316  ELAKV--PRVKPVSPFGACFNSTHIGRTRAGPAVPQIDLVLQSSKAVWSIFGANSMVQVK  373

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              V+CLGF+DGG+    S+VIGG+QLEDNLL+F+LGT+ LGF+S  L   T+CS+F
Sbjct  374  RDVLCLGFVDGGVHPRTSIVIGGHQLEDNLLQFDLGTARLGFSSSLLFRQTTCSNF  429



>gb|KDO74795.1| hypothetical protein CISIN_1g037976mg [Citrus sinensis]
Length=435

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKSIKIN   +P+NTSLL +D++  GGT+IST+ PYT L+++IY  F++++ +
Sbjct  256  SSDYFIEVKSIKINGHVIPMNTSLLSIDKKGFGGTKISTIRPYTVLESSIYEAFIEAFTK  315

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A +   RV PV+PF  CF+         G  VP+++ VLQS    W +   NSMV+V 
Sbjct  316  ELAKV--PRVKPVSPFGACFNSTHIGRTRAGPAVPQIDLVLQSSKAVWSIFGANSMVQVK  373

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              V+CLGF+DGG+    S+VIGG+QLEDNLL+F+LGT+ LGF+S  L   T+CS+F
Sbjct  374  RDVLCLGFVDGGVHPRTSIVIGGHQLEDNLLQFDLGTARLGFSSSLLFRQTTCSNF  429



>gb|KDO74801.1| hypothetical protein CISIN_1g040581mg [Citrus sinensis]
Length=394

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 132/191 (69%), Gaps = 18/191 (9%)
 Frame = -1

Query  829  PL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTI  650
            PL   P  G +Q+Y+INVKSIKIN   L +          +EG T++ST+VPY T++++I
Sbjct  213  PLMYTPLIGKSQDYFINVKSIKINGNPLSVT---------IEGLTKLSTIVPYATMESSI  263

Query  649  YHPFLDSYLESAA--SMGLSRVDPVAPFEVCFSGVG---SDVPKVEFVLQSEMVKWRM--  491
            Y  F  ++ ++AA  S  +S V PVAPF +CFS  G   S VP ++FVLQSEMVKWR   
Sbjct  264  YATFAKAFTKAAAAASRDMSVVAPVAPFSLCFSSKGFNGSAVPVIDFVLQSEMVKWRFYG  323

Query  490  -NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  314
             NSMVKV + V+CLGFLDGG    +S+V+GG+QLEDN+++F+LGTSMLGF++L  GT CS
Sbjct  324  SNSMVKVNEEVVCLGFLDGGSDLTSSIVLGGFQLEDNVMDFDLGTSMLGFSTLR-GTCCS  382

Query  313  HFTRFSMERDS  281
             F+  S+  +S
Sbjct  383  DFSPNSVLDES  393



>ref|XP_006489306.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=394

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 132/191 (69%), Gaps = 18/191 (9%)
 Frame = -1

Query  829  PL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTI  650
            PL   P  G +Q+Y+INVKSIKIN   L +          +EG T++ST+VPY T++++I
Sbjct  213  PLMYTPLIGKSQDYFINVKSIKINGNPLSVT---------IEGLTKLSTIVPYATMESSI  263

Query  649  YHPFLDSYLESAA--SMGLSRVDPVAPFEVCFSGVG---SDVPKVEFVLQSEMVKWRM--  491
            Y  F  ++ ++AA  S  +S V PVAPF +CFS  G   S VP ++FVLQSEMVKWR   
Sbjct  264  YATFAKAFTKAAAAASRDMSVVAPVAPFSLCFSSKGFNGSAVPVIDFVLQSEMVKWRFYG  323

Query  490  -NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  314
             NSMVKV + V+CLGFLDGG    +S+V+GG+QLEDN+++F+LGTSMLGF++L  GT CS
Sbjct  324  SNSMVKVNEEVVCLGFLDGGSDLTSSIVLGGFQLEDNVMDFDLGTSMLGFSTLR-GTCCS  382

Query  313  HFTRFSMERDS  281
             F+  S+  +S
Sbjct  383  DFSPNSVLDES  393



>ref|XP_006419821.1| hypothetical protein CICLE_v10005127mg [Citrus clementina]
 gb|ESR33061.1| hypothetical protein CICLE_v10005127mg [Citrus clementina]
Length=394

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 133/191 (70%), Gaps = 18/191 (9%)
 Frame = -1

Query  829  PL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTI  650
            PL   P  G +Q+Y+INVKSIKIN   L +          +EG T++ST+VPY T++++I
Sbjct  213  PLMYTPLIGKSQDYFINVKSIKINGNPLSVT---------IEGLTKLSTIVPYATMESSI  263

Query  649  YHPFLDSYLESAA--SMGLSRVDPVAPFEVCFSGVG---SDVPKVEFVLQSEMVKWRM--  491
            Y  F  ++ ++AA  S  +S V PVAPF +CFS  G   S VP ++FVLQSEMVKWR+  
Sbjct  264  YATFAKAFTKAAAAASRDMSVVAPVAPFGLCFSSKGFNGSAVPVIDFVLQSEMVKWRIYG  323

Query  490  -NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  314
             NSMVKV + V+CLGFLDGG    +S+V+GG+QLEDN+++F+LGTSMLGF++L  GT CS
Sbjct  324  SNSMVKVNEEVVCLGFLDGGSDLTSSIVLGGFQLEDNVMDFDLGTSMLGFSALR-GTCCS  382

Query  313  HFTRFSMERDS  281
             F+  S+  +S
Sbjct  383  DFSPNSVLDES  393



>ref|XP_008222998.1| PREDICTED: basic 7S globulin 2 [Prunus mume]
Length=411

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 113/171 (66%), Gaps = 19/171 (11%)
 Frame = -1

Query  796  QEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLES  617
             EY+IN+K IKI+ ++L LN            G ++ST VPYTT++ ++Y  F  +Y ++
Sbjct  238  HEYFINLKYIKISGKRLSLNRV------GFREGIKLSTTVPYTTMERSVYVTFTRAYEQA  291

Query  616  AASMGLSRVDPVAPFEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  467
            A +M ++RV PVAPF +CFS       GVG  VP ++ VLQSEMVKWR+   NSMV+V  
Sbjct  292  AMAMNMTRVTPVAPFGLCFSSEQAEGRGVGPKVPAIDLVLQSEMVKWRIHGRNSMVQVST  351

Query  466  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAGTSCS  314
             VMCLGFLDGG     S+VIGGYQLED LL F+L  S+LGF+S    TSCS
Sbjct  352  QVMCLGFLDGGSDLKTSIVIGGYQLEDTLLHFDLSASVLGFSS---QTSCS  399



>ref|XP_006387875.1| hypothetical protein POPTR_0509s00200g, partial [Populus trichocarpa]
 gb|ERP46789.1| hypothetical protein POPTR_0509s00200g, partial [Populus trichocarpa]
Length=411

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 121/177 (68%), Gaps = 15/177 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + +Y+I VKSIKIN + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + +++
Sbjct  230  SSDYFIGVKSIKINGKAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFV  289

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
            +  A +   RV  VAPF  CF+        VG  VP+++ VLQS  V W +   NSMV+V
Sbjct  290  KELALV--PRVASVAPFGPCFNSTNIGSTRVGPPVPQIDLVLQSSKVSWTIFGANSMVQV  347

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
               VMCLGF+DGGL    S+VIGGYQLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  348  KSDVMCLGFVDGGLNPRTSIVIGGYQLENNLLQFDLATSRLGFSSSLLFRQTTCANF  404



>ref|XP_008390829.1| PREDICTED: basic 7S globulin-like [Malus domestica]
Length=438

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 122/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKSIKIN++ + LNTSLL +D E  GGT++STV PYT L+ +IY+  ++++++
Sbjct  259  SSDYFIKVKSIKINEKVVKLNTSLLAIDNEGYGGTKLSTVNPYTVLEKSIYNAVVNAFVK  318

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A+  + RV  VAPF  CF+        VG  VP+++ VLQSE V WR+   NSMV+V 
Sbjct  319  EVAN--IPRVKAVAPFGACFNSKNIGSTRVGPAVPQIDLVLQSESVYWRIFGANSMVQVS  376

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGG     S+VIGG+QLEDNL++ +L  S LGF+S  L   T+C++F
Sbjct  377  DDVLCLGFVDGGERPRTSIVIGGHQLEDNLVQIDLAASKLGFSSSLLFRQTTCANF  432



>ref|XP_007034627.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05553.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=456

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 119/176 (68%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + +PLNTSLL  D E  GGT+ISTV PY  ++T+IY+  + ++L+
Sbjct  274  STEYFIQVKSIKINGKTVPLNTSLLSFDNEGNGGTKISTVKPYMLMETSIYNAVVKAFLQ  333

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A++  S+V  VAP   CF+         G  VP ++ VLQS++V WR+   NSMV V 
Sbjct  334  EIANV--SQVAAVAPLGACFNSNSIEKTRAGPAVPPIDLVLQSDLVYWRVFGANSMVHVS  391

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLG +DGG     S+VIGG+QLEDNLL+F+L TS LGF+S  L   T+CS+F
Sbjct  392  ENVLCLGAVDGGSNPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLLFRQTTCSNF  447



>ref|XP_007034630.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOY05556.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=375

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 120/176 (68%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VK IKIN + + LN +LL +++E  GGT+ISTV PYT ++T+IY   ++++++
Sbjct  196  SADYFIGVKGIKINGKAVQLNNTLLSINKEGHGGTKISTVTPYTVMETSIYRAVVNAFIK  255

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            + +   + RV  VAPF  CF         VG  VP+++ VLQS+ V W +   NSMV+V 
Sbjct  256  AISQ--IPRVPAVAPFSACFKAKSFGSTRVGPAVPQIDLVLQSKDVIWTIFGANSMVQVS  313

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGGL    S+VIGGYQ+E NLL+F+L TS LGFTS  L   T+CS+F
Sbjct  314  NDVLCLGFVDGGLEPTTSIVIGGYQIEHNLLQFDLATSRLGFTSSLLFRQTTCSNF  369



>gb|EMS47745.1| Basic 7S globulin [Triticum urartu]
Length=329

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 116/176 (66%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I V +IK+N R +PLN SLLV+D++  GGT++STV PYT L+T+I+    D++  
Sbjct  153  SNEYFIGVTAIKVNGRAVPLNASLLVIDKQGGGGTKLSTVAPYTVLETSIHKAVTDAF--  210

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            +A +  + RV  VAPF++C+ G       VG  VP VE VLQSE   W +   NSMV V 
Sbjct  211  AAETAMIPRVRAVAPFKLCYDGSKVGSTRVGPAVPTVELVLQSEAASWVVFGANSMVAVK  270

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             G +CLG +DGG     SVV+GG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  271  GGALCLGVVDGGAAPRTSVVVGGHMMEDNLLEFDLQRSRLGFSSSLLFRQTTCNNF  326



>ref|XP_006495483.1| PREDICTED: basic 7S globulin-like, partial [Citrus sinensis]
Length=174

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 110/160 (69%), Gaps = 12/160 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VKS+KIN   +PLNTSLL +D+   GGT+ISTV PYT L+++IY  F+ ++ +
Sbjct  17   STDYFIGVKSVKINGHVVPLNTSLLSIDKNGVGGTKISTVHPYTVLESSIYEAFVKAFTK  76

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A+    RVD V+PF  CF       + VG  VP+++ VLQS  V WR+   NSMV+V 
Sbjct  77   ELANA--PRVDSVSPFGACFDSTRIGSTRVGPAVPQIDLVLQSSDVYWRIFGANSMVQVK  134

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSML  350
              VMCLGF+DGG+    S+VIGG+QLEDNLL+F+L TS L
Sbjct  135  SNVMCLGFVDGGVNPRTSIVIGGHQLEDNLLQFDLATSRL  174



>gb|KEH36784.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=430

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/195 (46%), Positives = 128/195 (66%), Gaps = 22/195 (11%)
 Frame = -1

Query  832  TPL*SPPQNGT--------TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVV  677
            TPL   P N            EY+I VKSI+I+++++ LNTSLL +  E EGGT++ST+ 
Sbjct  232  TPLIENPDNSAGPIFHGRPAAEYFIGVKSIRIDEKQISLNTSLLSIGDEGEGGTKVSTLN  291

Query  676  PYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVL  518
            PYT ++T+IY+ F+D++ +      + +V PV PF++CF       + VG  VP ++FVL
Sbjct  292  PYTIMETSIYNDFVDAFAKELED--VPKVKPVKPFKLCFNLQNLGVTRVGPAVPTIDFVL  349

Query  517  QSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLG  347
            Q++ V WRM   NSMV+V  GV CL F+DGG+    S+VIGG+QLEDNLL+F+L  S LG
Sbjct  350  QNKDVFWRMFGANSMVQVSYGVYCLAFVDGGVEVTTSIVIGGHQLEDNLLQFDLHNSRLG  409

Query  346  FTS--LMAGTSCSHF  308
            F+S  L   T+C++F
Sbjct  410  FSSSLLSRQTTCANF  424



>ref|XP_008458562.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=417

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 125/181 (69%), Gaps = 16/181 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLD  632
            + EY+INVK+IK++  +L LN SLL L++  +GG    TR+STVVPYT L+++I++    
Sbjct  228  SPEYFINVKAIKVDGNRLDLNKSLLDLEEAGDGGGGGGTRLSTVVPYTALESSIFNSLTV  287

Query  631  SYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++  +AA+M +  V PVAPFE CF       +  G  VP++E +LQSEMV W++   NSM
Sbjct  288  AFRAAAAAMNMKEVAPVAPFEACFESENMEMTAAGPKVPEIELILQSEMVGWKIYGRNSM  347

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            VKV D   CLGF+DGGL    ++V+GGYQ+ED +L+F++GTSMLGF+S  L    SCS F
Sbjct  348  VKVNDKAYCLGFVDGGLKPRNAIVLGGYQMEDIVLDFDIGTSMLGFSSSLLQRKRSCSEF  407

Query  307  T  305
            +
Sbjct  408  S  408



>ref|XP_007222421.1| hypothetical protein PRUPE_ppa006071mg [Prunus persica]
 gb|EMJ23620.1| hypothetical protein PRUPE_ppa006071mg [Prunus persica]
Length=429

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 118/177 (67%), Gaps = 18/177 (10%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+INVKSIKIND+ + LNTSLL +D E  GGT+ISTV PYT L+T+IY+  +D
Sbjct  256  QGEPSTEYFINVKSIKINDKAVALNTSLLKIDSEGYGGTKISTVNPYTVLETSIYNAVVD  315

Query  631  SYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRMNSMVKV  473
            +++++ A   + RV  VAPF  CF       + VG  VP ++ VLQ+       NSMV V
Sbjct  316  AFVKTVAE--IPRVKAVAPFGACFDSKNIGSTRVGPAVPAIDLVLQT-------NSMVAV  366

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             D V+CLGF+DGG     S+VIGG+QLEDNLL+F+L  S LGF+S      T+C++F
Sbjct  367  SDDVLCLGFVDGGERPRTSIVIGGHQLEDNLLQFDLAASRLGFSSSLFFRRTTCANF  423



>ref|NP_001241217.1| uncharacterized protein LOC100818868 precursor [Glycine max]
 gb|ACU22861.1| unknown [Glycine max]
 gb|KHN03448.1| Basic 7S globulin [Glycine soja]
Length=450

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 122/180 (68%), Gaps = 17/180 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I+VKSIK++ + + +NTSLL +D++  GG ++STVVPYT   T+IY P ++ +++
Sbjct  269  SSEYFIDVKSIKLDGKIVNVNTSLLSIDRQGNGGCKLSTVVPYTKFHTSIYQPLVNDFVK  328

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             AA   + RV  VAPF  CF          G +VP ++ VL+   V+WR+   NSMVKV 
Sbjct  329  QAALRKIKRVTSVAPFGACFDSRTIGKTVTGPNVPTIDLVLKGG-VQWRIYGANSMVKVS  387

Query  469  DGVMCLGFLDGGLGQGA----SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              V+CLGF+DGGL  G+    S+VIGGYQ+EDNLLEF+L +S LGF+S  L+   SCSHF
Sbjct  388  KNVLCLGFVDGGLEPGSPIATSIVIGGYQMEDNLLEFDLVSSKLGFSSSLLLHMASCSHF  447



>ref|XP_008438716.1| PREDICTED: basic 7S globulin-like isoform X1 [Cucumis melo]
 ref|XP_008438717.1| PREDICTED: basic 7S globulin-like isoform X2 [Cucumis melo]
Length=425

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 120/176 (68%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSI+ N + +PLNT+LL +D+   GGT+ISTV PYT L+ +IY+  + ++  
Sbjct  249  SSEYFIGVKSIEFNSKTVPLNTTLLKIDRNGNGGTKISTVNPYTVLEPSIYNALVKTFTT  308

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
               +  + RVD VAPFEVC+S        +G  V  ++ +LQ++ V WRM   NSMV V 
Sbjct  309  ELGN--IPRVDAVAPFEVCYSSKSFGSTELGPGVASIDLILQNKKVIWRMFGANSMVLVN  366

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            D V+CLGF+DGG+    +VVIG +Q+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  367  DEVLCLGFVDGGVEAKTAVVIGAHQIEDNLLEFDLATSRLGFSSTLLGRNTNCANF  422



>ref|XP_006380060.1| hypothetical protein POPTR_0008s20740g [Populus trichocarpa]
 gb|ERP57857.1| hypothetical protein POPTR_0008s20740g [Populus trichocarpa]
Length=439

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 121/177 (68%), Gaps = 15/177 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + +Y+I VKSIKIN + +PLNTSLL +D+ +  GGT+ISTV PYT ++TTIY   + +++
Sbjct  258  SSDYFIGVKSIKINGKAVPLNTSLLSIDRIQGTGGTKISTVNPYTVMETTIYKAVIATFV  317

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
            +  A +   RV  VAPF  CF+        VG  VP+++ VLQS  V W +   NSMV+V
Sbjct  318  KELALV--PRVASVAPFGPCFNSTNIGSTRVGPPVPQIDLVLQSSKVSWTIFGANSMVQV  375

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
               VMCLGF+DGGL    S+VIGGYQLE+NLL+F++ TS LGF+S  L   T+C++F
Sbjct  376  KSDVMCLGFVDGGLNPRTSIVIGGYQLENNLLQFDIATSRLGFSSSLLFRQTTCANF  432



>ref|XP_009364261.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin, partial [Pyrus 
x bretschneideri]
Length=416

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 118/179 (66%), Gaps = 16/179 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+INVKSIKIND  +PLNTSLLV+ +   GGT+ISTV PYT L+ TIY  F+D +L+
Sbjct  233  SSDYFINVKSIKINDETVPLNTSLLVIKEYGYGGTKISTVNPYTVLENTIYTAFVDLFLK  292

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
               +  + RV P  PF  CF+        VG  VP ++FVLQS  V WR    NSMV+V 
Sbjct  293  EVPAH-IPRVAPAEPFGACFNSTHIGRTRVGPAVPTIDFVLQSGSVYWRFLGANSMVQVN  351

Query  469  DGVMCLGFLDGGLGQG---ASVVIGGYQLEDNLLEFNLGTSMLGF-TSLMAG-TSCSHF  308
            + V+CLGF+D GL       S+VIGG QLE+N L+F+L  S LGF  SL++G T+C+ F
Sbjct  352  EEVLCLGFVDAGLSPSNPMTSIVIGGLQLEENFLQFDLAASRLGFCNSLLSGPTTCADF  410



>ref|XP_004134152.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 ref|XP_004170541.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57019.1| hypothetical protein Csa_3G149990 [Cucumis sativus]
Length=429

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 120/176 (68%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSI+ N + +PLNT+LL +D    GGT+ISTV PYT L+T+IY   + ++  
Sbjct  250  SSEYFIGVKSIEFNSKTVPLNTTLLKIDSNGNGGTKISTVNPYTVLETSIYRALVKTFTS  309

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
               +  + RV  VAPFEVC+S        +G  VP ++ +LQ++ V WRM   NSMV V 
Sbjct  310  ELGN--IPRVAAVAPFEVCYSSKSFGSTELGPSVPSIDLILQNKKVIWRMFGANSMVVVT  367

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            + V+CLGF++GG+    ++VIGG+Q+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  368  EEVLCLGFVEGGVEAETAMVIGGHQIEDNLLEFDLATSRLGFSSTLLGRNTNCANF  423



>ref|XP_007034629.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY05555.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=436

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 120/176 (68%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VK IKIN + + LN +LL +++E  GGT+ISTV PYT ++T+IY   ++++++
Sbjct  257  SADYFIGVKGIKINGKAVQLNNTLLSINKEGHGGTKISTVTPYTVMETSIYRAVVNAFIK  316

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            + +   + RV  VAPF  CF         VG  VP+++ VLQS+ V W +   NSMV+V 
Sbjct  317  AISQ--IPRVPAVAPFSACFKAKSFGSTRVGPAVPQIDLVLQSKDVIWTIFGANSMVQVS  374

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGGL    S+VIGGYQ+E NLL+F+L TS LGFTS  L   T+CS+F
Sbjct  375  NDVLCLGFVDGGLEPTTSIVIGGYQIEHNLLQFDLATSRLGFTSSLLFRQTTCSNF  430



>ref|XP_004236054.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=436

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 128/200 (64%), Gaps = 22/200 (11%)
 Frame = -1

Query  847  RDL*CTPL*S--------PPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTR  692
            +DL  TPL +        P  N  + EYYI VKSI++N + + +N  LL +D+   GGT+
Sbjct  233  KDLIITPLITNPFGTGSVPSLNEPSSEYYIGVKSIRVNAKPVTINKKLLGVDKNGNGGTK  292

Query  691  ISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPK  533
            IST  PY+ L+T+IY     ++++  ++   +RV  VAPFE+CFS        VG  VP 
Sbjct  293  ISTGTPYSMLETSIYDVVTKAFIDELSNA--TRVAAVAPFEICFSSKSVGSTRVGPAVPT  350

Query  532  VEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLG  362
            ++ VLQ+  V WR+   NSMVKV   V+CLGF++GG+ + AS+VIGGYQLEDNLL+F+L 
Sbjct  351  IDLVLQTTRVYWRIFGANSMVKVSQDVICLGFVNGGIKRTASIVIGGYQLEDNLLQFDLA  410

Query  361  TSMLGFTS--LMAGTSCSHF  308
             S LGF+S  L+  T+C++ 
Sbjct  411  RSTLGFSSSLLLHQTACANL  430



>dbj|BAA03413.1| EDGP precursor [Daucus carota]
Length=433

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 117/174 (67%), Gaps = 12/174 (7%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I VKSIKIN + + LNTSLL +     GGT+IST+ PYT L+T+IY    +++++ +
Sbjct  256  EYFIGVKSIKINSKIVALNTSLLSISSAGLGGTKISTINPYTVLETSIYKAVTEAFIKES  315

Query  613  ASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
            A+  ++RV  VAPF  CFS        +G  VP ++ VLQSE V W +   NSMV + D 
Sbjct  316  AARNITRVASVAPFGACFSTDNILSTRLGPSVPSIDLVLQSESVVWTITGSNSMVYINDN  375

Query  463  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V+CLG +DGG     S+VIGG+QLEDNL++F+L TS +GF+  + G  T+C++F
Sbjct  376  VVCLGVVDGGSNLRTSIVIGGHQLEDNLVQFDLATSRVGFSGTLLGSRTTCANF  429



>ref|XP_006418255.1| hypothetical protein EUTSA_v10007672mg [Eutrema salsugineum]
 gb|ESQ36608.1| hypothetical protein EUTSA_v10007672mg [Eutrema salsugineum]
Length=437

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 120/177 (68%), Gaps = 13/177 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLL-VLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + EY+I V  I+I D+ +P+N +LL ++     GGT+ISTV PYT ++T+I++ F  +++
Sbjct  255  SSEYFIGVSDIRIVDKSVPINKTLLKIVASTGFGGTKISTVDPYTVMETSIFNAFTSAFV  314

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
              AA+  ++RV  V PF  CFS        VG  VP+++ VLQS  V WR+   NSMV V
Sbjct  315  REAAARNITRVSSVKPFGACFSTQNVGVTRVGYAVPEIQLVLQSNNVVWRIFGANSMVSV  374

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
             D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++ LGF+S + G  T+C++F
Sbjct  375  SDDVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNRLGFSSTLLGRRTNCANF  431



>gb|AAX81588.1| nectarin IV [Nicotiana langsdorffii x Nicotiana sanderae]
Length=437

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 122/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + +P+NT+LL +D +  GGT+ISTV PYT L+T++Y+   + +++
Sbjct  258  SSEYFIGVKSIKINQKVVPINTTLLSIDNQGVGGTKISTVNPYTILETSMYNAVTNFFVK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
                + ++RV  VAPF  CF       + VG  VP+++ VLQ+E V W +   NSMV+V 
Sbjct  318  EL--VNITRVASVAPFGACFDSRTIVSTRVGPAVPQIDLVLQNENVFWTIFGANSMVQVS  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGG+    S+VIGGY +EDNLL+F+L +S LGFTS  L   T+C++F
Sbjct  376  ENVLCLGFVDGGINPRTSIVIGGYTIEDNLLQFDLASSRLGFTSSILFRQTTCANF  431



>pdb|3VLA|A Chain A, Crystal Structure Of Edgp
Length=413

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 117/174 (67%), Gaps = 12/174 (7%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I VKSIKIN + + LNTSLL +     GGT+IST+ PYT L+T+IY    +++++ +
Sbjct  236  EYFIGVKSIKINSKIVALNTSLLSISSAGLGGTKISTINPYTVLETSIYKAVTEAFIKES  295

Query  613  ASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
            A+  ++RV  VAPF  CFS        +G  VP ++ VLQSE V W +   NSMV + D 
Sbjct  296  AARNITRVASVAPFGACFSTDNILSTRLGPSVPSIDLVLQSESVVWTITGSNSMVYINDN  355

Query  463  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V+CLG +DGG     S+VIGG+QLEDNL++F+L TS +GF+  + G  T+C++F
Sbjct  356  VVCLGVVDGGSNLRTSIVIGGHQLEDNLVQFDLATSRVGFSGTLLGSRTTCANF  409



>ref|XP_007034624.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05550.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=387

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 123/201 (61%), Gaps = 14/201 (7%)
 Frame = -1

Query  865  TLPMMFRDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRIS  686
            T P++   +   P+ S  +   ++EY+INVKSIK++     L TSLL +D +  GGT+ S
Sbjct  189  TTPLVINPVSTAPIFS--EGEASEEYFINVKSIKVDGNTASLKTSLLTIDVKGFGGTKFS  246

Query  685  TVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVE  527
            T+ PYT L T+IY      +   AA++ +SRV  VAPF +CFS         G  V  ++
Sbjct  247  TIDPYTVLHTSIYKALGQEFANKAAALKISRVASVAPFGLCFSSKTTRNSETGPAVRVID  306

Query  526  FVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTS  356
             VL+S    WR+   NSMVKV   VMCLGF+DGG     S+VIGG+Q+EDNL EF+L +S
Sbjct  307  LVLESNSAPWRIYGHNSMVKVDKNVMCLGFVDGGSKPRTSIVIGGHQVEDNLGEFDLVSS  366

Query  355  MLGFTS--LMAGTSCSHFTRF  299
             LGF+S  L+  TSCSHF  F
Sbjct  367  KLGFSSSLLLKNTSCSHFRVF  387



>pdb|3VLB|A Chain A, Crystal Structure Of Xeg-edgp
 pdb|3VLB|C Chain C, Crystal Structure Of Xeg-edgp
Length=413

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 117/174 (67%), Gaps = 12/174 (7%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I VKSIKIN + + LNTSLL +     GGT+IST+ PYT L+T+IY    +++++ +
Sbjct  236  EYFIGVKSIKINSKIVALNTSLLSISSAGLGGTKISTINPYTVLETSIYKAVTEAFIKES  295

Query  613  ASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
            A+  ++RV  VAPF  CFS        +G  VP ++ VLQSE V W +   NSMV + D 
Sbjct  296  AARNITRVASVAPFGACFSTDNILSTRLGPSVPSIDLVLQSESVVWTITGSNSMVYINDN  355

Query  463  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V+CLG +DGG     S+VIGG+QLEDNL++F+L TS +GF+  + G  T+C++F
Sbjct  356  VVCLGVVDGGSNLRTSIVIGGHQLEDNLVQFDLATSRVGFSGTLLGSRTTCANF  409



>ref|XP_010522713.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=429

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 122/180 (68%), Gaps = 15/180 (8%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V  I +N++ +PLN +LL +++E  GGT+ISTV PYT L+T+IY+  + 
Sbjct  247  QGEKSAEYFIGVTGILVNNKPVPLNQTLLKINREGFGGTKISTVNPYTVLETSIYNAVVS  306

Query  631  SYLESAASMGLSRVDPVAPFEVCFS--GVGSD-----VPKVEFVLQSEMVKWRM---NSM  482
            +++   A+    RV  VAPF  CFS  GVGS      VP+++ VLQS  V WR+   NSM
Sbjct  307  AFVRETAA---KRVAAVAPFGACFSTEGVGSTRLGPAVPEIDLVLQSNDVVWRIFGANSM  363

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V V D V+CLGF+DGG+    S+VIGGYQLEDN+++F+L  S LGF+S + G  T+C++F
Sbjct  364  VSVRDDVICLGFVDGGVNPRTSIVIGGYQLEDNVVQFDLAASRLGFSSTLLGRRTNCANF  423



>gb|KCW49914.1| hypothetical protein EUGRSUZ_K03381, partial [Eucalyptus grandis]
Length=413

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 117/180 (65%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V SI++ DR L LN++LL +D    GGT+ISTV PYT L+++I+    +
Sbjct  228  QGEPSSEYFIGVTSIRVGDRNLSLNSTLLSIDGNGYGGTKISTVDPYTVLESSIFATLTE  287

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++E   +M ++R   V+PFE CFS        VG  VP +  VLQS+ V W +   NSM
Sbjct  288  AFVEEVTAMNITRASAVSPFEYCFSSANILSTRVGPAVPYIYLVLQSDQVVWTITGSNSM  347

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V+V   V+CLGF+DGG     SVVIGGYQL+DNL++ +L  S LGF+S + G  T+C++F
Sbjct  348  VQVSQDVLCLGFVDGGSSPRTSVVIGGYQLQDNLVQIDLARSRLGFSSTLLGRQTTCANF  407



>ref|XP_004151001.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN47256.1| Basic 7S globulin 2 small subunit [Cucumis sativus]
Length=414

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 124/181 (69%), Gaps = 16/181 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLD  632
            + EY+INVK+IK++  +L LN SLL L+   +G     TR+STVVPYT L+++I++    
Sbjct  225  SPEYFINVKAIKVDGNRLDLNKSLLDLEGVGDGEGGGGTRLSTVVPYTVLESSIFNSLTA  284

Query  631  SYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++  +AA+M +  V PVAPFEVCF       +  G  VP++E +LQSEMV W++   NSM
Sbjct  285  AFRAAAAAMNMKEVAPVAPFEVCFESENMEMTAAGPKVPEIELILQSEMVGWKIYGRNSM  344

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            VKV D   CLGF+DGGL    ++V+GGYQ+ED +L+F++GTSMLGF+S  L    SCS F
Sbjct  345  VKVNDEAYCLGFVDGGLKPRNAIVLGGYQMEDIVLDFDMGTSMLGFSSSLLQRKRSCSEF  404

Query  307  T  305
            +
Sbjct  405  S  405



>ref|XP_009111159.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Brassica 
rapa]
Length=434

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 118/182 (65%), Gaps = 13/182 (7%)
 Frame = -1

Query  814  PQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPF  638
            P    + EY+I V +IKI+++ +P+N +LL +D     GGT+ISTV PYT  +T+IY   
Sbjct  247  PSGEKSSEYFIGVTAIKIDEKTVPINATLLKIDGTTGVGGTKISTVKPYTVQETSIYSAS  306

Query  637  LDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---N  488
              +Y+  AA   ++RV  VAPF  CFS        +G  VP+++ VL S  V WR+   N
Sbjct  307  TAAYVREAAGRNITRVASVAPFGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGAN  366

Query  487  SMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCS  314
            SMV V D V+CLGF+DGG+    SVVIGGYQLEDNL+EF+L ++  GF+S + G  T+C+
Sbjct  367  SMVSVSDDVICLGFVDGGVNARTSVVIGGYQLEDNLIEFDLASNRFGFSSTLLGRRTNCA  426

Query  313  HF  308
            +F
Sbjct  427  NF  428



>gb|KJB25917.1| hypothetical protein B456_004G215700 [Gossypium raimondii]
Length=442

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 124/187 (66%), Gaps = 17/187 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EYYIN+ SI +N + + +N+SLL +++   GGT+IST VPYT L+++IY+    +++ 
Sbjct  257  SDEYYINMTSINVNGKPIQINSSLLAVEENGSGGTKISTAVPYTVLESSIYNALTTAFVN  316

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-  473
             ++++ L+  D V PF VC+S        VG  VP V+FV+QS+ V WR+   NSMV++ 
Sbjct  317  ESSALNLTVTDTVKPFGVCYSAADITVTRVGPGVPTVDFVMQSDNVFWRVFGSNSMVRIT  376

Query  472  ---GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
               G  V CLGF+DGG+    SVVIGG Q+ DNLL+F+L  S LGFTS  L+ GT+CS+F
Sbjct  377  RDGGGDVWCLGFVDGGVNPRTSVVIGGQQMVDNLLQFDLDNSRLGFTSSVLLKGTTCSNF  436

Query  307  TRFSMER  287
              F+  R
Sbjct  437  -NFASTR  442



>ref|XP_010038106.1| PREDICTED: basic 7S globulin 2-like [Eucalyptus grandis]
Length=438

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 117/180 (65%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V SI++ DR L LN++LL +D    GGT+ISTV PYT L+++I+    +
Sbjct  253  QGEPSSEYFIGVTSIRVGDRNLSLNSTLLSIDGNGYGGTKISTVDPYTVLESSIFATLTE  312

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++E   +M ++R   V+PFE CFS        VG  VP +  VLQS+ V W +   NSM
Sbjct  313  AFVEEVTAMNITRASAVSPFEYCFSSANILSTRVGPAVPYIYLVLQSDQVVWTITGSNSM  372

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V+V   V+CLGF+DGG     SVVIGGYQL+DNL++ +L  S LGF+S + G  T+C++F
Sbjct  373  VQVSQDVLCLGFVDGGSSPRTSVVIGGYQLQDNLVQIDLARSRLGFSSTLLGRQTTCANF  432



>ref|XP_002517164.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45327.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=433

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 123/181 (68%), Gaps = 15/181 (8%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFL  635
            Q   + +Y+I VKSI IN + +PLNT+LL ++ +   GGT ISTVVPYT ++TTIY+ F+
Sbjct  249  QGDPSSDYFIGVKSININGKPVPLNTTLLSINSQTGFGGTMISTVVPYTVMETTIYNAFV  308

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NS  485
            +++++    + + RV  VAPF  CF         +G+ VP ++ VLQS  V WR+   NS
Sbjct  309  NAFVKEL--VDVPRVASVAPFGACFDASKIVGTRLGAAVPSIDLVLQSSNVFWRIVGANS  366

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            MV+V + V+CLGF+DGG     S+VIGG+QLEDNLL+F+L TS LGF+S +    T+C++
Sbjct  367  MVQVNEDVLCLGFVDGGENPRTSIVIGGHQLEDNLLQFDLATSRLGFSSSLFSRQTTCAN  426

Query  310  F  308
            F
Sbjct  427  F  427



>ref|XP_009611839.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=438

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + +P+NT+LL +D +  GGT+ISTV PYT L+T+IY+   + +++
Sbjct  259  SSEYFIGVKSIKINQKVVPINTTLLSIDNQGVGGTKISTVNPYTILETSIYNAVTNFFVK  318

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
                + ++RV  VAPF  CF       + VG  VP ++ VLQ+E V WR+   NSMV+V 
Sbjct  319  EL--VNITRVASVAPFGACFDSRNIVSTRVGPAVPSIDLVLQNENVFWRIFGANSMVQVS  376

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGG+    S+VIGGY +E+NLL+F+L  S LGFTS  L   T+C++F
Sbjct  377  ENVLCLGFVDGGVNPRTSIVIGGYTIENNLLQFDLAGSRLGFTSSILSRLTTCANF  432



>gb|ACM68432.1| xyloglucanase-specific endoglucanase inhibitor protein [Petunia 
x hybrida]
Length=436

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 120/176 (68%), Gaps = 15/176 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN++ +P+NT+LL +D +  GGT+ISTV PYT L+T+IY+   + +++
Sbjct  258  SSEYFIGVKSIKINEKVVPINTTLLSIDSQGVGGTKISTVNPYTILETSIYNAVTNFFVK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
                + +  V  VAPF VCF       + VG  VP ++ VLQ+E V WR+   NSMV V 
Sbjct  318  ---ELAIPTVPSVAPFGVCFDSRNITSTRVGPGVPSIDLVLQNENVFWRIFGANSMVLVS  374

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGG+    S+VIGG+ +EDNLL+F+L  S LGFTS  L   T+C++F
Sbjct  375  ENVLCLGFVDGGVNPRTSIVIGGHTIEDNLLQFDLAASRLGFTSSILFRQTTCANF  430



>gb|AIL30493.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Nicotiana tabacum]
Length=437

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + +P+NT+LL +D +  GGT+ISTV PYT L+T+IY+   + +++
Sbjct  258  SSEYFIGVKSIKINQKVVPINTTLLSIDNQGVGGTKISTVNPYTILETSIYNAVTNFFVK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
                + ++RV  VAPF  CF       + VG  VP ++ VLQ+E V WR+   NSMV+V 
Sbjct  318  EL--VNITRVASVAPFGACFDSRNIVSTRVGPAVPSIDLVLQNENVFWRIFGANSMVQVS  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGG+    S+VIGGY +E+NLL+F+L  S LGFTS  L   T+C++F
Sbjct  376  ENVLCLGFVDGGVNPRTSIVIGGYTIENNLLQFDLAGSRLGFTSSILSRLTTCANF  431



>ref|XP_010556788.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=464

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 122/180 (68%), Gaps = 15/180 (8%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q+ T+ EY+I V  I IN++ +PLN +LL +D +  GGT+ISTV PYT L+T+IY+  + 
Sbjct  282  QSETSTEYFIGVSGIIINNKPVPLNQTLLKIDDKGVGGTKISTVDPYTVLETSIYNAVVS  341

Query  631  SYLESAASMGLSRVDPVAPFEVCFS--GVGSD-----VPKVEFVLQSEMVKWRM---NSM  482
            +++   A+    RV  VAPF  CFS  GVGS      VP ++ VLQ++ V W +   NS+
Sbjct  342  AFVRETAA---KRVKAVAPFGACFSSKGVGSTRLGPAVPAIDLVLQNKDVVWSIFGANSV  398

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V VG+ VMCLGF+DGG+    S+VIGGYQLEDNL++ +L  S LGF+S + G  T+C++F
Sbjct  399  VSVGNDVMCLGFVDGGVNPRTSIVIGGYQLEDNLIQLDLAASKLGFSSTLLGRRTTCANF  458



>ref|XP_010255898.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=435

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 122/180 (68%), Gaps = 16/180 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I V S+K+N + L LN +LL +DQ   GGT+ISTVVPYTT++T+IY     +++ 
Sbjct  247  SDEYFIGVTSVKVNGKALELNKTLLAIDQNGFGGTKISTVVPYTTMETSIYKALTAAFIT  306

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVK-V  473
             AAS+ L+  DP+ PF VC++        VG  VP ++ V++ + + WR+   NSMV+ V
Sbjct  307  EAASLNLTXTDPLKPFSVCYASNDVFSTRVGPAVPTIDLVMERDDIFWRIFGANSMVRMV  366

Query  472  GDG---VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLM--AGTSCSHF  308
            G+    V+CLGF+DGG     S+VIGG+Q+EDNLL+F+LG   +GF+SL+    T+C++F
Sbjct  367  GEKEEEVVCLGFVDGGANPRTSIVIGGHQMEDNLLQFDLGMKRVGFSSLLLIKQTNCANF  426



>ref|XP_006345120.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=437

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 127/200 (64%), Gaps = 22/200 (11%)
 Frame = -1

Query  847  RDL*CTPL*S--------PPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTR  692
            +DL  TPL +        P  N  + EYYI VKSI++N + + +N  LL +D+   GGT+
Sbjct  234  KDLIITPLITNPFGTGSVPSLNEPSSEYYIGVKSIRVNGKPVTINKKLLGVDKSGNGGTK  293

Query  691  ISTVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPK  533
            IST  PY+ L+++IY+    ++++  ++   +RV  VAPFE CFS        VG  VP 
Sbjct  294  ISTGSPYSMLESSIYNVVTKAFIDELSNA--TRVAAVAPFETCFSSKSVGSTRVGPAVPT  351

Query  532  VEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLG  362
            ++ VLQ+  V WR+   NSMVKV   V+CLGF++GG+ + AS+VIGGYQLEDNLL F+L 
Sbjct  352  IDLVLQTTRVYWRIFGANSMVKVSQDVICLGFVNGGIKRTASIVIGGYQLEDNLLHFDLA  411

Query  361  TSMLGFTS--LMAGTSCSHF  308
             S LGF+S  L   T+C++F
Sbjct  412  RSTLGFSSSLLFHQTTCANF  431



>ref|XP_010522709.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=418

 Score =   157 bits (396),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 121/179 (68%), Gaps = 15/179 (8%)
 Frame = -1

Query  808  NGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDS  629
            N  + EY+I V  I++N++ LPLN +LL ++ E  G T+ISTV PYT ++T+IY+  L +
Sbjct  237  NPVSTEYFIGVNGIRVNNKLLPLNQTLLKINSEGFGRTKISTVNPYTVMETSIYNAVLSA  296

Query  628  YLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMV  479
            ++   A+    RV  VAPF  CFS        +G+ VP+++ VLQS  V W++   NSMV
Sbjct  297  FVRDTAA---KRVAAVAPFGACFSTEGVASTRLGAAVPEIDLVLQSSDVVWKIFGANSMV  353

Query  478  KVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
             V D V+CLGF+DGG+   +S+VIGG+QLEDNL++F+L  S LGF+S + G  T+C++F
Sbjct  354  SVSDNVICLGFVDGGVNPMSSIVIGGHQLEDNLVQFDLAASRLGFSSTLLGSRTNCANF  412



>ref|XP_011099700.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=433

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 116/180 (64%), Gaps = 16/180 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            T EY+I+VKSI++ DR L  N +LL +D+    GGT I TV PYT L  +I +  +  ++
Sbjct  251  TVEYFIDVKSIRVGDRTLSFNKTLLSIDKSTGAGGTSIRTVRPYTGLHRSILNALIKEFV  310

Query  622  ESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
            E+AAS  ++RV  VAPFE CF       S  G DVP ++ VLQS+ + WR    NSMV+V
Sbjct  311  EAAASKNITRVASVAPFEACFDSKTVGSSKTGPDVPTIDLVLQSKNIYWRFYGSNSMVRV  370

Query  472  GDGVMCLGFLDGG---LGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             + V+CL F+DGG    G   SVV+GG+QLE++LLEF++  S L F+S  L  GTSCS F
Sbjct  371  SNDVICLAFVDGGSNLTGPTTSVVVGGHQLENHLLEFDVAASRLRFSSSLLFHGTSCSQF  430



>gb|AAP84703.1| putative xyloglucanase inhibitor [Solanum tuberosum]
Length=437

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + +P+NT+LL +D +  GGT+ISTV PYT L+T++Y+   + +++
Sbjct  258  SSEYFIGVKSIKINQKVVPINTTLLSIDNQGVGGTKISTVNPYTILETSLYNAITNFFVK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A++  +RV  VAPF+VCF       + VG  VP ++ VLQ+E V W +   NSMV+V 
Sbjct  318  ELANV--TRVAAVAPFKVCFDSRNIGSTRVGPAVPSIDLVLQNENVVWTIFGANSMVQVS  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLG LDGG+    S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C++F
Sbjct  376  ENVLCLGVLDGGVNSRTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCANF  431



>ref|XP_004495218.1| PREDICTED: basic 7S globulin 2-like [Cicer arietinum]
Length=436

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 117/178 (66%), Gaps = 10/178 (6%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VK IKI+D+ + LNTSLL ++    GGT+ISTV PYT L+ +IY    D
Sbjct  253  QGEPSAEYFIGVKKIKIDDKVVSLNTSLLSINSNGIGGTKISTVDPYTVLEASIYKAVTD  312

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-----VGSDVPKVEFVLQSEMVKWRM---NSMVK  476
             +++++ +  L+RVD   PFE C++      +G+ VP +E VLQ+E V W +   NSMV 
Sbjct  313  GFVKASVARNLTRVDSFHPFEFCYTNLGGTRLGAAVPTIELVLQNENVVWSIFGANSMVN  372

Query  475  VGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            + D V CLGF++GG     S+VIGGYQL++NLL+F+L  S LGF+S + G  T C +F
Sbjct  373  INDEVSCLGFVNGGENVRTSIVIGGYQLDNNLLQFDLAASRLGFSSTLFGRQTGCYNF  430



>ref|XP_006419823.1| hypothetical protein CICLE_v10005035mg [Citrus clementina]
 gb|ESR33063.1| hypothetical protein CICLE_v10005035mg [Citrus clementina]
Length=422

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 119/176 (68%), Gaps = 13/176 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIK+  + +PLNT+LL +D E  GGT+ ST VPYT L+T+IY   L +++ 
Sbjct  243  SNEYFIGVKSIKVGGKAIPLNTTLLSIDSEGIGGTKFSTAVPYTVLETSIYKALLQAFVN  302

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             A    ++RV PVAPF  CF       S +G  VP+++ VLQ+  V W +   NS+V+V 
Sbjct  303  -AMPTKVTRVAPVAPFGACFNSRDIGSSRLGPSVPQIDLVLQNSKVFWSIIGANSIVRVS  361

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V CLGF+DGG+    S+VIGG+QL++NL++F++ TS LGF++  L+  T CS+F
Sbjct  362  NDVSCLGFVDGGVTPKTSIVIGGHQLDNNLVQFDIATSRLGFSNSLLLQRTMCSNF  417



>ref|NP_001234746.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
 gb|AAY97864.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
Length=438

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 120/176 (68%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + +P+NT+LL +D +  GGT+ISTV PYT L+T++Y+   + +++
Sbjct  259  SSEYFIGVKSIKINQKVVPINTTLLSIDNQGVGGTKISTVNPYTILETSLYNAITNFFVK  318

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A++  +RV  VAPF VCF       + VG  VP ++ VLQ+  V W +   NSMV+V 
Sbjct  319  ELANV--TRVAVVAPFRVCFDSRDIGSTRVGPAVPSIDLVLQNANVVWTIFGANSMVQVS  376

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLG LDGG+  G S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C++F
Sbjct  377  ENVLCLGVLDGGVNAGTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCANF  432



>ref|XP_010457326.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 124/190 (65%), Gaps = 15/190 (8%)
 Frame = -1

Query  832  TPL*SPP--QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTL  662
            TPL   P  QN  + EY+I V +IKI D+ +P++  LL +D     GGT+IS+V PYT +
Sbjct  238  TPLLINPFTQNEKSPEYFIGVTAIKIVDKTVPISPKLLKIDGSTGIGGTKISSVNPYTVM  297

Query  661  KTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMV  503
            +++IY+ F   ++  AA+  ++RV  V PF  CFS        VG  VP+++ VL S+ V
Sbjct  298  ESSIYNSFTSEFVRQAAARNMTRVASVKPFGACFSTKNVGVTRVGYAVPEIQLVLHSKDV  357

Query  502  KWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLM  332
             WR+   NSMV V D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S +
Sbjct  358  VWRIFGANSMVSVRDDVICLGFVDGGVNAKTSVVIGGFQLEDNLVEFDLASNRFGFSSTL  417

Query  331  AG--TSCSHF  308
             G  T+C++F
Sbjct  418  LGRRTNCANF  427



>gb|AFK34779.1| unknown [Medicago truncatula]
Length=454

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 127/187 (68%), Gaps = 17/187 (9%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
             N  + EY+I VKSIK+++  +  NT+LL +++  EGGT++STV+P+TTL T+IY+P L+
Sbjct  269  DNFPSTEYFIKVKSIKVDNNVVNFNTTLLSINKLGEGGTKLSTVIPHTTLHTSIYNPLLN  328

Query  631  SYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++ A    + RV  VAPF  CF       S  G +VP ++ VL+   V+WR+   NSM
Sbjct  329  AFVKKAEIRKIKRVKAVAPFGACFDSRTISKSVNGPNVPTIDLVLKGG-VEWRIFGANSM  387

Query  481  VKVGDGVMCLGFLDGG---LGQGA-SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTS  320
            VKV + V+CLGF+D G   +G  A S++IGG+QLEDNL+EF+L +S LGF+S  L+   S
Sbjct  388  VKVNENVLCLGFVDAGSEEVGPSATSIIIGGHQLEDNLVEFDLVSSKLGFSSSLLLNKAS  447

Query  319  CSHFTRF  299
            CSHF  F
Sbjct  448  CSHFRGF  454



>ref|XP_010111673.1| Basic 7S globulin [Morus notabilis]
 gb|EXC31441.1| Basic 7S globulin [Morus notabilis]
Length=421

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 121/186 (65%), Gaps = 21/186 (11%)
 Frame = -1

Query  832  TPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTT  653
            TPL    +  +  +Y+IN+KSI I  ++L  +              ++ST+VPYTT++++
Sbjct  236  TPLILSGEGDSQNDYFINLKSISIGGKRLSFDVE----------KAKLSTIVPYTTMESS  285

Query  652  IYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWR  494
            IY  F+ +Y  +A SM ++RV+ VAPF +CF       +  G +VP VE  LQSE+VKWR
Sbjct  286  IYAVFVKAYERAALSMNMTRVESVAPFGLCFGVETVPKTRFGPEVPDVELGLQSELVKWR  345

Query  493  M---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA-G  326
            +   N MVKV D V+CLGFLDGGL  GAS+V+GG+QLED +L F++G+SM+GF+ L+   
Sbjct  346  IHGRNLMVKVSDEVVCLGFLDGGLELGASIVLGGFQLEDVVLHFDVGSSMMGFSPLLKWK  405

Query  325  TSCSHF  308
             SCS F
Sbjct  406  RSCSDF  411



>ref|XP_010474940.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=432

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 124/190 (65%), Gaps = 15/190 (8%)
 Frame = -1

Query  832  TPL*SPP--QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTL  662
            TPL   P  QN  + EY+I V +IKI D+ +P++  LL +D     GGT+IS+V PYT +
Sbjct  237  TPLLINPFIQNEKSPEYFIGVTAIKIVDKTVPISPKLLKIDGSTGIGGTKISSVNPYTVM  296

Query  661  KTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMV  503
            +++IY+ F   ++  AA+  ++RV  V PF  CF       + VG  VP+++ VL S+ V
Sbjct  297  ESSIYNSFTSEFVRQAAARNMTRVASVKPFGACFRTENVGVTRVGYAVPEIQLVLHSKDV  356

Query  502  KWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLM  332
             WR+   NSMV V D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L T+  GF+S +
Sbjct  357  VWRIFGANSMVSVRDDVICLGFVDGGVDAKTSVVIGGFQLEDNLVEFDLATNRFGFSSTL  416

Query  331  AG--TSCSHF  308
             G  T+C++F
Sbjct  417  LGRSTNCANF  426



>ref|XP_003637703.1| Basic 7S globulin [Medicago truncatula]
 gb|KEH32186.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=454

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 127/187 (68%), Gaps = 17/187 (9%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
             N  + EY+I VKSIK+++  +  NT+LL +++  EGGT++STV+P+TTL T+IY+P L+
Sbjct  269  DNFPSTEYFIKVKSIKVDNNVVNFNTTLLSINKLGEGGTKLSTVIPHTTLHTSIYNPLLN  328

Query  631  SYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++ A    + RV  VAPF  CF       S  G +VP ++ VL+   V+WR+   NSM
Sbjct  329  AFVKKAEIRKIKRVKAVAPFGACFDSRTISKSVNGPNVPTIDLVLKGG-VEWRIFGANSM  387

Query  481  VKVGDGVMCLGFLDGG---LGQGA-SVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTS  320
            VKV + V+CLGF+D G   +G  A S++IGG+QLEDNL+EF+L +S LGF+S  L+   S
Sbjct  388  VKVNENVLCLGFVDAGSEEVGPSATSIIIGGHQLEDNLVEFDLVSSKLGFSSSLLLNKAS  447

Query  319  CSHFTRF  299
            CSHF  F
Sbjct  448  CSHFRGF  454



>gb|KCW49915.1| hypothetical protein EUGRSUZ_K03382 [Eucalyptus grandis]
Length=422

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 118/180 (66%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V +I + D  L LN++LL +D E  GGT+ISTV PYT L+++IY    +
Sbjct  237  QGEPSSEYFIKVTAITVGDITLSLNSTLLSIDSEGYGGTKISTVNPYTVLESSIYASLTE  296

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++ A S+ ++RV  V+PFE CF+        VG+ VP +  VLQ E   W +   NSM
Sbjct  297  AFVKEATSINITRVSAVSPFEYCFNSSSIGVTRVGAAVPYIFLVLQGEEAVWTITGSNSM  356

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V+V   V+CLGF+DGG     S+VIGGYQL+DNL++F+L  S LGF+S + G  T+C++F
Sbjct  357  VEVSQDVLCLGFVDGGSRPRTSIVIGGYQLQDNLVQFDLARSRLGFSSTLLGRRTTCANF  416



>gb|KDO35982.1| hypothetical protein CISIN_1g037784mg, partial [Citrus sinensis]
Length=244

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 117/176 (66%), Gaps = 13/176 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIK+    +PLNT+LL +D E  GGT+ ST VPYT L+T+IY   L +++ 
Sbjct  65   SNEYFIGVKSIKVGGIAIPLNTTLLSIDSEGIGGTKFSTAVPYTVLETSIYKALLQAFVN  124

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             A    ++RV PV PF  CF       S +G  VP+++ VLQ+  V W +   NS+V+V 
Sbjct  125  -AMPTKVTRVAPVVPFGACFNSRDIGSSRLGPSVPQIDLVLQNSKVLWSIIGANSIVRVS  183

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V CLGF+DGG+    S+VIGG+QL++NL++F++ +S LGF++  L+  T CS+F
Sbjct  184  NDVSCLGFVDGGVTPKTSIVIGGHQLDNNLVQFDIASSRLGFSNSLLLQRTMCSNF  239



>ref|XP_010481702.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=438

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 123/182 (68%), Gaps = 13/182 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFL  635
            Q   + EY+I V +IKI D+K+P+++ LL +++    GGT+IS+V PYT ++++IY+ F 
Sbjct  252  QGEKSSEYFIGVTAIKIVDKKVPISSKLLKINRSTGFGGTKISSVNPYTVMESSIYNSFT  311

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NS  485
              ++  AA+  ++RV  V PF  CFS        VG  VP+++ VL S+ V WR+   NS
Sbjct  312  SEFVRQAAARNITRVASVKPFGACFSTKNVGVTRVGYAVPEIQLVLHSKDVVWRIFGANS  371

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            MV V D V+CLGF+DGG+    SV+IGG+QLEDNL+EF+L ++  GF+S + G  T+C++
Sbjct  372  MVSVRDDVICLGFVDGGVNAKTSVMIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCAN  431

Query  310  FT  305
            F+
Sbjct  432  FS  433



>dbj|BAJ94733.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91936.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 115/180 (64%), Gaps = 14/180 (8%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V +IK+N R +PLN SLL +D++  GGT++STV PYT L+T+I+    D
Sbjct  250  QKDKSNEYFIGVTAIKVNGRAVPLNASLLAIDKQGGGGTKLSTVAPYTVLETSIHKAVTD  309

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++  +A +  + RV  VAPF++C+ G       VG  VP VE VLQ+E   W +   NSM
Sbjct  310  AF--AAETAMIPRVRAVAPFKLCYDGSKVGSTRVGPAVPTVELVLQNEAASWVVFGANSM  367

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V    G +CLG +DGG     SVVIGG+ +EDNLLEF+L  + LGF+S  L   T+C++F
Sbjct  368  VAAKGGALCLGVVDGGAAPRTSVVIGGHTMEDNLLEFDLQRARLGFSSSLLFRQTTCNNF  427



>dbj|BAK57511.1| extracellular dermal glycoprotein [Nicotiana benthamiana]
Length=440

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 120/176 (68%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + + +NT+LL +D +  GGT+ISTV PYT L+T+IY+   + +++
Sbjct  261  SSEYFIGVKSIKINQKVVSINTTLLSIDNQGVGGTKISTVNPYTILETSIYNAVTNFFVK  320

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
                + ++RV  VAPF  CF       + VG  VP ++ VLQ+E V W +   NSMV+V 
Sbjct  321  EL--VNITRVASVAPFGACFDSRNIVSTRVGPTVPPIDLVLQNENVFWTIFGANSMVQVS  378

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGG+    S+VIGGY +EDNLL+F+L +S LGFTS  L   T+C++F
Sbjct  379  ENVLCLGFVDGGVNPRTSIVIGGYTIEDNLLQFDLASSRLGFTSSILFRQTTCANF  434



>ref|NP_563679.1| aspartyl protease-like protein [Arabidopsis thaliana]
 gb|AAG48774.1|AF332411_1 unknown protein [Arabidopsis thaliana]
 gb|AAC72120.1| Strong similarity to gb|D14550 extracellular dermal glycoprotein 
(EDGP) precursor from Daucus carota. ESTs gb|84105 and gb|AI100071 
come from this gene [Arabidopsis thaliana]
 gb|AEE27547.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=434

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 119/177 (67%), Gaps = 13/177 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + EY+I V +IKI ++ LP++ +LL ++     GGT+IS+V PYT L+++IY  F   ++
Sbjct  252  SPEYFIGVTAIKIVEKTLPIDPTLLKINASTGIGGTKISSVNPYTVLESSIYKAFTSEFI  311

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
              AA+  + RV  V PF  CFS        +G  VP+++ VL S+ V WR+   NSMV V
Sbjct  312  RQAAARSIKRVASVKPFGACFSTKNVGVTRLGYAVPEIQLVLHSKDVVWRIFGANSMVSV  371

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
             D V+CLGF+DGG+  GASVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  372  SDDVICLGFVDGGVNPGASVVIGGFQLEDNLIEFDLASNKFGFSSTLLGRQTNCANF  428



>ref|XP_007147764.1| hypothetical protein PHAVU_006G153200g [Phaseolus vulgaris]
 gb|ESW19758.1| hypothetical protein PHAVU_006G153200g [Phaseolus vulgaris]
Length=410

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 126/195 (65%), Gaps = 24/195 (12%)
 Frame = -1

Query  853  MFRDL*CTPL*S-PPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVV  677
            + R L  TPL + P QN  +    INV S+KIN +K+         D  + GG ++STVV
Sbjct  216  ILRSLTFTPLLTNPDQNHPS----INVNSVKINGKKVSF-------DAPLGGGAQLSTVV  264

Query  676  PYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFS--GVGS-----DVPKVEFVL  518
            PYTTL+T+I+  F  +YL++A+ + +SRV PV+PF +CFS  GVGS     +VP ++ VL
Sbjct  265  PYTTLQTSIFANFESAYLKAASILNMSRVSPVSPFGLCFSSNGVGSSQMGPNVPVIDLVL  324

Query  517  QSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLG  347
            QSEMVKW +   NSMV+V   VMCLGF+DGG      +VIGGYQLED L++F+  TSM+G
Sbjct  325  QSEMVKWSIHGRNSMVQVSKDVMCLGFVDGGENPRNPIVIGGYQLEDVLVQFDFDTSMVG  384

Query  346  FTS--LMAGTSCSHF  308
            F+   L    SCS F
Sbjct  385  FSPSLLTRHASCSDF  399



>ref|XP_009773897.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=433

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 120/179 (67%), Gaps = 11/179 (6%)
 Frame = -1

Query  817  PPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPF  638
            P  N ++ EY+I VKSI++N + +P+N  LL +D+   GGT+IST  PYT L+++IY   
Sbjct  251  PFLNESSSEYFIGVKSIRVNGKSVPINKKLLSIDKRGNGGTKISTGSPYTILESSIYDAV  310

Query  637  LDSYLESAASMGLSRVDPVAPFEVCFS----GVGSDVPKVEFVLQSEMVKWRM---NSMV  479
              ++++  +++  +RV  VAPFE CFS    G    VP ++ VLQS+ V WR+   NSMV
Sbjct  311  TKAFVQELSNV--TRVAAVAPFETCFSSKNIGSTRAVPAIDLVLQSKQVYWRIFGSNSMV  368

Query  478  KVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            +V   V+CLGF++GG+    S+VIGGYQLEDNLL+F+L  S LGF+S  L    +C++F
Sbjct  369  EVSPDVICLGFVNGGIKPTTSIVIGGYQLEDNLLQFDLPRSTLGFSSSLLFRQITCANF  427



>ref|XP_006419825.1| hypothetical protein CICLE_v10007108mg [Citrus clementina]
 gb|ESR33065.1| hypothetical protein CICLE_v10007108mg [Citrus clementina]
Length=409

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 118/176 (67%), Gaps = 13/176 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIK+  + +PLNT+LL +D E  GGT+ S  VPYT L+T+IY   L +++ 
Sbjct  230  SNEYFIGVKSIKVGGKAIPLNTTLLSIDSEGIGGTKFSAAVPYTALETSIYKALLQAFVN  289

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             A    ++RV PVAPF  CF       S +G  VP+++ VLQ+  V W +   NS+V+V 
Sbjct  290  -AMPTKVTRVAPVAPFGACFNSRDIGSSRLGPSVPQIDLVLQNSKVLWSIVGANSIVRVS  348

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V CLGF+DGG+    S+VIGG+QL++NL++F++ TS LGF++  L+  T CS+F
Sbjct  349  NDVSCLGFVDGGVTPKTSIVIGGHQLDNNLVQFDIATSRLGFSNSLLLQRTMCSNF  404



>ref|XP_004170412.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
Length=414

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 123/181 (68%), Gaps = 16/181 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGG----TRISTVVPYTTLKTTIYHPFLD  632
            + EY+INVK+IK++  +L LN SLL L+   +G     TR+STVVPYT L+++I++    
Sbjct  225  SPEYFINVKAIKVDGNRLDLNKSLLDLEGVGDGEGGGGTRLSTVVPYTVLESSIFNSLTA  284

Query  631  SYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++  +AA+M +  V PVAPFEVCF       +  G  VP++E +LQSEMV W++   NSM
Sbjct  285  AFRAAAAAMNMKEVAPVAPFEVCFESENMEMTAAGPKVPEIELILQSEMVGWKIYGRNSM  344

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            VKV D   CLGF+DGGL    ++V+GGYQ+ED +L+F++GTSMLGF+S  L     CS F
Sbjct  345  VKVNDEAYCLGFVDGGLKPRNAIVLGGYQMEDIVLDFDMGTSMLGFSSSLLQRKRFCSEF  404

Query  307  T  305
            +
Sbjct  405  S  405



>ref|XP_010278299.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=426

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 123/186 (66%), Gaps = 14/186 (8%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLD-QEVEGGTRISTVVPYTTLKTTIYHPFLDSYLES  617
            +Y+I V+SIKI+ +KL LN SLL +D +E  GGT++ TVVPY+T++++IY  F  ++  +
Sbjct  241  DYFIGVESIKISGKKLSLNASLLSIDDREGTGGTKLGTVVPYSTMESSIYAIFTKAFERA  300

Query  616  A-ASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            A A+  ++RV  V PF VCFS         G  VP ++ VLQSEMV WR+   NSMV+V 
Sbjct  301  AIAAFNMTRVASVGPFGVCFSSESVDITRTGPSVPTIDLVLQSEMVYWRISGANSMVQVS  360

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFS  296
            + VMCLGFLDGG     S+V+GG+QLE+NL+  ++G S LGF+S  L    +CS F    
Sbjct  361  EDVMCLGFLDGGPNARTSIVVGGFQLENNLVLLDVGASRLGFSSSLLTRQMTCSDFNLRP  420

Query  295  MERDSA  278
            + R S+
Sbjct  421  IRRVSS  426



>ref|XP_010038107.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Eucalyptus 
grandis]
Length=437

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 118/180 (66%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V +I + D  L LN++LL +D E  GGT+ISTV PYT L+++IY    +
Sbjct  252  QGEPSSEYFIKVTAITVGDITLSLNSTLLSIDSEGYGGTKISTVNPYTVLESSIYASLTE  311

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++ A S+ ++RV  V+PFE CF+        VG+ VP +  VLQ E   W +   NSM
Sbjct  312  AFVKEATSINITRVSAVSPFEYCFNSSSIGVTRVGAAVPYIFLVLQGEEAVWTITGSNSM  371

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V+V   V+CLGF+DGG     S+VIGGYQL+DNL++F+L  S LGF+S + G  T+C++F
Sbjct  372  VEVSQDVLCLGFVDGGSRPRTSIVIGGYQLQDNLVQFDLARSRLGFSSTLLGRRTTCANF  431



>ref|XP_006304586.1| hypothetical protein CARUB_v10011636mg [Capsella rubella]
 gb|EOA37484.1| hypothetical protein CARUB_v10011636mg [Capsella rubella]
Length=434

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 117/180 (65%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V +IKI +  +P+N  LL ++    GGT+ISTV PYT ++++IY  F  
Sbjct  249  QGEKSSEYFIGVTAIKIVENTVPINPRLLKINSTGFGGTKISTVNPYTVMESSIYKAFTS  308

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
             ++  AA+  ++RV  V PF  CFS        VG  VP+++ VL S+ V WR+   NSM
Sbjct  309  EFVRQAAARNITRVASVKPFGACFSTQNIGVTRVGYAVPEIQLVLHSKDVVWRIFGANSM  368

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V V D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  369  VSVRDDVICLGFVDGGVNARTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  428



>ref|XP_002889446.1| EDGP precursor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65705.1| EDGP precursor [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 120/181 (66%), Gaps = 13/181 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFL  635
            Q   + EY+I V +IKI ++ +P+N +LL ++     GGT+IS+V PYT L+++IY+ F 
Sbjct  247  QGEKSSEYFIGVTAIKIVEKTVPINPTLLKINASTGFGGTKISSVNPYTVLESSIYNAFT  306

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NS  485
              +++ AA+  ++RV  V PF  CFS        +G  VP+++ VL S  V WR+   NS
Sbjct  307  SEFVKQAAARNITRVASVKPFSACFSTKNVGVTRLGYAVPEIQLVLHSNDVVWRIFGANS  366

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            MV V D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++
Sbjct  367  MVSVSDDVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGRRTNCAN  426

Query  310  F  308
            F
Sbjct  427  F  427



>emb|CDO98879.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 121/181 (67%), Gaps = 15/181 (8%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLL-VLDQEVEGGTRISTVVPYTTLKTTIYHPFL  635
            Q   + EY+I VKSI++N + + +N++LL + D++  GGT+ISTV PYT ++ +IY  F 
Sbjct  247  QGEKSVEYFIGVKSIEVNGKPVAINSTLLKIFDKDGNGGTKISTVNPYTVMERSIYKAFT  306

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NS  485
             ++ +  A  G+ RV PVAPFEVCF+        VG   P ++ VLQS+ V WR+   NS
Sbjct  307  SAFAK--AFSGVPRVAPVAPFEVCFNSSKLGSTRVGPPAPTIDLVLQSQSVFWRIFGANS  364

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSH  311
            MV+V + V+CLGF+DGGL    S+VIG +Q+ DNLL+F+L  S LGF+S  L   T+CS+
Sbjct  365  MVQVKEDVLCLGFVDGGLNPRTSIVIGLHQIVDNLLQFDLARSRLGFSSTLLFQQTTCSN  424

Query  310  F  308
            F
Sbjct  425  F  425



>gb|KDP40110.1| hypothetical protein JCGZ_02108 [Jatropha curcas]
Length=437

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 119/177 (67%), Gaps = 14/177 (8%)
 Frame = -1

Query  802  TTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            ++ +Y+I VKSIKIN++ + LNT+LL ++ E  GGT +STV PYT ++TTIY+  L++++
Sbjct  257  SSSDYFIGVKSIKINEKTVSLNTTLLKINSEGSGGTMLSTVRPYTVMETTIYNAVLNAFV  316

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
            +  A   + RV  VAPF  CF         +G  VP ++ +LQS  V WR+   NSMV+V
Sbjct  317  KELAH--VPRVASVAPFGACFDASKIASTRLGPAVPSIDLMLQSNNVVWRIIGANSMVQV  374

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
               V+CLGF+DGG+    S++IGG+QLEDN L+F+L  S LGF+S  L   T+C++F
Sbjct  375  NRDVLCLGFVDGGVDARTSIIIGGHQLEDNFLQFDLAASRLGFSSSLLSRQTTCANF  431



>ref|XP_009757289.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=437

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 117/176 (66%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + +P+NT+LL +D +  GGT+ISTV PYT L+T+IY+   + +++
Sbjct  258  SSEYFIGVKSIKINQKVVPINTTLLSIDNQGVGGTKISTVNPYTILETSIYNAVTNFFVK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
                + ++RV  VAPF  CF       + VG  VP ++ VLQ+E V W +   NSMV+V 
Sbjct  318  EL--VNITRVASVAPFGACFDSRNIVSTRVGPAVPSIDLVLQNENVFWTIFGANSMVQVS  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGG+    S+VIGGY +EDNLL+F+L  S LGF S  L   T+C  F
Sbjct  376  ENVLCLGFVDGGVNTRTSIVIGGYTIEDNLLQFDLARSRLGFISSILFRQTTCPDF  431



>ref|XP_004486304.1| PREDICTED: basic 7S globulin 2-like [Cicer arietinum]
Length=431

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 124/195 (64%), Gaps = 22/195 (11%)
 Frame = -1

Query  832  TPL*SPPQNGTT--------QEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVV  677
            TPL   P N            EY+I VK+I+IN++ + LNTSLL +  E EGGT+IST+ 
Sbjct  233  TPLIKNPDNSAGPIFHGRLGAEYFIGVKAIRINEKLISLNTSLLSIGDEGEGGTKISTLN  292

Query  676  PYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVL  518
            PYT ++T+IY+ F+D++ +    +   +   + PF++CF       + VG  VP ++F+L
Sbjct  293  PYTIMETSIYNSFVDAFAKELEDV--PKAKAIKPFKLCFKLKDLGVTRVGLAVPTIDFML  350

Query  517  QSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLG  347
            Q++ V WRM   NSMV+V + V CL FLDGG+    S+VIGGYQLEDN L+F+L  S LG
Sbjct  351  QNKDVFWRMFGANSMVQVNNKVSCLAFLDGGVEVTTSIVIGGYQLEDNFLQFDLVNSRLG  410

Query  346  FTS--LMAGTSCSHF  308
            F+S  L   T+C++F
Sbjct  411  FSSSLLFLQTTCANF  425



>ref|XP_006345119.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=436

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 120/187 (64%), Gaps = 14/187 (7%)
 Frame = -1

Query  817  PPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPF  638
            P  N  + EYYI VKSI++N + + +N  LL +D+  +GGT+IST  PY+ L+T+IY   
Sbjct  251  PFLNEPSSEYYIGVKSIRVNGKTVTINRKLLGIDKRGDGGTKISTGTPYSILETSIYDVV  310

Query  637  LDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---N  488
              ++++  ++   +RV  VAPFE CFS        VG  VP ++ VLQ+  V WR+   N
Sbjct  311  TKAFIDELSNA--TRVAAVAPFETCFSSKSVGSTRVGPAVPTIDLVLQTTRVYWRIFGAN  368

Query  487  SMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  314
            SMVKV   V+CLGF++GG+    S+VIGGYQL DNLL+F+L  S LGF+S  L   T+C+
Sbjct  369  SMVKVSQDVICLGFVNGGIKPTTSIVIGGYQLADNLLQFDLAKSTLGFSSSLLFHQTTCA  428

Query  313  HFTRFSM  293
            +F   +M
Sbjct  429  NFNFTTM  435



>gb|ACM68431.1| xyloglucan-specific endoglucanase inhibitor protein [Capsicum 
annuum]
Length=437

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 121/176 (69%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKS+KIN + +P+NT+LL +D +  GGT+ISTV PYT L+T++Y+   + +++
Sbjct  258  SSEYFIGVKSVKINQKVVPINTTLLSIDNQGVGGTKISTVNPYTVLETSLYNAITNFFVK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A+  ++RV  VAPF  CF       + VG  VP+++ VLQ+E V W +   NSMV+V 
Sbjct  318  ELAN--VTRVASVAPFGACFDSRNIGSTRVGPAVPQIDLVLQNENVIWTIFGANSMVQVS  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGG+    S+VIGG+ +EDNLL+ ++  S LGFTS  L   T+C++F
Sbjct  376  ENVLCLGFVDGGVNSRTSIVIGGHTIEDNLLQLDIARSRLGFTSSILFRQTTCANF  431



>ref|XP_007144622.1| hypothetical protein PHAVU_007G170900g [Phaseolus vulgaris]
 gb|ESW16616.1| hypothetical protein PHAVU_007G170900g [Phaseolus vulgaris]
Length=435

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 129/181 (71%), Gaps = 14/181 (8%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I VKSI+I+++ + +NT+LL ++ +  GGT+IS+V PYT L+ +I+    +
Sbjct  250  QGEPSAEYFIGVKSIRIDEKVVLVNTTLLSINSDGVGGTKISSVNPYTVLEASIFKAVTE  309

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++++A+  ++RV  VAPFEVCFS        +G+ VP +E +LQ++ + WR+   NS+
Sbjct  310  AFVKASAARNITRVAGVAPFEVCFSSENVLATRLGASVPTIELLLQNQKI-WRIFGANSV  368

Query  481  VKVGDG-VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            V V D  ++CLGF++GG     S+VIGGYQLE+NLL+F+L TS LGF+SL+ G  T+C++
Sbjct  369  VSVNDDEILCLGFVNGGEKLRTSIVIGGYQLENNLLQFDLATSRLGFSSLLFGSRTTCAN  428

Query  310  F  308
            F
Sbjct  429  F  429



>ref|NP_171821.1| aspartyl protease-like protein [Arabidopsis thaliana]
 gb|AAK17160.1|AF325092_1 unknown protein [Arabidopsis thaliana]
 gb|AAC72119.1| Strong similarity to gb|D14550 extracellular dermal glycoprotein 
(EDGP) precursor from Daucus carota. ESTs gb|H37281, gb|T44167, 
gb|T21813, gb|N38437, gb|Z26470, gb|R65072, gb|N76373, 
gb|F15470, gb|Z35182, gb|H76373, gb|Z34678 and gb|Z35387 
come from this gene [Arabidopsis thaliana]
 gb|AAK59531.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15204.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27546.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=433

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 120/181 (66%), Gaps = 13/181 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFL  635
            Q   + EY+I V +I+I ++ +P+N +LL ++     GGT+IS+V PYT L+++IY+ F 
Sbjct  247  QGEKSSEYFIGVTAIQIVEKTVPINPTLLKINASTGIGGTKISSVNPYTVLESSIYNAFT  306

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NS  485
              +++ AA+  + RV  V PF  CFS        +G  VP++E VL S+ V WR+   NS
Sbjct  307  SEFVKQAAARSIKRVASVKPFGACFSTKNVGVTRLGYAVPEIELVLHSKDVVWRIFGANS  366

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            MV V D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++
Sbjct  367  MVSVSDDVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNKFGFSSTLLGRQTNCAN  426

Query  310  F  308
            F
Sbjct  427  F  427



>ref|XP_008222995.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=457

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 119/183 (65%), Gaps = 20/183 (11%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+INVKSI++N++ + LNTSLL++DQ   GGT+ISTV PYT L++TIY  F+D++++
Sbjct  268  SAEYFINVKSIQVNEKMVSLNTSLLMIDQNGYGGTKISTVNPYTVLESTIYKAFVDAFVK  327

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
                  + RV  V PF  CF       + VG  VP ++FVLQSE V WR+   NSMV+V 
Sbjct  328  EMPGH-IKRVASVEPFGACFDSTHIGITRVGPAVPSIDFVLQSEGVYWRVSGANSMVQVS  386

Query  469  DGVMCLGFLDGGLGQ-------GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSC  317
              V+CLGF+     Q         S+VIGG+QLEDNLL+F+L    LGF+S  L   TSC
Sbjct  387  KDVLCLGFVAAEQRQRYSFESPTTSIVIGGHQLEDNLLQFDLANKRLGFSSSLLSRETSC  446

Query  316  SHF  308
            ++F
Sbjct  447  ANF  449



>ref|XP_007224945.1| hypothetical protein PRUPE_ppa021451mg [Prunus persica]
 gb|EMJ26144.1| hypothetical protein PRUPE_ppa021451mg [Prunus persica]
Length=457

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 117/183 (64%), Gaps = 20/183 (11%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+INVKSIK+N++ + LNTSLL +DQ   GGT+ISTV PYT L++TIY  F+D++++
Sbjct  268  SAEYFINVKSIKVNEKIVSLNTSLLAIDQNGYGGTKISTVNPYTVLESTIYKAFVDAFVK  327

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
                    RV  V PF  CF       + VG  VP ++FVLQSE V WR+   NSMV+V 
Sbjct  328  EMPGHS-KRVASVEPFGACFDSTHIGITRVGPAVPSIDFVLQSEGVYWRVSGGNSMVQVS  386

Query  469  DGVMCLGFLDGGLGQ-------GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSC  317
              V+CLGF+     Q         S+VIGG+QLEDNLL+F+L    LGF+S  L   TSC
Sbjct  387  KDVLCLGFVGAEQRQRYSFESPTTSIVIGGHQLEDNLLQFDLANKRLGFSSSLLSRETSC  446

Query  316  SHF  308
            ++F
Sbjct  447  ANF  449



>ref|NP_001234249.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
 gb|AAN87262.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
Length=438

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 120/182 (66%), Gaps = 14/182 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + +P+NT+LL +D +  GGT+ISTV PYT L+T++Y+   + +++
Sbjct  259  SSEYFIGVKSIKINQKVVPINTTLLSIDNQGVGGTKISTVNPYTILETSLYNAITNFFVK  318

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A++  +RV  VAPF VCF         VG  VP ++ VLQ+  V W +   NSMV+V 
Sbjct  319  ELANV--TRVAVVAPFRVCFDSRDIGSTRVGPAVPSIDLVLQNANVVWTIFGANSMVQVS  376

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTRFS  296
            + V+CLG LDGG+    S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C +F   S
Sbjct  377  ENVLCLGVLDGGVNARTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCDNFNFTS  436

Query  295  ME  290
            ++
Sbjct  437  ID  438



>ref|XP_006296506.1| hypothetical protein CARUB_v10025694mg [Capsella rubella]
 gb|EOA29404.1| hypothetical protein CARUB_v10025694mg [Capsella rubella]
Length=437

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 118/180 (66%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V +IKI ++ +P++  LL ++    GGT+IS+V PYT ++++IY  F  
Sbjct  252  QGEKSPEYFIGVTAIKIVEKTIPISPRLLKINSTGFGGTKISSVNPYTVMESSIYKAFTS  311

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
             ++  AA+  ++RV  V PF  CFS        VG  VP+++ VL S+ V WR+   NSM
Sbjct  312  EFVRQAAARNITRVASVKPFGACFSTQNVGVTRVGYAVPEIQLVLHSKDVVWRIFGGNSM  371

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V V D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  372  VSVRDDVICLGFVDGGVNARTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  431



>ref|XP_004134154.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 ref|XP_004170543.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57020.1| Xyloglucan-specific endoglucanase inhibitor protein [Cucumis 
sativus]
Length=435

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 117/176 (66%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I V SI +N + +PLNT+LL +D    GGT+ISTV P+T L+++IY   + ++  
Sbjct  256  STEYFIGVTSIVVNSKPVPLNTTLLKIDSNGNGGTKISTVNPFTVLESSIYKALVKAFTT  315

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              +   + RV  VAPFEVC+S        +G+ VP ++ VLQ++ V W M   NSMV+V 
Sbjct  316  EVSK--VPRVGAVAPFEVCYSSKSFPSTRLGAGVPTIDLVLQNKKVIWSMFGANSMVQVN  373

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            D V+CLGF+DGG+    ++VIG +Q+ED LLEF+L TS LGFT  + G  T+C++F
Sbjct  374  DEVLCLGFVDGGVDVRTAIVIGAHQIEDKLLEFDLATSRLGFTPTLLGRMTTCANF  429



>ref|XP_010483190.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 117/180 (65%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V +IKI D+ +P++  LL ++    GGT+IS+V PYT ++++IY  F  
Sbjct  248  QGEKSSEYFIGVTAIKIVDKTVPISPRLLKINSTGFGGTKISSVDPYTVMESSIYKAFTS  307

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
             ++  AA+  ++RV  V PF  CFS        +G  VP+++ VL S  V WR+   NSM
Sbjct  308  EFVRQAAARNITRVASVKPFGACFSTKNVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSM  367

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V V D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  368  VSVRDDVICLGFVDGGVNARTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  427



>ref|XP_006419827.1| hypothetical protein CICLE_v10005000mg [Citrus clementina]
 ref|XP_006489579.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
 gb|ESR33067.1| hypothetical protein CICLE_v10005000mg [Citrus clementina]
Length=435

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 111/173 (64%), Gaps = 9/173 (5%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I +KSI I    +PLNTSLL ++++  GGT++ST  PYT L+T+IY  F++++  
Sbjct  261  STDYFIEIKSILIGGNVVPLNTSLLSINKQGNGGTKVSTADPYTVLETSIYKAFIETF-S  319

Query  619  SAASMGLSRVDPVAPFEVCFSGV---GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  458
             A    + RV P+APF  CF+     G+  P++  VL      W++   NSMV+VG   M
Sbjct  320  KALLFNIPRVKPIAPFGACFNSSFIGGTTAPEIHLVLPGNNRVWKIYGANSMVRVGKDAM  379

Query  457  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  305
            CL F+DGG+    SVVIGGYQLEDNLLEFNL  S LGF+S  L   T+CS  T
Sbjct  380  CLAFVDGGVNPRTSVVIGGYQLEDNLLEFNLAKSRLGFSSSLLSWQTTCSKLT  432



>gb|KDO74796.1| hypothetical protein CISIN_1g038219mg [Citrus sinensis]
Length=435

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 111/173 (64%), Gaps = 9/173 (5%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I +KSI I    +PLNTSLL ++++  GGT++ST  PYT L+T+IY  F++++  
Sbjct  261  STDYFIEIKSILIGGNVVPLNTSLLSINKQGNGGTKVSTADPYTVLETSIYKAFIETF-S  319

Query  619  SAASMGLSRVDPVAPFEVCFSGV---GSDVPKVEFVLQSEMVKWRM---NSMVKVGDGVM  458
             A    + RV P+APF  CF+     G+  P++  VL      W++   NSMV+VG   M
Sbjct  320  KALLFNIPRVKPIAPFGACFNSSFIGGTTAPEIHLVLPGNNRVWKIYGANSMVRVGKDAM  379

Query  457  CLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  305
            CL F+DGG+    SVVIGGYQLEDNLLEFNL  S LGF+S  L   T+CS  T
Sbjct  380  CLAFVDGGVNPRTSVVIGGYQLEDNLLEFNLAKSRLGFSSSLLSWQTTCSKLT  432



>ref|XP_010457449.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 117/180 (65%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V +IKI D+ +P++  LL ++    GGT+IS+V PYT ++++IY  F  
Sbjct  248  QGEKSSEYFIGVTAIKIVDKTVPISPRLLKINSTGFGGTKISSVDPYTVMESSIYKAFTS  307

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
             ++  AA+  ++RV  V PF  CFS        +G  VP+++ VL S  V WR+   NSM
Sbjct  308  EFVRQAAARNITRVASVKPFGACFSTENVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSM  367

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V V D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  368  VSVRDDVICLGFVDGGVNARTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  427



>ref|XP_010475063.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=434

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 117/180 (65%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V +IKI D+ +P++  LL ++    GGT+IS+V PYT ++++IY  F  
Sbjct  249  QGEKSSEYFIGVTAIKIVDKTVPISPRLLKINSTGFGGTKISSVDPYTVMESSIYKAFTS  308

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
             ++  AA+  ++RV  V PF  CFS        +G  VP+++ VL S  V WR+   NSM
Sbjct  309  EFVRQAAARNITRVASVKPFGACFSTQNVGVTRLGYAVPEIQLVLHSNDVVWRIFGANSM  368

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V V D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  369  VSVRDDVICLGFVDGGVNARTSVVIGGFQLEDNLVEFDLASNRFGFSSTLLGRRTNCANF  428



>gb|AAT85209.1| unknown protein [Oryza sativa Japonica Group]
Length=255

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 114/176 (65%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY++ +  IK+N R +PLNT+LL ++++  GGT++STV PYT L+T+I+    D++  
Sbjct  79   STEYFVGLTRIKVNGRAVPLNTTLLAINKKGVGGTKLSTVTPYTVLETSIHKAVTDAF--  136

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            +A +  + RV  VAPF++C+ G       VG  VP VE V QSE   W +   NSMV   
Sbjct  137  AAETSMIPRVPAVAPFKLCYDGSKVAGTRVGPAVPTVELVFQSEATSWVVFGANSMVATK  196

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             G +CLG +DGG+    SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  197  GGALCLGVVDGGVASETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  252



>ref|XP_009118711.1| PREDICTED: basic 7S globulin-like [Brassica rapa]
Length=432

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 117/181 (65%), Gaps = 13/181 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFL  635
            Q   + EY+I V  IKI D+ +  N +LL +D     GGT+ISTV PYT ++TTI++ F 
Sbjct  246  QGEKSTEYFIGVTDIKIADKSVTFNKTLLKIDGTTGFGGTKISTVDPYTVMETTIFNKFR  305

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRMN---S  485
             +++++AA+M ++RV  V PF  CFS        VG  VP ++ VL S  V WR+N   S
Sbjct  306  MAFVKAAAAMNITRVPSVKPFGACFSTKNVFGTRVGYSVPAIQLVLHSNDVVWRINGANS  365

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            MV V   V+CLGF+DGG+    SVVIGG QLEDNL+EF+L ++ L F+S + G  T+C++
Sbjct  366  MVSVSRDVICLGFVDGGVNARTSVVIGGLQLEDNLIEFDLASNRLSFSSTLLGLRTNCAN  425

Query  310  F  308
            F
Sbjct  426  F  426



>gb|KCW58886.1| hypothetical protein EUGRSUZ_H01512 [Eucalyptus grandis]
Length=351

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 119/179 (66%), Gaps = 17/179 (9%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL-E  620
            EYY+ V ++++N + +PLN +LL +D+E   GGT ISTV+PYT L+T+I+     ++  E
Sbjct  165  EYYVGVTAVRVNGKVVPLNATLLAIDEESGRGGTLISTVLPYTALQTSIFRAVTQAFARE  224

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-  473
            ++A+  L+ + PV PF +C+S         G  VP ++ V+QSE V WR+   NSMV++ 
Sbjct  225  ASAAFNLTTIQPVKPFSLCYSARDVGVTRAGPAVPAIDLVMQSEEVFWRVFGANSMVRIQ  284

Query  472  --GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              G    CLG +DGG    A++VIGG+Q+EDNLL+F+LG+  LGF+S  L+ GT+C+ F
Sbjct  285  RKGTDAWCLGLVDGGAEARAAIVIGGHQVEDNLLQFDLGSMRLGFSSSVLVRGTTCADF  343



>emb|CDY32500.1| BnaA09g50960D [Brassica napus]
Length=434

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 117/181 (65%), Gaps = 13/181 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFL  635
            Q   + EY+I V  IKI D+ +  N +LL +D     GGT+ISTV PYT ++TTI++ F 
Sbjct  248  QGEKSTEYFIGVTDIKIADKSVTFNKTLLKIDGTTGFGGTKISTVDPYTVMETTIFNKFR  307

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRMN---S  485
             +++++AA+M ++RV  V PF  CFS        VG  VP ++ VL S  V WR+N   S
Sbjct  308  MAFVKAAAAMNITRVPSVKPFGACFSTKNVFGTRVGYSVPAIQLVLHSNDVVWRINGANS  367

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            MV V   V+CLGF+DGG+    SVVIGG QLEDNL+EF+L ++ L F+S + G  T+C++
Sbjct  368  MVSVSRDVICLGFVDGGVNARTSVVIGGLQLEDNLIEFDLASNRLSFSSTLLGLRTNCAN  427

Query  310  F  308
            F
Sbjct  428  F  428



>ref|XP_008438715.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=436

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 118/176 (67%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSI  N + +PLNT+LL +D+   GGT+IST+ PYT L+++IY+  + +   
Sbjct  257  SSEYFIGVKSIVFNSKTVPLNTTLLKIDRNGNGGTKISTIHPYTVLESSIYNALVKTITT  316

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
               +  + RV  VAPF VC+         +G  +P ++ +LQ++ V WR+   NSMV+V 
Sbjct  317  ELRN--IPRVAAVAPFGVCYKSKSFGSTRLGPGMPSIDLILQNKKVIWRIFGANSMVQVN  374

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            D V+CLGF+DGG+    ++VIG +Q+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  375  DDVLCLGFVDGGVEARTAIVIGAHQMEDNLLEFDLATSRLGFSSTLLGRMTTCANF  430



>ref|XP_007162407.1| hypothetical protein PHAVU_001G149500g [Phaseolus vulgaris]
 gb|ESW34401.1| hypothetical protein PHAVU_001G149500g [Phaseolus vulgaris]
Length=452

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 121/180 (67%), Gaps = 15/180 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+INV SIKIN + LP+N S+L +D+   GGT+IST  PYT L+++IY  F+  ++ 
Sbjct  264  SDEYFINVTSIKINGKALPINGSILTVDETGFGGTKISTAEPYTVLESSIYKLFVQFFVN  323

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             +++  L+  + V PF VC+         VG  VP V+ V+QSE V WR+   NSMV++ 
Sbjct  324  ESSAFNLTVTEGVEPFGVCYPAGDLTETRVGPAVPTVDLVMQSEEVFWRIFGGNSMVRIE  383

Query  469  DG---VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  305
             G   V CLGF+DGG  + ++VVIGG+QLEDN++EF++ ++  GFTS  L+ GT+C++ T
Sbjct  384  KGGVDVWCLGFVDGGSRRRSAVVIGGHQLEDNVVEFDVDSNRFGFTSSLLLQGTNCANLT  443



>gb|KCW58887.1| hypothetical protein EUGRSUZ_H01513, partial [Eucalyptus grandis]
Length=414

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 119/179 (66%), Gaps = 17/179 (9%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL-E  620
            EYY+NV +IKIN + +PLN +LL +DQ+   GGT IST+VPYTT++T+IY     ++  E
Sbjct  228  EYYVNVTAIKINGKAVPLNATLLAIDQKSGHGGTLISTLVPYTTVQTSIYGAVARAFARE  287

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-  473
            ++A+  L+   PV PF +C+S         G  VP ++ V+  E   WR+   NSMV++ 
Sbjct  288  ASAAFNLTATQPVKPFGLCYSARHVNITRAGPAVPAIDLVMHGEDAVWRLFGANSMVRIQ  347

Query  472  --GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              G    CLGF+DGG G  A++++GG+Q+EDNLL+F+LG   LGF+S  L+ GT+C++F
Sbjct  348  RNGTDAWCLGFVDGGAGFRAAILMGGHQMEDNLLQFDLGKMRLGFSSSVLVRGTTCANF  406



>gb|KCW58889.1| hypothetical protein EUGRSUZ_H015141, partial [Eucalyptus grandis]
Length=212

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 116/179 (65%), Gaps = 17/179 (9%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL-E  620
            EYY+NV +IK+N + +PLN +LL +DQ+   GGT IST+VPYTTL+T+IY     ++  E
Sbjct  26   EYYVNVTAIKVNGKAVPLNATLLAIDQKSGHGGTIISTLVPYTTLQTSIYGAVARAFAQE  85

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-  473
            ++ +  L+   PV PF +C+S         G  VP ++ V+  +   WR+   NSMV++ 
Sbjct  86   ASTAFNLTATQPVKPFGLCYSARLVNITRAGPAVPAIDLVMHGQDAVWRLFGANSMVRIQ  145

Query  472  --GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              G    CLG +DGG    A+++IGG+Q+EDNLL+F+LG   LGF+S  L+ GT+C++F
Sbjct  146  RNGTDAWCLGLVDGGAEFRAAILIGGHQMEDNLLQFDLGKMRLGFSSSVLVRGTTCANF  204



>ref|XP_010026235.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=455

 Score =   152 bits (384),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 119/179 (66%), Gaps = 17/179 (9%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL-E  620
            EYY+NV +IKIN + +PLN +LL +DQ+   GGT IST+VPYTT++T+IY     ++  E
Sbjct  269  EYYVNVTAIKINGKAVPLNATLLAIDQKSGHGGTLISTLVPYTTVQTSIYGAVARAFARE  328

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-  473
            ++A+  L+   PV PF +C+S         G  VP ++ V+  E   WR+   NSMV++ 
Sbjct  329  ASAAFNLTATQPVKPFGLCYSARHVNITRAGPAVPAIDLVMHGEDAVWRLFGANSMVRIQ  388

Query  472  --GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              G    CLGF+DGG G  A++++GG+Q+EDNLL+F+LG   LGF+S  L+ GT+C++F
Sbjct  389  RNGTDAWCLGFVDGGAGFRAAILMGGHQMEDNLLQFDLGKMRLGFSSSVLVRGTTCANF  447



>ref|XP_004170542.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Cucumis 
sativus]
Length=432

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 117/176 (66%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSI  N + +P+NT+LL +D    GGT+ISTV PYT L+++IY+  + +   
Sbjct  253  SSEYFIGVKSIVFNSKTVPINTTLLKIDSNGNGGTKISTVHPYTVLESSIYNALVKTITR  312

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
               +  + RV  VAPF VC+         +G  +P ++ +LQ++ V WR+   NSMV+V 
Sbjct  313  ELRN--IPRVAAVAPFGVCYKSKSFGSTRLGPGMPSIDLILQNKKVIWRIFGANSMVQVN  370

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            + V+CLGF+DGG+    ++VIG YQ+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  371  EEVLCLGFVDGGVEARTAIVIGAYQMEDNLLEFDLATSRLGFSSTLLGRMTTCANF  426



>ref|XP_009595035.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=436

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 119/182 (65%), Gaps = 14/182 (8%)
 Frame = -1

Query  817  PPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPF  638
            P  N ++ EY+I VKSI++N + +P+N  LL +D+   GGT+IST  PY+ L+ +IY   
Sbjct  251  PFLNESSSEYFIGVKSIRLNGKPVPINKKLLSIDKRGNGGTKISTGSPYSILEASIYDAV  310

Query  637  LDSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---N  488
              + ++  +++  +RV  VAPFE CFS        VG  VP ++ VLQS+ V WR+   N
Sbjct  311  TKALVQELSNV--TRVTAVAPFETCFSSKNIVSAKVGQAVPAIDLVLQSKQVYWRIFGSN  368

Query  487  SMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  314
            SMV+V   V+CLG ++GG+    S+VIGG+QLEDNLL+F+L  S LGF+S  L   T+C+
Sbjct  369  SMVEVSQDVICLGIVNGGIKPTTSIVIGGHQLEDNLLQFDLPRSTLGFSSSLLFRQTTCA  428

Query  313  HF  308
            +F
Sbjct  429  NF  430



>ref|XP_004134153.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57018.1| hypothetical protein Csa_3G149980 [Cucumis sativus]
Length=432

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 117/176 (66%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSI  N + +P+NT+LL +D    GGT+ISTV PYT L+++IY+  + +   
Sbjct  253  SSEYFIGVKSIVFNSKTVPINTTLLKIDSNGNGGTKISTVHPYTVLESSIYNALVKTITR  312

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
               +  + RV  VAPF VC+         +G  +P ++ +LQ++ V WR+   NSMV+V 
Sbjct  313  ELRN--IPRVAAVAPFGVCYKSKSFGSTRLGPGMPSIDLILQNKKVIWRIFGANSMVQVN  370

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            + V+CLGF+DGG+    ++VIG YQ+EDNLLEF+L TS LGF+S + G  T+C++F
Sbjct  371  EEVLCLGFVDGGVEARTAIVIGAYQMEDNLLEFDLATSRLGFSSTLLGRMTTCANF  426



>ref|XP_002877156.1| hypothetical protein ARALYDRAFT_484681 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53415.1| hypothetical protein ARALYDRAFT_484681 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 116/175 (66%), Gaps = 13/175 (7%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYLES  617
            EY+I V+ IKI ++ +P+N  LL +++E   GGT+IS+V PYT L+++I+  F   ++  
Sbjct  240  EYFIGVREIKIVEKTVPINQMLLKINKETGFGGTKISSVNPYTVLESSIFKSFTSMFVRQ  299

Query  616  AASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  467
            A +  ++RV  V PF  CFS        +G  VP+++ VL S  V WR+   NSMV V D
Sbjct  300  ATARNMTRVASVKPFSACFSTQNVGVTRLGYAVPEIQLVLHSNDVVWRIFGGNSMVSVSD  359

Query  466  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
             V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++F
Sbjct  360  DVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGRQTNCANF  414



>ref|XP_006489307.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=422

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 117/176 (66%), Gaps = 13/176 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIK+  + +PLNT+LL +D +  GGT+ S  VPYT L+T+ Y   L +++ 
Sbjct  243  SNEYFIGVKSIKVGRKAIPLNTTLLSIDSDGIGGTKFSASVPYTALETSFYKALLQAFVN  302

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             A    ++RV PVAPF  CF       S +G  VP+++ VLQ+  V W +   NS+V+V 
Sbjct  303  -AMPTKVTRVAPVAPFGACFNSRDIGSSRLGPSVPQIDLVLQNSKVLWSIIGANSIVRVS  361

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V CLGF+DGG+    S+VIGG+QL++NL++F++ TS LGF++  L+  T CS+F
Sbjct  362  NDVSCLGFVDGGVTPKTSIVIGGHQLDNNLVQFDIATSRLGFSNSLLLQRTMCSNF  417



>ref|XP_010026234.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=389

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 119/179 (66%), Gaps = 17/179 (9%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL-E  620
            EYY+ V ++++N + +PLN +LL +D+E   GGT ISTV+PYT L+T+I+     ++  E
Sbjct  203  EYYVGVTAVRVNGKVVPLNATLLAIDEESGRGGTLISTVLPYTALQTSIFRAVTQAFARE  262

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-  473
            ++A+  L+ + PV PF +C+S         G  VP ++ V+QSE V WR+   NSMV++ 
Sbjct  263  ASAAFNLTTIQPVKPFSLCYSARDVGVTRAGPAVPAIDLVMQSEEVFWRVFGANSMVRIQ  322

Query  472  --GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              G    CLG +DGG    A++VIGG+Q+EDNLL+F+LG+  LGF+S  L+ GT+C+ F
Sbjct  323  RKGTDAWCLGLVDGGAEARAAIVIGGHQVEDNLLQFDLGSMRLGFSSSVLVRGTTCADF  381



>gb|AAM61574.1| EDGP precursor [Arabidopsis thaliana]
Length=433

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 119/181 (66%), Gaps = 13/181 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFL  635
            Q   + EY+I V +I+I ++ +P+N +LL ++     GGT+IS+V PYT L+++IY+ F 
Sbjct  247  QGEKSSEYFIGVTAIQIVEKTVPINPTLLKINASTGFGGTKISSVNPYTVLESSIYNAFT  306

Query  634  DSYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NS  485
              +++ A +  + RV  V PF  CFS        +G  VP++E VL S+ V WR+   NS
Sbjct  307  SEFVKQALARSIKRVASVKPFGACFSTKNVGVTRLGYAVPEIELVLHSKDVVWRIFGANS  366

Query  484  MVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSH  311
            MV V D V+CLGF+DGG+    SVVIGG+QLEDNL+EF+L ++  GF+S + G  T+C++
Sbjct  367  MVSVSDDVICLGFVDGGVNARTSVVIGGFQLEDNLIEFDLASNRFGFSSTLLGRQTNCAN  426

Query  310  F  308
            F
Sbjct  427  F  427



>ref|XP_006489308.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=429

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 116/178 (65%), Gaps = 14/178 (8%)
 Frame = -1

Query  802  TTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            ++ EY+I VKSI I+   +PLN SLL +++E  GGT+ISTV PYT L+T+IY  F+ +++
Sbjct  248  SSAEYFIGVKSILISGNVVPLNKSLLSINKEGFGGTKISTVFPYTVLETSIYKAFVKTFI  307

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
            +S ++  + RV P+APF  CF+        VG+  P++   +      W++   NSMV+V
Sbjct  308  KSYSN--IPRVKPMAPFGACFNSSFIGSTHVGAAAPEIHLYMPGTNRMWKIFGANSMVRV  365

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  305
            G   MCL F+DGG+    S+VIG YQLEDNLL+F+L  S LGF+S  L   T+CS+ T
Sbjct  366  GKHAMCLAFVDGGVNPTTSIVIGAYQLEDNLLQFDLAKSRLGFSSSLLARQTTCSNLT  423



>ref|XP_007034628.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05554.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=381

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 117/176 (66%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I VK I IN + + LN  LL +++E  GGT+ISTV PYT ++T+IY   ++++++
Sbjct  202  SSDYFIGVKGITINGKAVQLNEPLLAINKEGHGGTKISTVTPYTVMETSIYRAVVNAFIK  261

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              +   + RV  VAP   CF+        +G  VP+++ VLQS+ V WR+   NSMV+V 
Sbjct  262  EISK--IPRVPAVAPLRACFNAKSFASTRLGPAVPQIDLVLQSKDVIWRIVGANSMVEVS  319

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGGL    S+VIGG Q+E+NLL+F+L T  LGF+S  L   T+CS+F
Sbjct  320  NDVLCLGFVDGGLKPTTSIVIGGRQIENNLLQFDLATLRLGFSSSLLFQQTTCSNF  375



>ref|XP_009356759.1| PREDICTED: basic 7S globulin [Pyrus x bretschneideri]
Length=439

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 114/180 (63%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V +I +N++ + + T+LL +D E  GGT+ISTV PYT L+ +I+    +
Sbjct  254  QGDPSSEYFIQVNAINVNEKAVAIQTTLLSIDGEGVGGTKISTVNPYTVLEVSIFKAVTE  313

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
             ++  A +M +++     PFEVCFS        VG  VP ++FV Q+    WR+   NSM
Sbjct  314  MFISEAKAMNITQTGATGPFEVCFSTENVLSTRVGPSVPSIDFVFQNNSTFWRVFGANSM  373

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V+V D V+CLG ++GG     S+VIGG QLE+NLL+F+L TS LGF+S  L   T+C++F
Sbjct  374  VQVNDNVLCLGIVNGGENPRTSIVIGGLQLENNLLQFDLATSRLGFSSSLLFTQTTCANF  433



>ref|XP_009342159.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Pyrus x bretschneideri]
Length=440

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 114/174 (66%), Gaps = 14/174 (8%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+INVKSIKIN + + LNTS+L ++ E  GGT+IS V  Y  L+ +IY+  ++++++  
Sbjct  263  EYFINVKSIKINQKVVALNTSMLAINNEGYGGTKISMVNLYKVLEISIYNVVVNTFVKEV  322

Query  613  ASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
            A   + RV PV PF  CFS        VG  VP+++ VLQSE V W M   NSMV V + 
Sbjct  323  A--NIPRVKPVMPFGACFSSKNIDVTRVGPAVPQIDLVLQSENVYWTMFGANSMVYVSND  380

Query  463  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V+CLGF+DGG      +VIGG  LEDNLL+F+L TS LGF+S  L   T+C++F
Sbjct  381  VLCLGFVDGGERPMTXIVIGGNXLEDNLLQFDLATSKLGFSSSLLFRRTTCANF  434



>gb|ACJ85243.1| unknown [Medicago truncatula]
Length=232

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 118/180 (66%), Gaps = 13/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q  ++ EY+I VK+IKI+ + + LN+SLL +D +  GGT+ISTV PYT L+ +IY    D
Sbjct  48   QGESSVEYFIGVKTIKIDGKVVSLNSSLLSIDNKGVGGTKISTVDPYTVLEASIYKAVTD  107

Query  631  SYLESAASMGLSRVDPVAPFEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++++ +  ++  D   PFE C+S        +G+ VP +E +LQ+ ++ W M   NSM
Sbjct  108  AFVKASVARNITTEDSSPPFEFCYSFDNLPGTPLGASVPTIELLLQNNVI-WSMFGANSM  166

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V + D V+CLGF++GG+    S+VIGGYQLE+NLL+F+L  S LGF++ +    T C  F
Sbjct  167  VNINDEVLCLGFVNGGVNLRTSIVIGGYQLENNLLQFDLAASRLGFSNTIFAHQTDCFRF  226



>ref|XP_008438718.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=436

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 117/176 (66%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I V SI +N + +PLNT+LL +D    GGT+ISTV P+T L+++IY   + ++  
Sbjct  256  STEYFIGVTSIVVNSKPVPLNTTLLKIDSNGNGGTKISTVNPFTVLESSIYKALVKAFTT  315

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              +   + RV  VAPFEVC++        +G+ VP ++ VLQ++ V W +   NSMV+V 
Sbjct  316  EVSK--VPRVAAVAPFEVCYNSKSFPSTRLGAGVPTIDLVLQNKKVIWSIFGANSMVQVN  373

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            D V+CLGF+DGG+    ++VIG +Q+ED LLEF+L TS LGFT  + G  T+C++F
Sbjct  374  DDVLCLGFVDGGVDVRTAIVIGAHQIEDKLLEFDLATSRLGFTPTLLGRMTTCANF  429



>gb|ADG23123.1| xyloglucan specific endoglucanase inhibitor [Solanum melongena]
Length=437

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 119/176 (68%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN + +P+NT+LL +D +  GGT++STV PYT ++T++Y+   + +++
Sbjct  258  SSEYFIGVKSIKINQKVVPINTTLLSIDNQGVGGTKLSTVNPYTVMETSLYNAITNFFVK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
              A++  +RV PV PF  CF       + VG  VP ++ VLQ++ V W +   NSMV+V 
Sbjct  318  ELANV--TRVAPVTPFGACFDSRNIGSTRVGPAVPWIDLVLQNQNVVWTIFGANSMVQVS  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLG +DGG+    S+VIGG+ +EDNLL+F+   S LGFTS  L   T+C++F
Sbjct  376  ENVLCLGIVDGGVNARTSIVIGGHTIEDNLLQFDHAASRLGFTSSILFRQTTCANF  431



>ref|XP_008355568.1| PREDICTED: basic 7S globulin-like [Malus domestica]
Length=439

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 113/180 (63%), Gaps = 12/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + EY+I V +I +N++ + +NT+LL +D E  GGT+ISTV PYT L+ +I+    +
Sbjct  254  QGDPSSEYFIQVNAINVNEKPVAINTTLLSIDGEGVGGTKISTVNPYTVLEASIFKAVTE  313

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
             ++  A +  +++     PFEVCFS        VG  VP ++FV Q+    WR+   NSM
Sbjct  314  MFISEAKARNITQTGATGPFEVCFSTENVLSTRVGPSVPSIDFVFQNNSTFWRVFGANSM  373

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V+V D V+CLG ++GG     S+VIGG QLEDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  374  VQVNDNVLCLGIVNGGENPRTSIVIGGLQLEDNLLQFDLAKSRLGFSSSLLFTQTTCANF  433



>gb|ADD71505.1| xyloglucanase inhibitor 3 [Humulus lupulus]
Length=441

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 114/175 (65%), Gaps = 19/175 (11%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q  ++ EY+I VKSIK++ + + +N+SLL  D +  GGT+ISTV PYTTL+T+IY+  ++
Sbjct  245  QGESSSEYFIGVKSIKVDGKPVSVNSSLLSFDVDGNGGTKISTVDPYTTLETSIYNTVVN  304

Query  631  SYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++ + A   + +V  VAPF  CF       S  G  VP +EFVLQSE V WR+   NSM
Sbjct  305  AFVNALAVRNVHKVAAVAPFSACFNAKDIGLSRAGPIVPPIEFVLQSEKVVWRVTGANSM  364

Query  481  VKVGDGVMCLGFLDGGLGQ---------GASVVIGGYQLEDNLLEFNLGTSMLGF  344
            V+V + V+CLGF+DGG              ++VIGG Q+EDNLL+F+L TS LGF
Sbjct  365  VRVSNEVLCLGFVDGGPLHFVDWGIKFTPTAIVIGGRQIEDNLLQFDLATSRLGF  419



>gb|EAY97992.1| hypothetical protein OsI_19909 [Oryza sativa Indica Group]
Length=437

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 113/176 (64%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY++ V  IK+N R +PLNT+LL ++++  GGT++STV PYT L+T+I+    D++  
Sbjct  261  STEYFVGVTRIKVNGRAVPLNTTLLAINKKGVGGTKLSTVTPYTVLETSIHKAVTDAF--  318

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            +A +  + RV  VAPF++C+ G       VG  VP VE V QSE   W +   NSMV   
Sbjct  319  AAETSMIPRVPAVAPFKLCYDGSKVASTRVGPAVPTVELVFQSEATSWVVFGANSMVATK  378

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             G +CLG +DGG     SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  379  GGALCLGVVDGGAAPETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  434



>gb|KDO74797.1| hypothetical protein CISIN_1g044303mg [Citrus sinensis]
Length=428

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 116/178 (65%), Gaps = 14/178 (8%)
 Frame = -1

Query  802  TTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            ++ EY+I VKSI I+   +PLN SLL +++E  GGT+ISTV PYT L+T+IY  F+ +++
Sbjct  248  SSAEYFIGVKSILISGNVVPLNKSLLSINKEGFGGTKISTVFPYTVLETSIYKAFVKTFI  307

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
            +S ++  + RV P+APF  CF+        VG+  P++   +      W++   +SMV+V
Sbjct  308  KSYSN--IPRVKPMAPFGACFNSSFIGSTHVGAAAPEIHLYMPGTNRMWKIFGAHSMVRV  365

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  305
            G   MCL F+DGG+    S+VIG YQLEDNLL+F+L  S LGF+S  L   T+CS+ T
Sbjct  366  GKHAMCLAFVDGGVNPTTSIVIGAYQLEDNLLQFDLAKSRLGFSSSLLARQTTCSNLT  423



>ref|XP_004508379.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=448

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 121/187 (65%), Gaps = 18/187 (10%)
 Frame = -1

Query  808  NGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLD  632
            N  + EY+I VKSIK+++  +  N SLL + +++  GGT++STV+P+T L T IY   L+
Sbjct  263  NLPSTEYFIKVKSIKVDNNIINFNNSLLSIRKKLGIGGTKLSTVIPHTKLHTLIYKSLLN  322

Query  631  SYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++ A    + RV  VAPF  CF       S  G +VP ++FVL+   V+WR    NSM
Sbjct  323  AFVKKAEIRKIKRVKEVAPFGACFDSRTIGKSVTGPNVPTIDFVLKGG-VEWRFYGANSM  381

Query  481  VKVGDGVMCLGFLDGGLGQ----GASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTS  320
            VKVG  V+CLGF+DGG  +      S+VIGG+QLEDNLLEF+L +S LGF+S  L+   S
Sbjct  382  VKVGRNVLCLGFVDGGNEEVGPWDTSIVIGGHQLEDNLLEFDLVSSKLGFSSSLLLNKAS  441

Query  319  CSHFTRF  299
            CSHF  F
Sbjct  442  CSHFKGF  448



>ref|XP_007050654.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOX94811.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=441

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 121/179 (68%), Gaps = 15/179 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EYYIN+ +I +N + + +N S L +D+   GGT++ST   YT L+T+IY+   D+++ 
Sbjct  255  SDEYYINLTAINVNGKPIQINGSSLNVDKNGFGGTKLSTSTTYTVLETSIYNALTDAFVN  314

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-  473
             ++++ L+  + V PF VC+S        VG  VP V+ V+QS+ V WR+   NSMV++ 
Sbjct  315  ESSALNLTVTNAVKPFSVCYSAADIIVTRVGPGVPTVDLVMQSDDVFWRVFGSNSMVQIA  374

Query  472  GDG--VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            GDG  V CLGF+DGG+    SVVIGG+Q+EDNLL+F+L ++ LGFTS  L+ GT+C+ F
Sbjct  375  GDGGDVWCLGFVDGGVNPRTSVVIGGHQMEDNLLQFDLDSNRLGFTSSVLLKGTTCADF  433



>ref|XP_010045852.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=456

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 115/176 (65%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I + SIKIN R +PLN SLL +++E +GGT+IST  PYT ++ +I+   L  ++E
Sbjct  277  STDYFIRLTSIKINGRAVPLNMSLLHINEEGKGGTKISTFDPYTVMERSIFMAVLKVFME  336

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
               + G++RV  V PF+ C S        VG  VP ++  L  + V WR+   NSMV++ 
Sbjct  337  E--TKGVTRVPSVKPFQYCISSKNLGSTRVGPPVPTIDLGLHHKSVSWRIFGANSMVQLK  394

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGGL    SVVIGG+QLEDNLL+F+L    LGFTS  L   T+C++F
Sbjct  395  DDVLCLGFVDGGLNPRTSVVIGGHQLEDNLLQFDLVKRRLGFTSSLLYMQTTCTNF  450



>gb|KCW84282.1| hypothetical protein EUGRSUZ_B01133 [Eucalyptus grandis]
Length=437

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 115/176 (65%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I + SIKIN R +PLN SLL +++E +GGT+IST  PYT ++ +I+   L  ++E
Sbjct  258  STDYFIRLTSIKINGRAVPLNMSLLHINEEGKGGTKISTFDPYTVMERSIFMAVLKVFME  317

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
               + G++RV  V PF+ C S        VG  VP ++  L  + V WR+   NSMV++ 
Sbjct  318  E--TKGVTRVPSVKPFQYCISSKNLGSTRVGPPVPTIDLGLHHKSVSWRIFGANSMVQLK  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            D V+CLGF+DGGL    SVVIGG+QLEDNLL+F+L    LGFTS  L   T+C++F
Sbjct  376  DDVLCLGFVDGGLNPRTSVVIGGHQLEDNLLQFDLVKRRLGFTSSLLYMQTTCTNF  431



>ref|XP_010678844.1| PREDICTED: basic 7S globulin 2-like [Beta vulgaris subsp. vulgaris]
Length=432

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 114/183 (62%), Gaps = 21/183 (11%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I V SI+++   +  ++SLL  D+   GGT+IST+ PYT L ++IY   +D ++  A
Sbjct  247  EYFIKVTSIEVDKTPIRFSSSLLSFDKNGIGGTKISTLDPYTVLHSSIYKALIDVFVSKA  306

Query  613  ASMGLSRVDPVAPFEVCFSG--------VGSDVPKVEFVL--------QSEMVKWRM---  491
             +M ++RV PVAPF  CF+          G +VP ++ +L             +WR+   
Sbjct  307  TAMKMTRVAPVAPFGACFNAKSVVNSAKTGFNVPVIDMILDGKSSLLHNKNNARWRIYGA  366

Query  490  NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSC  317
            NSMVKV D V+CLGF+DGGL    S+VIGG Q+EDNL+EF+L ++ LG TS  L  GTSC
Sbjct  367  NSMVKVSDDVLCLGFVDGGLESRTSIVIGGKQMEDNLVEFDLESNKLGITSSLLRMGTSC  426

Query  316  SHF  308
            S+F
Sbjct  427  SNF  429



>ref|NP_001055496.1| Os05g0402900 [Oryza sativa Japonica Group]
 dbj|BAF17410.1| Os05g0402900 [Oryza sativa Japonica Group]
Length=437

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 114/176 (65%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY++ +  IK+N R +PLNT+LL ++++  GGT++STV PYT L+T+I+    D++  
Sbjct  261  STEYFVGLTRIKVNGRAVPLNTTLLAINKKGVGGTKLSTVTPYTVLETSIHKAVTDAF--  318

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            +A +  + RV  VAPF++C+ G       VG  VP VE V QSE   W +   NSMV   
Sbjct  319  AAETSMIPRVPAVAPFKLCYDGSKVAGTRVGPAVPTVELVFQSEATSWVVFGANSMVATK  378

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             G +CLG +DGG+    SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  379  GGALCLGVVDGGVASETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  434



>gb|KJB26454.1| hypothetical protein B456_004G242400 [Gossypium raimondii]
Length=425

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 122/193 (63%), Gaps = 19/193 (10%)
 Frame = -1

Query  847  RDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYT  668
            R L  TPL   PQ     EYY+ VKSIKIND+ +P++T+LL ++++  GGT++ST+ PYT
Sbjct  233  RPLSYTPLIISPQG----EYYMEVKSIKINDKDVPIDTALLSINKQSVGGTKLSTINPYT  288

Query  667  TLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSE  509
             L  +I+      + +  ++  + +V PVAPF  CF       S VG  VP ++ VL  +
Sbjct  289  ILHHSIFKAVTQFFSKELSA--IPQVKPVAPFSACFNSKSFKNSRVGPGVPNIDLVLHDK  346

Query  508  MVKWRM---NSMVKVGDGVMCLGFLDGGL-GQGASVVIGGYQLEDNLLEFNLGTSMLGFT  341
             V WR+   NS+V+   GV CL F+DGG+   GAS++IG YQ+E+NL++F++  S LGF+
Sbjct  347  HVMWRIYGANSLVEAAPGVSCLAFVDGGMKNNGASIIIGAYQMENNLVQFDMARSRLGFS  406

Query  340  S--LMAGTSCSHF  308
            S  L   TSC++F
Sbjct  407  SSLLFYKTSCNNF  419



>gb|EEE63670.1| hypothetical protein OsJ_18488 [Oryza sativa Japonica Group]
Length=419

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 114/176 (65%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY++ +  IK+N R +PLNT+LL ++++  GGT++STV PYT L+T+I+    D++  
Sbjct  243  STEYFVGLTRIKVNGRAVPLNTTLLAINKKGVGGTKLSTVTPYTVLETSIHKAVTDAF--  300

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            +A +  + RV  VAPF++C+ G       VG  VP VE V QSE   W +   NSMV   
Sbjct  301  AAETSMIPRVPAVAPFKLCYDGSKVAGTRVGPAVPTVELVFQSEATSWVVFGANSMVATK  360

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             G +CLG +DGG+    SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  361  GGALCLGVVDGGVASETSVVIGGHMMEDNLLEFDLVGSRLGFSSSLLFRQTTCNNF  416



>ref|XP_009597883.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=432

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 116/178 (65%), Gaps = 16/178 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I VKSIKIN   +P+NT+LL + +   GGT+ISTV PYT L+T+IY+ F  ++++
Sbjct  251  SMEYFIGVKSIKINGNVVPINTTLLTIAKNGIGGTKISTVDPYTKLETSIYNAFTKAFVK  310

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSE-----MVKWRMNSMVK  476
            S A   ++RV  VAPF VC++        VG  VP +E VL S         W +NSMV 
Sbjct  311  SLAK--VARVKSVAPFRVCYNSTSLGSTRVGPGVPPIELVLGSNKDAKSWTIWGVNSMVV  368

Query  475  VGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V + V+CLGF+DGG     S+VIG +Q+EDNLL+F++    +GF+S  L + T+C++F
Sbjct  369  VNNEVLCLGFVDGGFEPTTSIVIGAHQIEDNLLQFDIANKRMGFSSSLLFSRTTCANF  426



>gb|KCW45638.1| hypothetical protein EUGRSUZ_L005902, partial [Eucalyptus grandis]
Length=224

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 115/176 (65%), Gaps = 15/176 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+IN+ SIKIN + +PLN +LL +  +  GGT+ISTV PYT ++T+I+  F+  +  
Sbjct  46   STDYFINLTSIKINGKAVPLNAALLKI-TDGNGGTKISTVNPYTVMETSIFKAFVKVFRH  104

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             A +  L++V  V PF+ CFS        VG  VP ++ V+ +  V WR+   NSMV+V 
Sbjct  105  EAKN--LTKVSSVKPFKYCFSSKNTPSTRVGPAVPLIDLVMHNSSVYWRIFGANSMVQVK  162

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGG     S+VIGGYQLEDNL++ ++  + LGF+S  L   T+CS+F
Sbjct  163  EDVICLGFVDGGSNPRTSIVIGGYQLEDNLVQIDMEKARLGFSSSLLFKQTTCSNF  218



>ref|XP_008649625.1| PREDICTED: basic 7S globulin-like [Zea mays]
 gb|AFW77950.1| hypothetical protein ZEAMMB73_390094 [Zea mays]
Length=438

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 114/180 (63%), Gaps = 14/180 (8%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            ++  + EY++ V  IK+N R +PLN +LL +D++  GGT++STV PYT L+++IY    D
Sbjct  258  RHDKSDEYFVGVTGIKVNGRAVPLNATLLAIDRKGVGGTKLSTVAPYTVLQSSIYKAVTD  317

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++  +A +  + R  P+APF++C+ G       VG  VP +E VL +E   W +   NSM
Sbjct  318  AF--AAETAMIPRAPPLAPFKLCYDGSKVGSTRVGPAVPTIELVLGNEATSWVVFGANSM  375

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V    G +CLG +DGG     SVVIGG+ +EDNLL+F+L  S LGF+S  L   T+C++F
Sbjct  376  VATEGGALCLGVVDGGKAPRTSVVIGGHMMEDNLLQFDLEASRLGFSSSLLFRQTNCNNF  435



>gb|KDP25943.1| hypothetical protein JCGZ_22848 [Jatropha curcas]
Length=434

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 114/174 (66%), Gaps = 14/174 (8%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I VKSI+IN++++ +N  LL + +E +GGT+ISTV PYT L+T+IY     +++++ 
Sbjct  258  EYFIRVKSIEINEKQVKINKKLLSITEEGKGGTKISTVNPYTVLETSIYKAVTKAFVKAL  317

Query  613  ASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
            + +   RV  VAPF VCFS        VG  VP ++ VLQ+    WR+   NSMV + D 
Sbjct  318  SKV--PRVKAVAPFGVCFSAKHIGVTRVGPAVPTIDLVLQNNGTVWRIWGTNSMVNINDN  375

Query  463  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHF  308
             +CL F+DGG     S+VIGG+QLE+NLL+F+ G+  LGF+  +    T+C++F
Sbjct  376  ALCLAFVDGGADAETSIVIGGHQLEENLLQFDFGSKTLGFSGPLPFWRTTCANF  429



>ref|XP_006366973.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=361

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 117/182 (64%), Gaps = 15/182 (8%)
 Frame = -1

Query  808  NGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDS  629
            N    +YY+N+ SIK+N   + LN ++  ++ +  GGT++ST+ PYTTL++ IY+ F ++
Sbjct  171  NPVHSDYYVNLTSIKVNGVTVQLNQNISAVNHQGFGGTKLSTITPYTTLQSNIYNAFTET  230

Query  628  YLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMV  479
            ++  +A + L+  +PV PF+VC++        VG  VP V+ V+ +  V WR+   NSMV
Sbjct  231  FVNESAKLNLTVTNPVEPFKVCYNADEVLDTKVGPTVPTVDLVMDNHDVFWRIFGSNSMV  290

Query  478  KVGDG---VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  314
            ++      V CLGFLDGG+    S++IGG+Q+E+NLL+F+L    LGF+S  L   TSCS
Sbjct  291  RIARNDVDVWCLGFLDGGIKTETSIIIGGHQMENNLLQFDLEQEKLGFSSSVLAYSTSCS  350

Query  313  HF  308
            +F
Sbjct  351  NF  352



>ref|XP_006419822.1| hypothetical protein CICLE_v10007187mg [Citrus clementina]
 gb|ESR33062.1| hypothetical protein CICLE_v10007187mg [Citrus clementina]
Length=422

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 117/175 (67%), Gaps = 16/175 (9%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I VKSI+++D+ +PLNT+LL +D E  GGT+ISTV PYT L+T+IY+  + +++   
Sbjct  246  EYFIGVKSIRVSDKAIPLNTTLLSIDSEGFGGTKISTVNPYTVLETSIYNALVQAFVN--  303

Query  613  ASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
            A   ++RV PVAP   CF       S  G  VP ++ VLQ+  V W +   NS+V+V + 
Sbjct  304  AMPNVTRVAPVAPLGACFKSSDIVSSRFGPSVPPIDLVLQNN-VSWSIIGANSIVRVNNN  362

Query  463  -VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             V CLGF+DGG+    S+VIGG+QLE+NLL+F+L +S LGF++  L   T C +F
Sbjct  363  DVSCLGFVDGGVRPMTSIVIGGHQLENNLLQFDLASSRLGFSNSLLFQRTVCDNF  417



>ref|XP_009773278.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=459

 Score =   147 bits (372),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 117/182 (64%), Gaps = 15/182 (8%)
 Frame = -1

Query  808  NGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDS  629
            N    +Y+IN+ SIK+N   + L+  +L +D+   GGT++STV PYT L ++IY  F ++
Sbjct  269  NAFQSDYFINLTSIKVNSVTVQLSRKILAVDEHGFGGTKLSTVTPYTLLHSSIYKAFTET  328

Query  628  YLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMV  479
            +++ +  + L+  +PV PF+VC++        VG  VP V+ V+Q + V WR+   NSMV
Sbjct  329  FVDQSTKLNLTVTNPVEPFKVCYNADEVMETRVGPAVPTVDLVMQGDDVFWRIFGSNSMV  388

Query  478  KV---GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  314
            ++   G  V CLGFLDGG+    S++IGG+Q+EDNLL+F+L    LGF+S  L   T+CS
Sbjct  389  RIFRDGVDVWCLGFLDGGVKTKTSIIIGGHQMEDNLLQFDLRQQRLGFSSSVLAYNTTCS  448

Query  313  HF  308
            +F
Sbjct  449  NF  450



>ref|XP_011079830.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=399

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 119/177 (67%), Gaps = 15/177 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I + +IK+N + +  N +LL +D++  GGT++STV PYT+L +TIY    ++++ 
Sbjct  212  SNEYFIGLTAIKVNGKAVKFNQTLLSIDEKGFGGTKLSTVTPYTSLHSTIYRALTEAFVN  271

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-  473
             +A++ L+   PV PF VC++        +G  VP V+FVLQ + V WR+   NSM ++ 
Sbjct  272  ESAALNLTITQPVKPFNVCYNADEVMSTRIGPAVPTVDFVLQDDDVIWRIFGWNSMFRIF  331

Query  472  GDGV--MCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  314
             DGV   CLGFLDGG    +S+VIGG+Q++DNLL+F+L ++ LGF+S  L+ GT C+
Sbjct  332  RDGVDLYCLGFLDGGPNPRSSIVIGGHQMDDNLLQFDLQSNRLGFSSSLLVHGTMCA  388



>gb|KJB45207.1| hypothetical protein B456_007G295400 [Gossypium raimondii]
Length=425

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 124/199 (62%), Gaps = 24/199 (12%)
 Frame = -1

Query  868  VTLPMMFRDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRI  689
            ++LP+ +  L  +PL          EYYI VKSIKIN++ +PLNT+LL +D+   GGT++
Sbjct  231  ISLPVGYTPLIISPL---------GEYYIEVKSIKINNKDVPLNTTLLSIDRRGIGGTKL  281

Query  688  STVVPYTTLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCFSG--------VGSDVPK  533
            ST+ PYT L+ +I+   ++ + +  +  G+  V  V PFEVCF+         VG  VP 
Sbjct  282  STINPYTILEHSIFKSVIEFFTKELS--GIPLVKLVEPFEVCFNSKSIDKRTRVGPKVPN  339

Query  532  VEFVLQSEMVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLG  362
            ++ VL  + V WR+   NS+V+   GV CL F+DGGL   A++VIG YQ+E+NL++F++ 
Sbjct  340  IDLVLHDQHVIWRIYGSNSLVEATPGVSCLAFVDGGLNTRAAIVIGAYQMENNLIQFDMA  399

Query  361  TSMLGFTS--LMAGTSCSH  311
             S LGF+S  L   TSC++
Sbjct  400  RSRLGFSSSLLFFRTSCNN  418



>gb|KDO74800.1| hypothetical protein CISIN_1g036447mg, partial [Citrus sinensis]
Length=338

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 117/176 (66%), Gaps = 16/176 (9%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I VKSI+++D+ +PLNT+LL +D E  GGT+ISTV PYT L+T+IY+  + +++   
Sbjct  162  EYFIGVKSIRVSDKAIPLNTTLLSIDSEGFGGTKISTVNPYTVLETSIYNALVQAFVN--  219

Query  613  ASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
            A   ++RV PVAP   CF       S  G  VP ++ VLQ+  V W +   NS+V+V + 
Sbjct  220  AMPNVTRVAPVAPLGACFKSSDIVSSRFGPSVPPIDLVLQNN-VSWSIIGANSIVRVNNN  278

Query  463  -VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  305
             V CLGF+DGG+    S+VIGG+QLE+NLL+F+L +S LGF++  L   T C +F 
Sbjct  279  DVSCLGFVDGGVRPMTSIVIGGHQLENNLLQFDLPSSRLGFSNSLLFQRTVCDNFN  334



>ref|XP_007030900.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY11402.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=424

 Score =   147 bits (370),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 119/192 (62%), Gaps = 18/192 (9%)
 Frame = -1

Query  847  RDL*CTPL*SPPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYT  668
            R L  TPL   PQ     EYYI V+SIKIN++ +P+N ++L +++   GGT++ST+ PYT
Sbjct  233  RPLRYTPLIISPQG----EYYIEVRSIKINNKDVPINKTVLSINKRGFGGTKLSTINPYT  288

Query  667  TLKTTIYHPFLDSYLESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSE  509
             L+ +I+      +    +  G+ +V PV PF VCF       +  G  VP ++ VL ++
Sbjct  289  VLEHSIFKAVTHFFTNELS--GIPQVKPVKPFGVCFGSKSFKSTRFGPGVPNIDLVLHNQ  346

Query  508  MVKWRM---NSMVKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS  338
             V WR+   NSMV+   GV CL F+DGG+   AS+VIG YQ+E+NL++F+L  S LGF+S
Sbjct  347  HVTWRIFGANSMVQAAPGVSCLAFVDGGVNTRASIVIGAYQMENNLVQFDLARSRLGFSS  406

Query  337  --LMAGTSCSHF  308
              L   TSC++F
Sbjct  407  SLLHFKTSCNNF  418



>gb|AAT85211.1| hypothetical protein [Oryza sativa Japonica Group]
Length=435

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 110/176 (63%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I V  IK+N R +PLN +LL + +   GGT++S + PYT L+T+IY    D++  
Sbjct  259  STEYFIGVTGIKVNGRAVPLNATLLAIAKSGVGGTKLSMLSPYTVLETSIYKAVTDAF--  316

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            +A +  + RV  VAPF++C+ G        G  VP VE VLQS+ V W +   NSMV   
Sbjct  317  AAETAMIPRVPAVAPFKLCYDGTMVGSTRAGPAVPTVELVLQSKAVSWVVFGANSMVATK  376

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHF  308
            DG +C G +DGG+    SVVIGG+ +EDNLLEF+L  S LGFTS +    T+C+ F
Sbjct  377  DGALCFGVVDGGVAPETSVVIGGHMMEDNLLEFDLEGSRLGFTSYLPLLQTTCNSF  432



>ref|XP_003520561.1| PREDICTED: basic 7S globulin-like [Glycine max]
Length=427

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 113/179 (63%), Gaps = 15/179 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+IN+ SIKIN + L +N+S+L +DQ   GGT+IST  PYT L+T+IY  F+  ++ 
Sbjct  239  SDEYFINLTSIKINGKPLYINSSILTVDQTGFGGTKISTAEPYTVLETSIYRLFVQRFVN  298

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             +++  L+  + V PF VC+         VG  VP V+ V+ SE V WR+   NSMV+V 
Sbjct  299  ESSAFNLTVTEAVEPFGVCYPAGDLTETRVGPAVPTVDLVMHSEDVFWRIFGGNSMVRVA  358

Query  469  DG---VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             G   V CLGF+DGG      +VIGG+QLEDNL++F+L ++  GFTS  L+    CS+ 
Sbjct  359  KGGVDVWCLGFVDGGTRGRTPIVIGGHQLEDNLMQFDLDSNRFGFTSTLLLQDAKCSNL  417



>gb|KDP21481.1| hypothetical protein JCGZ_21952 [Jatropha curcas]
Length=453

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 118/175 (67%), Gaps = 15/175 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EYYIN+ S+K+N + + LN+S L  D+   GGT++ST   YTTL+++IY  F+++++ 
Sbjct  253  SDEYYINLTSVKVNGKPIQLNSSQLSFDENGFGGTKLSTDTSYTTLESSIYRAFVEAFVN  312

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-  473
             +A + L+    V PF+VC+         VG  VP V+FV++SE V WR+   NSMV + 
Sbjct  313  ESAGLNLTVTSVVKPFDVCYQATDVISTRVGPGVPTVDFVMESEDVFWRIFGWNSMVMIE  372

Query  472  GDGV--MCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTS  320
             DGV   CLGF+DGG+   AS+VIGG+Q+EDNLLEF++ +  LGF+S  L+ GTS
Sbjct  373  RDGVDLWCLGFVDGGVNARASIVIGGHQMEDNLLEFDMESKRLGFSSSLLLKGTS  427



>ref|XP_006472113.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=273

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 111/175 (63%), Gaps = 14/175 (8%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYLES  617
            +YYI + SI+IN++++P+N SLL  +     GGT+IST+ PYT L+ +IY  F   +L S
Sbjct  94   QYYITLTSIRINNKQVPINASLLKFNVNAGTGGTKISTIKPYTVLEHSIYQSF-TRFLTS  152

Query  616  AASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  467
                      PVAPF VC+       +  G  VP ++FVLQ++ VKW +   NSMV+   
Sbjct  153  QLPGIPQLAKPVAPFSVCYDSRKLKSTRAGPGVPNIDFVLQNQNVKWTITGANSMVEARR  212

Query  466  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            GV CL F+DGG+   AS++IG +QL+DNL++F+L  S LGF+S  L   TSCS+F
Sbjct  213  GVTCLAFVDGGVRPRASIIIGSHQLQDNLVQFDLAGSRLGFSSSLLFRRTSCSNF  267



>ref|XP_002272199.2| PREDICTED: basic 7S globulin 2-like [Vitis vinifera]
Length=457

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 114/179 (64%), Gaps = 15/179 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+I V ++K+N   + LN +LL +D    GGT+ISTV PYT L+++IY     +++ 
Sbjct  270  SDEYFIGVTALKVNGHAVDLNPALLTVDLNGNGGTKISTVAPYTVLESSIYEALTHAFIA  329

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-  473
             +A + L+   PV PF VCF         VG  VP V+ V+QS+ V WR+   NSMV++ 
Sbjct  330  ESAGLNLTVHYPVKPFRVCFPADDVMETTVGPAVPTVDLVMQSDDVFWRIFGRNSMVRIL  389

Query  472  --GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              G  V CLGF+DGG+    S+VIGG+Q+EDNLL+F+LG   LGF+S  L+  T C++F
Sbjct  390  EEGVDVWCLGFVDGGVRPRTSIVIGGHQMEDNLLQFDLGLKRLGFSSSVLVHHTMCANF  448



>gb|KDO74789.1| hypothetical protein CISIN_1g014679mg [Citrus sinensis]
Length=420

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 117/179 (65%), Gaps = 15/179 (8%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I V S+ +N + +PLN +LL +D E  GGT+ISTV PYT L+T+IY   + ++  ++
Sbjct  244  EYFIGVTSVHVNGKAVPLNKTLLSIDNEGVGGTKISTVNPYTVLETSIYKALVQAF--AS  301

Query  613  ASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
            A   ++RV PVAPF  CF       + +G  VP+++ VLQ++ V W +   NSMV++G  
Sbjct  302  AMPKVARVAPVAPFGACFRLQDIGFTRIGPVVPQIDLVLQNKNVVWSIHGQNSMVQIGGD  361

Query  463  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS-HFTRFS  296
             +CLGF+DGG+    S+VIG  QLE+NLL+F+L TS LGF+   L    +C+ +FT  +
Sbjct  362  ALCLGFVDGGVNPRTSIVIGARQLENNLLQFDLATSRLGFSDSLLFERATCTFNFTSIA  420



>ref|XP_006489578.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=422

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 117/175 (67%), Gaps = 16/175 (9%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I VKSI+++D+ +PLNT+LL +D E  GGT+ISTV PYT L+T+IY+  + +++   
Sbjct  246  EYFIGVKSIRVSDKAIPLNTTLLSIDSEGFGGTKISTVNPYTVLETSIYNALVQAFVN--  303

Query  613  ASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
            A   ++RV PVAP   CF       S  G  VP ++ VLQ+  V W +   NS+V+V + 
Sbjct  304  AMPNVTRVAPVAPLGACFKSSDIVSSRFGPSVPPIDLVLQNN-VSWSIIGANSIVRVNNN  362

Query  463  -VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             V CLGF+DGG+    S+VIGG+QLE+NLL+F+L +S LGF++  L   T C +F
Sbjct  363  DVSCLGFVDGGVRPMTSIVIGGHQLENNLLQFDLPSSRLGFSNSLLFQRTVCDNF  417



>ref|XP_004229432.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=441

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 119/180 (66%), Gaps = 18/180 (10%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I V SIK+N   +P+NT+LL + ++ +GGT+ISTV PYT L+T+IY+    ++++
Sbjct  258  STDYFIGVTSIKVNGNVVPINTTLLNITKDGKGGTKISTVEPYTKLETSIYNALTKAFVK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVK-----WRMNSMVK  476
            S +   + RV PVAPF+VC+       + VG  VP +E VL+++        W +NSMV 
Sbjct  318  SISK--VPRVKPVAPFKVCYNRTSLGSTRVGPGVPPIELVLRNKNATTSWTIWGVNSMVA  375

Query  475  VGDGVMCLGFLDGGL--GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V D V+CLGF+DGG+      S+VIG +Q+EDNLL+F++    LGFTS  L   T+C++F
Sbjct  376  VNDDVLCLGFVDGGVEFEPTTSIVIGAHQIEDNLLQFDIANKRLGFTSSLLFGQTTCANF  435



>gb|KJB70565.1| hypothetical protein B456_011G080800 [Gossypium raimondii]
Length=434

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 119/180 (66%), Gaps = 15/180 (8%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q   + +Y+I V  I IN + +  N +LL +++E +GGT+ISTV PYT ++T+IY   ++
Sbjct  252  QGDPSADYFIGVNGITINTKPVSFNKTLLSINKEGQGGTKISTVTPYTVMQTSIYRAVVN  311

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++  + +  +RV  VAPF  C++        VG  VP+++ +L +++V WR+   NSM
Sbjct  312  AFIKQTSKV--ARVPAVAPFSACYNAKSLGSTRVGPAVPQIDLLLPNKVV-WRIFGANSM  368

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V+V   V+CLGF+DGGL    S+VIGG+Q+EDNLL+ +L  S LGF+S  L   T+CS+F
Sbjct  369  VQVNKDVLCLGFVDGGLEPTTSIVIGGHQIEDNLLQIDLAASKLGFSSSLLFRRTTCSNF  428



>gb|KCW84281.1| hypothetical protein EUGRSUZ_B01132 [Eucalyptus grandis]
Length=302

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 115/176 (65%), Gaps = 15/176 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+IN+ SIKIN + +PLN +LL +  +  GGT+ISTV PYT ++T+I+  F+  +  
Sbjct  124  STDYFINLTSIKINGKAVPLNAALLKI-TDGNGGTKISTVNPYTVMETSIFKAFVKVFRH  182

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             A +  L++V  V PF+ CFS        VG  VP ++ V+ +  V WR+   NSMV+V 
Sbjct  183  EAKN--LTKVSSVKPFKYCFSSKNTPSTRVGPAVPLIDLVMHNSSVYWRIFGANSMVQVK  240

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGG     S+VIGGYQLEDNL++ ++  + LGF+S  L   T+CS+F
Sbjct  241  EDVICLGFVDGGSNPRTSIVIGGYQLEDNLVQIDMEKARLGFSSSLLFKQTTCSNF  296



>ref|XP_006654378.1| PREDICTED: basic 7S globulin-like [Oryza brachyantha]
Length=436

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 112/176 (64%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY++ +  IK+N R +PLNT+LL + ++  GGT++STV PYT L+T+I+   +D++  
Sbjct  260  STEYFVGLTGIKVNGRAVPLNTTLLSISKKGVGGTKLSTVSPYTVLETSIHKAVIDAF--  317

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            +A +  + R   VAPF++C+ G       VG  VP VE V QSE   W +   NSMV   
Sbjct  318  AAETSMIPRAPAVAPFKLCYDGSKVGSTRVGPAVPTVELVFQSEAASWVVFGANSMVATK  377

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             G +CLG +DGG     SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  378  GGALCLGVVDGGATPETSVVIGGHMMEDNLLEFDLEGSRLGFSSSLLFRQTTCNNF  433



>gb|AES60912.2| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=451

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 118/180 (66%), Gaps = 13/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q  ++ EY+I VK+IKI+ + + LN+SLL +D +  GGT+ISTV PYT L+ +IY    D
Sbjct  267  QGESSVEYFIGVKTIKIDGKVVSLNSSLLSIDNKGVGGTKISTVDPYTVLEASIYKAVTD  326

Query  631  SYLESAASMGLSRVDPVAPFEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++++ +  ++  D   PFE C+S        +G+ VP +E +LQ+ ++ W M   NSM
Sbjct  327  AFVKASVARNITTEDSSPPFEFCYSFDNLPGTPLGASVPTIELLLQNNVI-WSMFGANSM  385

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V + D V+CLGF++GG+    S+VIGGYQLE+NLL+F+L  S LGF++ +    T C  F
Sbjct  386  VNINDEVLCLGFVNGGVNLRTSIVIGGYQLENNLLQFDLAASRLGFSNTIFAHQTDCFRF  445



>ref|XP_009625778.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=439

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 115/182 (63%), Gaps = 15/182 (8%)
 Frame = -1

Query  808  NGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDS  629
            N    +Y+IN+ SIK+N   + LN  +L +D+   GGT++STV PYT L ++IY    ++
Sbjct  249  NPVQSDYFINLTSIKVNGVTVQLNRKILAVDEHGFGGTKLSTVTPYTLLHSSIYKALTET  308

Query  628  YLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMV  479
            ++  +  + L+  +PV PF+VC++        VG  VP V+ V+  + V WR+   NSMV
Sbjct  309  FVNQSTKLNLTVTNPVEPFKVCYNADEVMETRVGPAVPTVDLVMHGDDVFWRIFGSNSMV  368

Query  478  KV---GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  314
            ++   G  V CLGFLDGG+    S++IGG+Q+EDNLL+F+L    LGF+S  L+  T+CS
Sbjct  369  RIFRDGVNVWCLGFLDGGVKTKTSIIIGGHQMEDNLLQFDLRQQRLGFSSSVLVYNTTCS  428

Query  313  HF  308
            +F
Sbjct  429  NF  430



>ref|XP_010026236.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=418

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 116/179 (65%), Gaps = 17/179 (9%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL-E  620
            EYY+NV +IK+N + +PLN +LL +DQ+   GGT IST+VPYTTL+T+IY     ++  E
Sbjct  232  EYYVNVTAIKVNGKAVPLNATLLAIDQKSGHGGTIISTLVPYTTLQTSIYGAVARAFAQE  291

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV-  473
            ++ +  L+   PV PF +C+S         G  VP ++ V+  +   WR+   NSMV++ 
Sbjct  292  ASTAFNLTATQPVKPFGLCYSARLVNITRAGPAVPAIDLVMHGQDAVWRLFGANSMVRIQ  351

Query  472  --GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
              G    CLG +DGG    A+++IGG+Q+EDNLL+F+LG   LGF+S  L+ GT+C++F
Sbjct  352  RNGTDAWCLGLVDGGAEFRAAILIGGHQMEDNLLQFDLGKMRLGFSSSVLVRGTTCANF  410



>ref|XP_010024401.1| PREDICTED: basic 7S globulin 2-like [Eucalyptus grandis]
Length=441

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 109/174 (63%), Gaps = 13/174 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY+++V SIK++   +   +S+L +D+   GGT+I T+ PYT L + I+ P ++ + +
Sbjct  266  SDEYFVDVTSIKVDLAPISFKSSILAIDKNGIGGTKIGTLTPYTVLHSAIFRPLVNEFTK  325

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             A    + +  PVAPF VCF          G DVP +  VLQ   V+WRM   NSMV+V 
Sbjct  326  KAMDRKIKKASPVAPFGVCFDAKMVRSGKAGPDVPAIVLVLQGN-VQWRMEGANSMVRVS  384

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS  314
              VMCLGF+DGG     +VVIG +Q+EDNL+EF++G+S  GF++  L+  +SCS
Sbjct  385  KDVMCLGFVDGGSKPRTAVVIGAHQMEDNLVEFDVGSSTFGFSNSLLLQNSSCS  438



>ref|NP_001174419.1| Os05g0403000 [Oryza sativa Japonica Group]
 gb|AAT85210.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EEE63671.1| hypothetical protein OsJ_18489 [Oryza sativa Japonica Group]
 dbj|BAH93147.1| Os05g0403000 [Oryza sativa Japonica Group]
Length=437

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 110/178 (62%), Gaps = 15/178 (8%)
 Frame = -1

Query  802  TTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            T+ EY I +  IK+N R +PLN +LL +D+   GGT +ST  PYT L+T+IY   +D++ 
Sbjct  259  TSIEYLIGLTGIKVNGRDVPLNATLLAIDKNGVGGTTLSTASPYTVLETSIYKAVIDAFA  318

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
               A+  + RV  VAPFE+C+ G        G  VP +E VLQ E V W M   NSMV  
Sbjct  319  AETAT--IPRVPAVAPFELCYDGRKVGSTRAGPAVPTIELVLQREAVSWIMYGANSMVPA  376

Query  472  GDGVMCLGFLDGGLG-QGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMA--GTSCSHF  308
              G +CLG +DGG     +SVVIGG+ +EDNLLEF+L  S LGF+S +    T+C++F
Sbjct  377  KGGALCLGVVDGGPALYPSSVVIGGHMMEDNLLEFDLEGSRLGFSSYLPLRQTTCNNF  434



>ref|XP_004962140.1| PREDICTED: basic 7S globulin-like [Setaria italica]
Length=434

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 111/176 (63%), Gaps = 14/176 (8%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + EY++ V  IK+N R +PLN +LL +D++  GGT++STV PYT L+++IY     ++  
Sbjct  258  SDEYFVGVTGIKVNGRAVPLNATLLAIDKKGVGGTKLSTVAPYTVLESSIYKAVTGAF--  315

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
            +A +  + R   +APF++C+ G       VG  VP +E VL ++   W +   NSMV V 
Sbjct  316  AAETAAIPRAPAMAPFQLCYDGSKVGSTRVGPAVPTIELVLGTDATSWVVFGANSMVAVK  375

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             G +CLG +DGG     SVVIGG+ +EDNLLEF+L  S LGF+S  L   T+C++F
Sbjct  376  GGALCLGVVDGGEAPRTSVVIGGHMMEDNLLEFDLEASRLGFSSSLLFRQTNCNNF  431



>ref|XP_006419826.1| hypothetical protein CICLE_v10006501mg [Citrus clementina]
 gb|ESR33066.1| hypothetical protein CICLE_v10006501mg [Citrus clementina]
Length=419

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 109/168 (65%), Gaps = 4/168 (2%)
 Frame = -1

Query  802  TTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            ++ EY+I VKSI I+   +PLN SLL +++E  GGT+ISTV PYT L+T+IY  F+ +++
Sbjct  248  SSAEYFIGVKSILISGNVVPLNKSLLSINKEGFGGTKISTVFPYTVLETSIYKAFVKTFI  307

Query  622  ESAASMGLSRVDPVAPFEVCFSGVGSDVPKVEFVLQSEMVKWRMNSMVKVGDGVMCLGFL  443
            +S ++  + RV P+APF  CF+        V+       +    NSMV+VG   MCL F+
Sbjct  308  KSYSN--IPRVKPMAPFGACFNSSFIGCTHVDAAAPEIHLYMPANSMVRVGKHAMCLAFV  365

Query  442  DGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFT  305
            DGG+    S+VIG YQLEDNLL+F+L  S LGF+S  L   T+CS+ T
Sbjct  366  DGGVNPTTSIVIGAYQLEDNLLQFDLAKSRLGFSSSLLARQTTCSNLT  413



>ref|XP_003590661.1| Basic 7S globulin [Medicago truncatula]
Length=500

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 118/180 (66%), Gaps = 13/180 (7%)
 Frame = -1

Query  811  QNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            Q  ++ EY+I VK+IKI+ + + LN+SLL +D +  GGT+ISTV PYT L+ +IY    D
Sbjct  259  QGESSVEYFIGVKTIKIDGKVVSLNSSLLSIDNKGVGGTKISTVDPYTVLEASIYKAVTD  318

Query  631  SYLESAASMGLSRVDPVAPFEVCFS-------GVGSDVPKVEFVLQSEMVKWRM---NSM  482
            ++++++ +  ++  D   PFE C+S        +G+ VP +E +LQ+ ++ W M   NSM
Sbjct  319  AFVKASVARNITTEDSSPPFEFCYSFDNLPGTPLGASVPTIELLLQNNVI-WSMFGANSM  377

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V + D V+CLGF++GG+    S+VIGGYQLE+NLL+F+L  S LGF++ +    T C  F
Sbjct  378  VNINDEVLCLGFVNGGVNLRTSIVIGGYQLENNLLQFDLAASRLGFSNTIFAHQTDCFRF  437



>ref|XP_004229434.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=437

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 115/174 (66%), Gaps = 14/174 (8%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I V SIKIN   +P+NT+LL + ++ +GGT+ISTV PYT L+T+IY+    ++++S 
Sbjct  260  EYFIGVTSIKINGNVVPINTTLLDITKDGKGGTKISTVDPYTKLETSIYNALTKAFVKSL  319

Query  613  ASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVK-WRMNSMVKVGDGVM  458
            + +   RV P+APFEVC+       + VG  VP +E VL +     W  NSMV V D V+
Sbjct  320  SKV--PRVKPLAPFEVCYNRSSLGSTRVGPGVPPIELVLGTTSWNIWGSNSMVAVNDDVL  377

Query  457  CLGFLDGGL--GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            CLGF+DGG+      S+VIG +Q+EDN L+F++    LGFTS  L + T+C++F
Sbjct  378  CLGFVDGGVEFEPTTSIVIGAHQIEDNFLQFDIANKRLGFTSSLLFSQTTCANF  431



>ref|XP_006349243.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=441

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 118/180 (66%), Gaps = 18/180 (10%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I V SIKIN   +P+NT+LL + ++ +GGT+ISTV PYT L+T+IY+    ++++
Sbjct  258  STDYFIGVTSIKINGNVVPINTTLLNITKDGKGGTKISTVDPYTKLETSIYNALTKAFVK  317

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVK-----WRMNSMVK  476
            S + +   RV PVAPFEVC+       + VG  VP +E VL ++        W +NSMV 
Sbjct  318  SLSKV--PRVKPVAPFEVCYNRTSLGSTRVGPGVPPIELVLGNKNATTSWTIWGVNSMVA  375

Query  475  VGDGVMCLGFLDGGL--GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V + V+CLGF+DGG+      S+VIG +Q+EDNLL+F++    LGFTS  L   T+C++F
Sbjct  376  VNNDVLCLGFVDGGVEFEPTTSIVIGAHQIEDNLLQFDIANKRLGFTSSLLFGQTTCANF  435



>ref|XP_006433276.1| hypothetical protein CICLE_v10003944mg [Citrus clementina]
 gb|ESR46516.1| hypothetical protein CICLE_v10003944mg [Citrus clementina]
Length=422

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 111/175 (63%), Gaps = 14/175 (8%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYLES  617
            +YYI + SI+IN++++P+N SLL  +     GGT+IST+ PYT L+ +IY  F   +L S
Sbjct  243  QYYITLTSIRINNKQVPINASLLKFNVNAGTGGTKISTIKPYTVLEHSIYQSF-TRFLTS  301

Query  616  AASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGD  467
                      PVAPF VC+       +  G  VP ++FVLQ++ VKW +   NSMV+   
Sbjct  302  QLPGIPQLAKPVAPFSVCYDSRKLKSTRAGPGVPNIDFVLQNQNVKWTITGANSMVEARR  361

Query  466  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            GV CL F+DGG+   AS++IG +QL+DNL++F+L  S LGF+S  L   TSCS+F
Sbjct  362  GVTCLAFVDGGVRPRASIIIGSHQLQDNLVQFDLAGSRLGFSSSLLFRRTSCSNF  416



>ref|NP_001274964.1| xyloglucan-specific endoglucanase inhibitor 4 precursor [Solanum 
tuberosum]
 gb|ADU58605.1| xyloglucan-specific endoglucanase inhibitor 4 [Solanum tuberosum]
Length=440

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 118/180 (66%), Gaps = 18/180 (10%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I V SIKIN   +P+NT+LL + ++ +GGT+ISTV PYT L+T+IY+    ++++
Sbjct  257  STDYFIGVTSIKINGNVVPINTTLLNITKDGKGGTKISTVDPYTKLETSIYNALTKAFVK  316

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVK-----WRMNSMVK  476
            S A   + RV PVAPF+VC+       + VG  VP +E VL ++        W +NSMV 
Sbjct  317  SLAK--VPRVKPVAPFKVCYNRTSLGSTRVGRGVPPIELVLGNKNATTSWTIWGVNSMVA  374

Query  475  VGDGVMCLGFLDGGL--GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + + V+CLGFLDGG+      S+VIG +Q+EDNLL+F++    LGFTS  L   T+C++F
Sbjct  375  MNNDVLCLGFLDGGVEFEPTTSIVIGAHQIEDNLLQFDIANKRLGFTSSLLFGQTTCANF  434



>emb|CDY15455.1| BnaA08g27390D [Brassica napus]
Length=432

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 116/180 (64%), Gaps = 13/180 (7%)
 Frame = -1

Query  808  NGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLD  632
            N  + EY+I V +IK+ ++ +P+NTSLL ++     GGT++STV PYT L+T+I+     
Sbjct  247  NPKSPEYFIGVTAIKVAEKTVPINTSLLKINGTTGLGGTKLSTVNPYTVLETSIFKAVTS  306

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++  A +  ++RV  V PF  C S        +G  VP+++ VLQS+ V WR+   NSM
Sbjct  307  AFVREATARNITRVPSVKPFGACVSTKNVVVTRLGYAVPEIQLVLQSKDVVWRIFGANSM  366

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
            V V   V+CLGF+DGG+    SV+IGG QLEDNL+E +L  + LGF+S + G  T+C++F
Sbjct  367  VSVHSDVICLGFVDGGVNAETSVIIGGLQLEDNLIEIDLAKNTLGFSSTLLGRQTNCANF  426



>ref|XP_006371344.1| hypothetical protein POPTR_0019s09280g [Populus trichocarpa]
 gb|ERP49141.1| hypothetical protein POPTR_0019s09280g [Populus trichocarpa]
Length=442

 Score =   144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 115/186 (62%), Gaps = 18/186 (10%)
 Frame = -1

Query  814  PQNGTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFL  635
            P +  + EYY+ + SIK+N + +  N +LL  +    GGTRISTVVPYT L+++IY  F 
Sbjct  251  PYSHRSPEYYVGLTSIKVNGKMVAFNKALLAFNDRGYGGTRISTVVPYTKLQSSIYKAFT  310

Query  634  DSYLESAAS--MGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---  491
             ++L+ AAS    L+   PV PF VC+         +G  VP +E VL  + V W+M   
Sbjct  311  LAFLKEAASSAFNLTTTKPVKPFRVCYPAGAVKTTQMGPAVPIIELVLDRQDVVWKMFGS  370

Query  490  NSMVKVGD---GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAG  326
            NSMV+V      V CLGF+DGG+  G S++IGG QLEDNLL+F+L +  LGF+S  L  G
Sbjct  371  NSMVRVTKKSVDVWCLGFVDGGI-DGPSIMIGGLQLEDNLLQFDLQSQKLGFSSSILSKG  429

Query  325  TSCSHF  308
            T+C+ +
Sbjct  430  TNCADY  435



>ref|XP_004247154.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=431

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 115/183 (63%), Gaps = 16/183 (9%)
 Frame = -1

Query  808  NGTTQEYYINVKSIKINDRKLPLN-TSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLD  632
            N     Y+IN+ SIK+N   + LN  ++  LDQ+  G T++STV PYTTL + IY PF +
Sbjct  240  NPVQSNYFINLTSIKVNGVTVQLNHNNISALDQQGFGLTKLSTVTPYTTLHSNIYKPFTE  299

Query  631  SYLESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSM  482
            +++  +  + L+  +PV PF+VC++        VG  VP V+ V+ S+ V WR+   NSM
Sbjct  300  TFINESTKLNLTVTNPVEPFKVCYNADEVLDTKVGPTVPTVDLVMDSDDVFWRIFGSNSM  359

Query  481  VKV---GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSC  317
            V++   G  V CLGFLDGG     S++IGG+Q+E+NLL+F+L    LGF+S  L   TSC
Sbjct  360  VRIARNGVDVWCLGFLDGGSKTETSIIIGGHQMENNLLQFDLEQEKLGFSSSVLAYSTSC  419

Query  316  SHF  308
            S+F
Sbjct  420  SNF  422



>ref|XP_002517167.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45330.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=435

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 119/183 (65%), Gaps = 14/183 (8%)
 Frame = -1

Query  802  TTQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            ++ +Y+I VK++++  +++  N +LL +D E +GGTRISTV PYT L T+IY   + ++ 
Sbjct  254  SSTDYFIAVKTLRVGGKEIKFNKTLLSIDNEGKGGTRISTVHPYTLLHTSIYKAVIKAFA  313

Query  622  ESAASMGLSRVDPVAPFEVCFSGVGSD-------VPKVEFVLQSE-MVKWRM---NSMVK  476
            +    + +    P+APF +C+     D       VP ++ VL+S+  V WR+   NSMVK
Sbjct  314  KQMKFL-IEVNPPIAPFGLCYQSAAMDINEYGPVVPFIDLVLESQGSVYWRIWGANSMVK  372

Query  475  VGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHFTR  302
            +   VMCLGF+DGGL   +S++IGG QLEDNLL+F+L ++ LGFTS  L+  T+CS+F  
Sbjct  373  ISSYVMCLGFVDGGLKPDSSIIIGGRQLEDNLLQFDLASARLGFTSSLLVRNTTCSNFNS  432

Query  301  FSM  293
             S+
Sbjct  433  KSV  435



>gb|KCW60840.1| hypothetical protein EUGRSUZ_H03578 [Eucalyptus grandis]
Length=392

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 112/179 (63%), Gaps = 18/179 (10%)
 Frame = -1

Query  796  QEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYH-----PFLD  632
             EY+I+V +IKI+   +  N+S+L +D++  GGT+  T+ PY+    T +H     P ++
Sbjct  214  DEYFIDVTAIKIDSAPITFNSSILAIDKDGAGGTKFGTLTPYSRAPYTFFHSAIFNPLVE  273

Query  631  SYLESAASMGLSRVDPVAPFEVCF------SGV-GSDVPKVEFVLQSEMVKWRM---NSM  482
             + + A    + +  PVAPF  CF      SGV GSDVP +  VL+ +  +WR+   NSM
Sbjct  274  EFTKKATDGKIKKATPVAPFGACFDARTVRSGVAGSDVPAIVLVLRGD-AQWRIEGANSM  332

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSH  311
            V+V   VMCLGFLDGG G GA++ IGG Q+EDNLLE ++G+   GF++  L+  +SCSH
Sbjct  333  VRVSKDVMCLGFLDGGSGAGAAIEIGGNQMEDNLLESDVGSLTFGFSNSLLLRNSSCSH  391



>ref|XP_009787261.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=436

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 111/180 (62%), Gaps = 16/180 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEV-EGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + EY+I V SIK+N + +PLN +LL +++E   GGT+IST  PYT L+T ++    + ++
Sbjct  251  SDEYFIGVSSIKVNGKSVPLNQTLLKINEENGYGGTKISTSTPYTVLQTAMFKAVTERFV  310

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
              A +M L+   PV PFEVCF         +G  VP ++ VLQ   V WR+   NSMV+V
Sbjct  311  AEAKAMNLTVTTPVKPFEVCFPAKAIAFTRLGPAVPTIDLVLQKPDVFWRIFGSNSMVRV  370

Query  472  GD---GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
                  V CLGF+DGG     S+VIGG+Q+EDNLL+F+L     GF+S  L   T+C++F
Sbjct  371  KAQNVDVWCLGFVDGGPEPRTSIVIGGHQIEDNLLQFDLAQKRFGFSSSLLFKSTNCANF  430



>ref|XP_006489313.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=420

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 116/179 (65%), Gaps = 15/179 (8%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I V S+ +N + +PLN +LL +D E  GGT+ISTV PYT L+T+IY   + ++  ++
Sbjct  244  EYFIGVTSVHVNGKAVPLNKTLLSIDNEGVGGTKISTVNPYTVLETSIYKALVQAF--AS  301

Query  613  ASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
            A   ++RV PVAPF  CF       + +G  VP+++ VLQ++ V W +   NSMV++G  
Sbjct  302  AMPKVARVAPVAPFGACFRLQDIGFTRIGPVVPQIDLVLQNKNVVWSIHGQNSMVQIGGD  361

Query  463  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS-HFTRFS  296
             +CLGF+DGG+    S+VIG  QLE+ LL+F+L TS LGF+   L    +C+ +FT  +
Sbjct  362  ALCLGFVDGGVNPRTSIVIGARQLENYLLQFDLATSRLGFSDSLLFERATCTFNFTSIA  420



>ref|XP_011005003.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=262

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 116/188 (62%), Gaps = 19/188 (10%)
 Frame = -1

Query  817  PPQNGTTQEYYINVKSIKINDRKLPLNTSLLVLD-QEVEGGTRISTVVPYTTLKTTIYHP  641
            P  +  + EYY+ + SIK+N + +  N +LL +D Q   GGTRIST+VPYT L+++IY  
Sbjct  69   PNTHRLSPEYYVGLTSIKVNGKMVAFNKALLAIDDQSGSGGTRISTLVPYTKLQSSIYKA  128

Query  640  FLDSYLESAAS--MGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM-  491
            F  ++L+ AAS    L+   PV PF VC+       + +G  VP +E VL  + V W+M 
Sbjct  129  FTLAFLKEAASSAFNLTTTKPVKPFRVCYPVGAVKTTQMGPAVPLIELVLDRQDVVWKMF  188

Query  490  --NSMVKVGDG---VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LM  332
              NSMV+V      + CLGF+DGG+  G S++IGG QLEDNLL+ +L +  LGF+S  L 
Sbjct  189  GSNSMVRVTKKSVDLWCLGFVDGGI-DGPSIIIGGLQLEDNLLQIDLQSKKLGFSSSILS  247

Query  331  AGTSCSHF  308
             GT C+ +
Sbjct  248  KGTKCADY  255



>ref|XP_010026985.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=434

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 112/180 (62%), Gaps = 18/180 (10%)
 Frame = -1

Query  796  QEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYH-----PFLD  632
             EY+I+V +IKI+   +  N+S+L +D++  GGT+  T+ PY+    T +H     P ++
Sbjct  256  DEYFIDVTAIKIDSAPITFNSSILAIDKDGAGGTKFGTLTPYSRAPYTFFHSAIFNPLVE  315

Query  631  SYLESAASMGLSRVDPVAPFEVCF------SGV-GSDVPKVEFVLQSEMVKWRM---NSM  482
             + + A    + +  PVAPF  CF      SGV GSDVP +  VL+ +  +WR+   NSM
Sbjct  316  EFTKKATDGKIKKATPVAPFGACFDARTVRSGVAGSDVPAIVLVLRGD-AQWRIEGANSM  374

Query  481  VKVGDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V+V   VMCLGFLDGG G GA++ IGG Q+EDNLLE ++G+   GF++  L+  +SCSH 
Sbjct  375  VRVSKDVMCLGFLDGGSGAGAAIEIGGNQMEDNLLESDVGSLTFGFSNSLLLRNSSCSHL  434



>ref|XP_006419832.1| hypothetical protein CICLE_v10005038mg [Citrus clementina]
 gb|ESR33072.1| hypothetical protein CICLE_v10005038mg [Citrus clementina]
Length=420

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 116/179 (65%), Gaps = 15/179 (8%)
 Frame = -1

Query  793  EYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLESA  614
            EY+I V S+ +N + +PLN +LL +D E  GGT+ISTV PYT L+T+IY   + ++  ++
Sbjct  244  EYFIGVTSVHVNGKAVPLNKTLLSIDNEGVGGTKISTVNPYTVLETSIYKALVQAF--AS  301

Query  613  ASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKVGDG  464
            A   ++RV PVAPF  CF       + +G  VP+++ VLQ++ V W +   NSMV++G  
Sbjct  302  AMPKVARVAPVAPFGACFRLQDIGFTRIGPVVPQIDLVLQNKNVVWTIHGQNSMVQIGGD  361

Query  463  VMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCS-HFTRFS  296
             +CLGF+DGG+    S+VIG  QLE+ LL+F+L TS LGF+   L    +C+ +FT  +
Sbjct  362  ALCLGFVDGGVNPRTSIVIGARQLENYLLQFDLATSRLGFSDSLLFERATCTFNFTSIA  420



>gb|EYU20615.1| hypothetical protein MIMGU_mgv1a006692mg [Erythranthe guttata]
Length=435

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 113/180 (63%), Gaps = 16/180 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQ-EVEGGTRISTVVPYTTLKTTIYHPFLDSYL  623
            T EY+I+VKS+++  + L LN +LL +++ +  GGT I TV  YT L  +IY   +D ++
Sbjct  253  THEYFIDVKSVRVGSKTLSLNKTLLSINKKDGSGGTSIRTVRAYTGLHRSIYMALIDEFV  312

Query  622  ESAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
            ++AAS  + RV  VAPF  CF       S  G  VP ++FVL  + V WR    NSMV+V
Sbjct  313  KAAASQNIKRVASVAPFGACFGSKTVTSSKTGPQVPTIDFVLHKKSVYWRFYGANSMVRV  372

Query  472  GDGVMCLGFLDGG---LGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
             D V+CL F++G    +G   S+ +GGYQ+E+ LLEF++ +S LGF+S  L+  TSCS F
Sbjct  373  SDEVICLAFVEGATNLVGPTTSIEVGGYQMENYLLEFDVASSKLGFSSSLLLHDTSCSKF  432



>ref|XP_009111160.1| PREDICTED: basic 7S globulin-like [Brassica rapa]
Length=455

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 115/177 (65%), Gaps = 13/177 (7%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDSYL  623
            + EY+I V +IK+ ++ +P+NTSLL ++     GGT++STV PYT L+T+I+     +++
Sbjct  273  SPEYFIGVTAIKVAEKTVPINTSLLKINGTTGLGGTKLSTVNPYTVLETSIFKAVTSAFV  332

Query  622  ESAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKV  473
              A +  ++RV  V PF  C S        +G  VP+++ VLQS+ V WR+   NSMV V
Sbjct  333  REATARNITRVPSVKPFGACVSTKNVVVTRLGYAVPEIQLVLQSKDVVWRIFGANSMVSV  392

Query  472  GDGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTSLMAG--TSCSHF  308
               V+CLGF+DGG+    SVV+GG QLEDNL+E +L  + LGF+S + G  T+C++F
Sbjct  393  HSDVICLGFVDGGVNAETSVVVGGLQLEDNLIEIDLAKNTLGFSSTLLGRQTNCANF  449



>ref|XP_009591595.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=440

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 116/180 (64%), Gaps = 18/180 (10%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+I V SIKIN   +P+NT+LL + ++ +GGT+ISTV PY  L+++IY+    ++++
Sbjct  257  STDYFIGVTSIKINGNVVPINTTLLTITKDGKGGTKISTVEPYMKLESSIYNALTKAFVK  316

Query  619  SAASMGLSRVDPVAPFEVCF-------SGVGSDVPKVEFVLQSE-----MVKWRMNSMVK  476
            S A   + RV PVAPF+VC+       + VG  VP +E VL S         W +NSMV 
Sbjct  317  SLAK--VPRVKPVAPFKVCYNRASLGSTRVGPGVPPIELVLGSNKDAKSWTIWGVNSMVA  374

Query  475  VGDGVMCLGFLDGGL--GQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            V + V+CLGF+DGG+      S+VIG +Q+EDNLL+F++    LGFTS  L   T+C++F
Sbjct  375  VNNEVLCLGFVDGGIEFEPTTSIVIGAHQIEDNLLQFDIANKKLGFTSSLLFGQTTCANF  434



>ref|XP_009596039.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=440

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 111/175 (63%), Gaps = 11/175 (6%)
 Frame = -1

Query  805  GTTQEYYINVKSIKINDRKLPLNTSLLVLDQEVE-GGTRISTVVPYTTLKTTIYHPFLDS  629
            G   EY+I V+SI++N++ +PLN S L+  +    GG +IST+ PYT L+  I+  F   
Sbjct  254  GAQGEYFIPVRSIRVNNKPVPLNRSSLISTRSQNFGGAKISTIRPYTVLEHNIFTAFTQF  313

Query  628  YLESAASMGLSRVDPVAPFEVCFSG---VGSDVPKVEFVLQSEMVKW---RMNSMVKVGD  467
            +    +  G+SRV+P++PF +CF+      ++VP ++FV+Q+  V W   R NSMV+   
Sbjct  314  FANQLS--GVSRVNPISPFGLCFNSNNLTSTNVPNIDFVMQNRNVTWTITRANSMVQARP  371

Query  466  GVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            GV CL F+DGG  +   +VIG +QLEDN ++F+L  S LGF+S  L   TSCS+F
Sbjct  372  GVSCLAFVDGGENRKNPIVIGVHQLEDNFVQFDLVKSRLGFSSSLLSRNTSCSNF  426



>ref|XP_010035585.1| PREDICTED: basic 7S globulin [Eucalyptus grandis]
Length=436

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 115/176 (65%), Gaps = 15/176 (9%)
 Frame = -1

Query  799  TQEYYINVKSIKINDRKLPLNTSLLVLDQEVEGGTRISTVVPYTTLKTTIYHPFLDSYLE  620
            + +Y+IN+ SIKIN + +PLN +LL +  +  GGT+ISTV PYT ++T+I+  F+  +  
Sbjct  258  STDYFINLTSIKINGKAVPLNAALLKI-TDGNGGTKISTVNPYTVMETSIFKAFVKVFRH  316

Query  619  SAASMGLSRVDPVAPFEVCFSG-------VGSDVPKVEFVLQSEMVKWRM---NSMVKVG  470
             A +  L++V  V PF+ CFS        VG  VP ++ V+ +  V WR+   NSMV+V 
Sbjct  317  EAKN--LTKVSSVKPFKYCFSSKNTPSTRVGPAVPLIDLVMHNSSVYWRIFGANSMVQVK  374

Query  469  DGVMCLGFLDGGLGQGASVVIGGYQLEDNLLEFNLGTSMLGFTS--LMAGTSCSHF  308
            + V+CLGF+DGG     S+VIGGYQLEDNL++ ++  + LGF+S  L   T+CS+F
Sbjct  375  EDVICLGFVDGGSNPRTSIVIGGYQLEDNLVQIDMEKARLGFSSSLLFKQTTCSNF  430



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1876722211200