BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF037O24

Length=587
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB65560.1|  hypothetical protein B456_010G101200                    383   1e-122   Gossypium raimondii
gb|KHG00684.1|  Glycine dehydrogenase [decarboxylating], mitochon...    382   2e-122   Gossypium arboreum [tree cotton]
gb|KJB54687.1|  hypothetical protein B456_009G045100                    381   8e-122   Gossypium raimondii
gb|KHG06307.1|  Glycine dehydrogenase [decarboxylating], mitochon...    379   2e-121   Gossypium arboreum [tree cotton]
ref|XP_009620998.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    379   4e-121   Nicotiana tomentosiformis
ref|XP_007012280.1|  Glycine decarboxylase P-protein 1                  378   1e-120   
ref|XP_003544533.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    378   2e-120   Glycine max [soybeans]
ref|XP_009797115.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    377   2e-120   Nicotiana sylvestris
ref|XP_010262151.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    376   5e-120   Nelumbo nucifera [Indian lotus]
emb|CBI20667.3|  unnamed protein product                                367   5e-120   Vitis vinifera
ref|XP_004245101.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    374   3e-119   Solanum lycopersicum
sp|O49954.1|GCSP_SOLTU  RecName: Full=Glycine dehydrogenase (deca...    374   3e-119   Solanum tuberosum [potatoes]
gb|AEP95746.1|  glycine decarboxylase complex subunit P                 350   6e-119   Cicer arietinum [garbanzo]
ref|XP_011081684.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    373   7e-119   Sesamum indicum [beniseed]
ref|XP_003550270.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    372   1e-118   Glycine max [soybeans]
dbj|BAD81531.1|  P protein-like                                         347   1e-118   Oryza sativa Japonica Group [Japonica rice]
gb|AEP95751.1|  glycine decarboxylase complex subunit P                 349   2e-118   Cicer arietinum [garbanzo]
ref|XP_011097886.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    372   3e-118   Sesamum indicum [beniseed]
ref|XP_002516446.1|  glycine dehydrogenase, putative                    371   5e-118   Ricinus communis
ref|XP_010047334.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    370   6e-118   Eucalyptus grandis [rose gum]
ref|XP_004498895.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    371   1e-117   
emb|CDP08258.1|  unnamed protein product                                369   2e-117   Coffea canephora [robusta coffee]
gb|KDP34101.1|  hypothetical protein JCGZ_07672                         369   2e-117   Jatropha curcas
ref|XP_006361002.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    370   2e-117   
emb|CAN63089.1|  hypothetical protein VITISV_032016                     369   3e-117   Vitis vinifera
sp|P26969.1|GCSP_PEA  RecName: Full=Glycine dehydrogenase (decarb...    369   3e-117   Pisum sativum [garden pea]
ref|XP_010648358.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    368   6e-117   Vitis vinifera
dbj|BAD81530.1|  P protein-like                                         346   7e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008220472.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    367   1e-116   Prunus mume [ume]
gb|ABO61734.1|  mitochondrial glycine decarboxylase complex P-pro...    367   2e-116   Populus tremuloides
ref|XP_003589000.1|  Glycine dehydrogenase P protein                    366   3e-116   Medicago truncatula
ref|XP_008797766.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   4e-116   Phoenix dactylifera
ref|XP_003523643.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    365   6e-116   Glycine max [soybeans]
gb|KHN29723.1|  Glycine dehydrogenase [decarboxylating], mitochon...    365   6e-116   Glycine soja [wild soybean]
ref|XP_011019466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   6e-116   Populus euphratica
gb|EYU29323.1|  hypothetical protein MIMGU_mgv1a000648mg                365   7e-116   Erythranthe guttata [common monkey flower]
ref|XP_010519851.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    365   9e-116   Tarenaya hassleriana [spider flower]
ref|XP_002308562.1|  P-protein subunit of glycine decarboxylase e...    365   9e-116   Populus trichocarpa [western balsam poplar]
ref|XP_007227061.1|  hypothetical protein PRUPE_ppa000675mg             364   1e-115   
ref|XP_004159575.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    361   1e-115   
ref|XP_009361863.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    364   2e-115   Pyrus x bretschneideri [bai li]
ref|XP_008393646.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    363   2e-115   Malus domestica [apple tree]
ref|XP_009361869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    363   4e-115   Pyrus x bretschneideri [bai li]
ref|XP_008444466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    363   4e-115   Cucumis melo [Oriental melon]
dbj|BAD81529.1|  P protein-like                                         348   6e-115   Oryza sativa Japonica Group [Japonica rice]
gb|EYU20359.1|  hypothetical protein MIMGU_mgv1a000655mg                362   7e-115   Erythranthe guttata [common monkey flower]
ref|NP_001289247.1|  glycine dehydrogenase (decarboxylating), mit...    362   7e-115   Pyrus x bretschneideri [bai li]
ref|XP_010049196.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    362   1e-114   Eucalyptus grandis [rose gum]
gb|AAL24244.1|  AT4g33010/F26P21_130                                    353   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142925.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    362   1e-114   Cucumis sativus [cucumbers]
ref|XP_004291039.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    361   2e-114   Fragaria vesca subsp. vesca
ref|XP_003526001.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    360   3e-114   Glycine max [soybeans]
gb|KHN32209.1|  Glycine dehydrogenase [decarboxylating], mitochon...    360   3e-114   Glycine soja [wild soybean]
ref|XP_010526062.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    360   5e-114   Tarenaya hassleriana [spider flower]
gb|ADM18296.1|  mitochondrial glycine decarboxylase complex P-pro...    340   9e-114   Nicotiana benthamiana
ref|XP_007161011.1|  hypothetical protein PHAVU_001G035500g             359   2e-113   Phaseolus vulgaris [French bean]
gb|AFW56072.1|  hypothetical protein ZEAMMB73_271256                    344   2e-113   
ref|NP_195027.1|  glycine dehydrogenase [decarboxylating] 2             358   4e-113   Arabidopsis thaliana [mouse-ear cress]
gb|AAK68740.1|  P-Protein - like protein                                358   4e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008808050.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    358   4e-113   Phoenix dactylifera
ref|XP_002867212.1|  hypothetical protein ARALYDRAFT_491390             357   5e-113   
ref|NP_180178.1|  glycine decarboxylase P-protein 2                     356   2e-112   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98954.1|  putative glycine dehydrogenase                         356   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644607.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    353   3e-112   Oryza brachyantha
gb|EMS46370.1|  Glycine dehydrogenase [decarboxylating] B, mitoch...    350   4e-112   Triticum urartu
ref|XP_009392931.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    355   4e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK29912.1|  hypothetical protein AALP_AA7G194500                    355   5e-112   Arabis alpina [alpine rockcress]
ref|XP_006408846.1|  hypothetical protein EUTSA_v10001891mg             355   5e-112   Eutrema salsugineum [saltwater cress]
gb|AAA63798.1|  victorin binding protein                                354   5e-112   Avena sativa [cultivated oat]
gb|AAL57651.1|  AT4g33010/F26P21_130                                    354   8e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010667776.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    353   1e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002880741.1|  hypothetical protein ARALYDRAFT_481465             353   2e-111   
ref|XP_010925018.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    353   2e-111   Elaeis guineensis
ref|XP_006412401.1|  hypothetical protein EUTSA_v10024257mg             355   2e-111   
gb|KFK32542.1|  hypothetical protein AALP_AA6G256500                    353   3e-111   Arabis alpina [alpine rockcress]
gb|KHN37049.1|  Glycine dehydrogenase [decarboxylating], mitochon...    327   5e-111   Glycine soja [wild soybean]
gb|KDO80088.1|  hypothetical protein CISIN_1g001531mg                   350   6e-111   Citrus sinensis [apfelsine]
emb|CDM83805.1|  unnamed protein product                                352   7e-111   Triticum aestivum [Canadian hard winter wheat]
gb|EAZ13293.1|  hypothetical protein OsJ_03218                          351   1e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006601224.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    325   1e-110   
ref|XP_010942763.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    351   1e-110   Elaeis guineensis
ref|NP_001044046.1|  Os01g0711400                                       351   1e-110   
gb|EAY75571.1|  hypothetical protein OsI_03474                          351   1e-110   Oryza sativa Indica Group [Indian rice]
ref|XP_002441849.1|  hypothetical protein SORBIDRAFT_08g003440          351   2e-110   Sorghum bicolor [broomcorn]
ref|XP_003569669.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    350   2e-110   Brachypodium distachyon [annual false brome]
gb|EAZ37623.1|  hypothetical protein OsJ_21958                          350   2e-110   Oryza sativa Japonica Group [Japonica rice]
gb|EMT12369.1|  Glycine dehydrogenase (decarboxylating), mitochon...    350   2e-110   
ref|XP_006450834.1|  hypothetical protein CICLE_v10007310mg             351   2e-110   Citrus clementina [clementine]
ref|XP_008347531.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    327   2e-110   
ref|XP_006475931.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    351   2e-110   Citrus sinensis [apfelsine]
gb|AAB82711.1|  glycine decarboxylase P subunit                         350   3e-110   x Tritordeum sp.
dbj|BAD35509.1|  putative glycine dehydrogenase                         350   4e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969722.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    349   5e-110   
emb|CBI27919.3|  unnamed protein product                                348   7e-110   Vitis vinifera
ref|XP_002282271.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    348   1e-109   Vitis vinifera
ref|XP_010097067.1|  Glycine cleavage system P protein 1                348   3e-109   
ref|XP_008662474.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    347   4e-109   
ref|XP_010432628.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    344   6e-108   Camelina sativa [gold-of-pleasure]
emb|CDX75316.1|  BnaA01g03860D                                          342   2e-107   
ref|XP_009125119.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    342   2e-107   Brassica rapa
ref|XP_010437818.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    342   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_009401914.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    342   3e-107   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA81076.1|  P protein                                              342   4e-107   Flaveria pringlei
ref|XP_010429623.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    342   4e-107   Camelina sativa [gold-of-pleasure]
sp|P49361.1|GCSPA_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    342   4e-107   Flaveria pringlei
ref|XP_010417387.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    341   5e-107   Camelina sativa [gold-of-pleasure]
sp|O49852.1|GCSP_FLATR  RecName: Full=Glycine dehydrogenase (deca...    341   6e-107   Flaveria trinervia
emb|CDX68930.1|  BnaC01g05230D                                          341   7e-107   
sp|O49850.1|GCSP_FLAAN  RecName: Full=Glycine dehydrogenase (deca...    341   7e-107   Flaveria anomala
sp|P49362.1|GCSPB_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    341   8e-107   Flaveria pringlei
ref|XP_010472637.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    340   1e-106   Camelina sativa [gold-of-pleasure]
ref|XP_007136824.1|  hypothetical protein PHAVU_009G077400g             339   2e-106   Phaseolus vulgaris [French bean]
ref|XP_006858311.1|  hypothetical protein AMTR_s00064p00096040          339   3e-106   Amborella trichopoda
ref|XP_008347532.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    316   9e-106   
ref|XP_006283054.1|  hypothetical protein CARUB_v10004049mg             337   2e-105   Capsella rubella
ref|XP_006296473.1|  hypothetical protein CARUB_v10025658mg             333   1e-103   Capsella rubella
gb|ACN39938.1|  unknown                                                 321   3e-101   Picea sitchensis
gb|KJB54688.1|  hypothetical protein B456_009G045100                    325   6e-101   Gossypium raimondii
ref|XP_001755004.1|  predicted protein                                  316   3e-98    
ref|XP_001754864.1|  predicted protein                                  317   6e-98    
ref|XP_001780310.1|  predicted protein                                  315   1e-97    
gb|KDO80089.1|  hypothetical protein CISIN_1g001531mg                   313   2e-96    Citrus sinensis [apfelsine]
emb|CAA38252.1|  P-protein subunit of glycine decarboxylase enzym...    287   7e-96    Pisum sativum [garden pea]
ref|XP_005850089.1|  hypothetical protein CHLNCDRAFT_34381              287   3e-95    Chlorella variabilis
ref|XP_006371884.1|  hypothetical protein POPTR_0018s05150g             294   5e-91    
ref|XP_002979861.1|  hypothetical protein SELMODRAFT_153563             294   6e-90    
ref|XP_002988429.1|  hypothetical protein SELMODRAFT_159459             294   8e-90    
ref|XP_001692993.1|  glycine cleavage system, P protein                 288   3e-87    Chlamydomonas reinhardtii
ref|WP_010472943.1|  glycine dehydrogenase                              284   7e-86    Acaryochloris sp. CCMEE 5410
ref|XP_002956892.1|  hypothetical protein VOLCADRAFT_107448             283   8e-86    Volvox carteri f. nagariensis
ref|XP_011398598.1|  Glycine dehydrogenase [decarboxylating], mit...    280   4e-84    Auxenochlorella protothecoides
ref|WP_012166094.1|  glycine dehydrogenase                              279   4e-84    Acaryochloris marina
ref|WP_040765024.1|  glycine dehydrogenase                              264   5e-84    Rhodopirellula maiorica
gb|EMI20957.1|  glycine dehydrogenase                                   264   5e-84    Rhodopirellula maiorica SM1
ref|XP_003055654.1|  glycine cleavage system p-protein                  279   6e-84    Micromonas pusilla CCMP1545
ref|WP_039128745.1|  glycine dehydrogenase                              278   1e-83    Flavihumibacter sp. ZG627
gb|AAM93931.1|  glycine decarboxylase p protein                         258   1e-83    Griffithsia japonica
ref|WP_033110978.1|  hypothetical protein                               255   9e-83    
ref|WP_018342886.1|  glycine dehydrogenase                              274   2e-82    Cytophaga aurantiaca
ref|XP_010304606.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    253   7e-82    Balearica regulorum gibbericeps
ref|WP_022606719.1|  glycine dehydrogenase (decarboxylating)            271   3e-81    Rubidibacter lacunae
ref|WP_016874717.1|  glycine dehydrogenase                              271   3e-81    Chlorogloeopsis fritschii
ref|XP_007112412.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    254   3e-81    
ref|XP_002503477.1|  glycine cleavage system p-protein                  270   6e-81    Micromonas commoda
ref|WP_009094772.1|  glycine dehydrogenase                              270   6e-81    Rhodopirellula sp. SWK7
ref|WP_041036217.1|  glycine dehydrogenase                              270   6e-81    Tolypothrix campylonemoides
ref|WP_028981454.1|  glycine dehydrogenase                              270   6e-81    Sporocytophaga myxococcoides
gb|EFA86802.1|  glycine dehydrogenase                                   270   6e-81    Heterostelium album PN500
ref|WP_039142781.1|  glycine dehydrogenase                              270   8e-81    Flavihumibacter solisilvae
ref|WP_023065539.1|  glycine dehydrogenase                              270   1e-80    Lyngbya aestuarii
ref|WP_017712703.1|  glycine dehydrogenase                              270   1e-80    Prochlorothrix hollandica
emb|CCI29698.1|  Glycine cleavage system P-protein (glycine dehyd...    257   1e-80    Microcystis aeruginosa PCC 9809
ref|WP_012789622.1|  glycine dehydrogenase                              269   1e-80    Chitinophaga pinensis
ref|WP_008684764.1|  glycine dehydrogenase                              270   1e-80    Rhodopirellula sallentina
ref|WP_044171749.1|  glycine dehydrogenase                              269   1e-80    
ref|WP_044197707.1|  glycine dehydrogenase                              269   1e-80    
gb|KIY91355.1|  glycine dehydrogenase                                   249   1e-80    Monoraphidium neglectum
ref|WP_006631620.1|  glycine dehydrogenase                              269   1e-80    Microcoleus vaginatus
ref|WP_015209784.1|  glycine dehydrogenase, decarboxylating             269   2e-80    Cylindrospermum stagnale
gb|AFY83915.1|  glycine dehydrogenase, decarboxylating                  269   2e-80    Oscillatoria acuminata PCC 6304
ref|WP_016866657.1|  glycine dehydrogenase                              269   2e-80    Fischerella muscicola
ref|WP_044035200.1|  glycine dehydrogenase                              256   2e-80    
ref|WP_009457628.1|  glycine dehydrogenase                              269   2e-80    Fischerella thermalis
ref|XP_010074869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    255   2e-80    Pterocles gutturalis
ref|WP_016870901.1|  glycine dehydrogenase                              269   2e-80    Fischerella thermalis
ref|XP_010129815.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   2e-80    Buceros rhinoceros silvestris
ref|WP_011140250.1|  glycine dehydrogenase                              269   2e-80    Gloeobacter violaceus
ref|WP_016546738.1|  glycine dehydrogenase                              268   2e-80    Leptospira wolffii
dbj|GAL84002.1|  glycine dehydrogenase                                  268   2e-80    Sporocytophaga myxococcoides
ref|XP_009490955.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    255   2e-80    Pelecanus crispus
ref|WP_035999593.1|  glycine dehydrogenase                              269   3e-80    [Leptolyngbya] sp. JSC-1
ref|WP_002155590.1|  glycine dehydrogenase-like protein                 259   3e-80    
ref|WP_015175278.1|  Glycine dehydrogenase (decarboxylating)            268   3e-80    Oscillatoria nigro-viridis
ref|WP_020531529.1|  glycine dehydrogenase                              268   4e-80    Flexithrix dorotheae
ref|WP_020769690.1|  glycine dehydrogenase                              268   4e-80    Leptospira sp. B5-022
ref|WP_027401604.1|  glycine dehydrogenase                              268   4e-80    Aphanizomenon flos-aquae
ref|WP_039200768.1|  glycine dehydrogenase                              268   4e-80    Aphanizomenon flos-aquae
ref|WP_017320159.1|  glycine dehydrogenase                              268   5e-80    cyanobacterium PCC 7702
ref|WP_011584413.1|  glycine dehydrogenase                              268   5e-80    Cytophaga hutchinsonii
ref|WP_026721410.1|  glycine dehydrogenase                              268   5e-80    Fischerella sp. PCC 9431
ref|XP_009955956.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    254   6e-80    Leptosomus discolor
ref|WP_016550019.1|  glycine dehydrogenase                              267   7e-80    Leptospira fainei
ref|WP_017319421.1|  glycine dehydrogenase                              267   8e-80    
gb|KIJ83529.1|  glycine dehydrogenase                                   267   8e-80    Scytonema tolypothrichoides VB-61278
ref|WP_027255179.1|  glycine dehydrogenase                              267   9e-80    Planktothrix agardhii
ref|WP_043938103.1|  glycine dehydrogenase                              266   1e-79    
ref|WP_026795376.1|  MULTISPECIES: glycine dehydrogenase                266   1e-79    Planktothrix
ref|WP_017309685.1|  glycine dehydrogenase                              266   1e-79    Fischerella sp. PCC 9339
ref|WP_027846740.1|  glycine dehydrogenase                              266   1e-79    Mastigocoleus testarum
ref|WP_026796741.1|  glycine dehydrogenase                              266   1e-79    Planktothrix rubescens
ref|WP_012627655.1|  glycine dehydrogenase                              266   1e-79    Cyanothece sp. PCC 7425
ref|WP_021263190.1|  hypothetical protein                               248   1e-79    
ref|WP_042157536.1|  glycine dehydrogenase                              266   1e-79    
ref|WP_026752074.1|  glycine dehydrogenase                              266   2e-79    Sediminibacterium sp. C3
ref|WP_041226533.1|  glycine dehydrogenase                              266   2e-79    
gb|AFZ12851.1|  Glycine dehydrogenase (decarboxylating)                 266   2e-79    Crinalium epipsammum PCC 9333
ref|WP_041919296.1|  glycine dehydrogenase                              266   2e-79    
gb|AFZ32122.1|  Glycine dehydrogenase (decarboxylating)                 266   2e-79    Gloeocapsa sp. PCC 7428
dbj|BAB26854.1|  unnamed protein product                                247   2e-79    Mus musculus [mouse]
ref|WP_019487125.1|  glycine dehydrogenase                              266   2e-79    Kamptonema formosum
ref|WP_010571257.1|  glycine dehydrogenase                              266   2e-79    Leptospira broomii
ref|WP_008590214.1|  glycine dehydrogenase                              265   3e-79    Leptospira licerasiae
ref|WP_026103942.1|  glycine dehydrogenase                              266   3e-79    Anabaena sp. PCC 7108
ref|XP_009699383.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    255   3e-79    Cariama cristata
ref|WP_043507924.1|  glycine dehydrogenase                              248   3e-79    
ref|WP_039743276.1|  glycine dehydrogenase                              266   3e-79    
ref|WP_021833182.1|  Glycine dehydrogenase [decarboxylating] (gly...    246   3e-79    
ref|WP_015081132.1|  glycine dehydrogenase                              265   3e-79    Anabaena sp. 90
gb|KFF35033.1|  hypothetical protein G039_0311865                       247   4e-79    Pseudomonas aeruginosa VRFPA01
ref|WP_039895601.1|  glycine dehydrogenase                              265   4e-79    
gb|EAW38056.1|  glycine dehydrogenase                                   265   5e-79    Lyngbya sp. PCC 8106
ref|WP_031770429.1|  glycine dehydrogenase                              248   6e-79    
ref|WP_015182831.1|  glycine dehydrogenase, decarboxylating             265   6e-79    Microcoleus sp. PCC 7113
ref|WP_006972317.1|  glycine dehydrogenase                              265   6e-79    Plesiocystis pacifica
ref|WP_019497275.1|  glycine dehydrogenase                              265   7e-79    Calothrix sp. PCC 7103
gb|KGB84088.1|  glycine dehydrogenase                                   246   7e-79    Pseudomonas aeruginosa
ref|WP_033886039.1|  glycine dehydrogenase                              248   8e-79    
ref|WP_026736448.1|  glycine dehydrogenase                              264   8e-79    Fischerella sp. PCC 9605
dbj|GAM17937.1|  hypothetical protein SAMD00019534_011120               265   9e-79    Acytostelium subglobosum LB1
ref|WP_027250002.1|  glycine dehydrogenase                              264   9e-79    
ref|XP_001420206.1|  predicted protein                                  264   1e-78    Ostreococcus lucimarinus CCE9901
ref|WP_033335677.1|  glycine dehydrogenase                              264   1e-78    
ref|WP_015130859.1|  glycine dehydrogenase                              264   1e-78    Calothrix sp. PCC 7507
ref|WP_015198875.1|  glycine dehydrogenase                              264   1e-78    Calothrix parietina
ref|WP_009149788.1|  glycine dehydrogenase                              264   1e-78    Moorea producens
ref|WP_029637128.1|  glycine dehydrogenase [                            264   1e-78    
ref|WP_016861897.1|  glycine dehydrogenase                              263   1e-78    Fischerella muscicola
ref|WP_010415806.1|  glycine dehydrogenase                              263   1e-78    Leptospira inadai
ref|WP_015212883.1|  Glycine dehydrogenase (decarboxylating)            263   1e-78    Anabaena cylindrica
ref|WP_011057442.1|  glycine dehydrogenase                              263   1e-78    Thermosynechococcus elongatus
ref|WP_012410110.1|  glycine dehydrogenase                              263   2e-78    Nostoc punctiforme
ref|WP_011319516.1|  glycine dehydrogenase                              263   2e-78    Trichormus variabilis
ref|WP_017289075.1|  glycine dehydrogenase                              263   2e-78    Leptolyngbya boryana
ref|WP_013193021.1|  glycine dehydrogenase                              263   2e-78    Trichormus azollae
ref|WP_026763335.1|  glycine dehydrogenase                              263   2e-78    Sediminibacterium salmoneum
ref|WP_019017579.1|  glycine dehydrogenase                              263   2e-78    Halomonas lutea
ref|XP_008944450.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    253   3e-78    Merops nubicus
ref|WP_042991755.1|  hypothetical protein                               245   3e-78    
ref|WP_015119530.1|  glycine dehydrogenase, decarboxylating             263   3e-78    Rivularia sp. PCC 7116
ref|WP_028088591.1|  glycine dehydrogenase                              262   3e-78    Dolichospermum circinale
ref|XP_009575710.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    252   3e-78    Fulmarus glacialis
ref|WP_043391215.1|  glycine dehydrogenase                              262   3e-78    Archangium violaceum
ref|WP_015163334.1|  glycine dehydrogenase                              263   4e-78    Pseudanabaena sp. PCC 7367
ref|XP_008334138.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    253   4e-78    
ref|WP_015145532.1|  glycine dehydrogenase, decarboxylating             262   4e-78    Pleurocapsa minor
ref|WP_010572852.1|  glycine dehydrogenase                              262   4e-78    Leptospira kmetyi
gb|AFY75171.1|  glycine dehydrogenase, decarboxylating                  262   4e-78    Synechococcus sp. PCC 7502
gb|KIE11464.1|  glycine dehydrogenase                                   262   4e-78    Tolypothrix bouteillei VB521301
ref|WP_041430269.1|  glycine dehydrogenase                              262   5e-78    
ref|WP_015349077.1|  glycine dehydrogenase                              262   5e-78    Myxococcus stipitatus
ref|XP_637330.1|  glycine dehydrogenase                                 262   5e-78    Dictyostelium discoideum AX4
emb|CCH66233.1|  Glycine dehydrogenase [decarboxylating] (glycine...    262   7e-78    Richelia intracellularis HH01
emb|CCH65953.1|  Glycine dehydrogenase [decarboxylating] (glycine...    261   7e-78    Richelia intracellularis HM01
ref|WP_044304265.1|  glycine dehydrogenase                              262   7e-78    Richelia intracellularis
ref|WP_044260453.1|  glycine dehydrogenase                              261   7e-78    
ref|WP_002627258.1|  Glycine dehydrogenase [decarboxylating] (gly...    261   7e-78    Cystobacter fuscus
ref|WP_032826728.1|  glycine dehydrogenase                              245   7e-78    
ref|WP_022960455.1|  glycine dehydrogenase                              261   8e-78    Spongiibacter tropicus
ref|WP_015115551.1|  glycine dehydrogenase (decarboxylating) beta...    261   9e-78    Nostoc sp. PCC 7107
ref|XP_007510359.1|  glycine dehydrogenase                              261   1e-77    Bathycoccus prasinos
ref|XP_010723944.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    259   1e-77    
ref|WP_004439320.1|  glycine dehydrogenase                              261   1e-77    Leptospira noguchii
ref|WP_004497226.1|  glycine dehydrogenase                              261   1e-77    Leptospira weilii
ref|XP_010204576.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   1e-77    Colius striatus
ref|WP_004501078.1|  glycine dehydrogenase                              261   1e-77    Leptospira weilii
ref|WP_004499426.1|  glycine dehydrogenase                              261   1e-77    Leptospira weilii
ref|WP_044874555.1|  hypothetical protein                               244   1e-77    
ref|WP_024124666.1|  glycine dehydrogenase [decarboxylating] GcvP       261   1e-77    Thermosynechococcus sp. NK55a
ref|WP_002616019.1|  glycine dehydrogenase                              261   1e-77    Leptospira weilii
ref|WP_004503349.1|  glycine dehydrogenase                              261   1e-77    Leptospira weilii
ref|WP_020782916.1|  glycine dehydrogenase                              261   2e-77    Leptospira sp. P2653
ref|WP_001089334.1|  glycine dehydrogenase                              261   2e-77    Leptospira interrogans
ref|WP_028083847.1|  glycine dehydrogenase                              260   2e-77    Dolichospermum circinale
ref|WP_039713483.1|  glycine dehydrogenase                              260   2e-77    
ref|WP_027284971.1|  glycine dehydrogenase                              260   3e-77    Rubritepida flocculans
ref|WP_003001920.1|  glycine dehydrogenase                              260   3e-77    Leptospira weilii
gb|AFY60495.1|  glycine dehydrogenase, decarboxylating                  260   3e-77    Synechococcus sp. PCC 6312
gb|AID49398.1|  mitochondrial glycine dehydrogenase                     239   3e-77    Panax ginseng [Asiatic ginseng]
ref|WP_002179931.1|  glycine dehydrogenase                              260   3e-77    Leptospira noguchii
ref|WP_017213857.1|  glycine dehydrogenase                              260   3e-77    
ref|XP_003390802.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    253   3e-77    
ref|WP_041431238.1|  glycine dehydrogenase                              260   3e-77    
ref|XP_001507722.2|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   3e-77    
ref|XP_003510272.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    255   3e-77    
gb|AID49400.1|  mitochondrial glycine dehydrogenase                     239   3e-77    
ref|WP_035563762.1|  glycine dehydrogenase                              259   4e-77    
ref|WP_011614237.1|  glycine dehydrogenase                              259   4e-77    
ref|WP_015171139.1|  glycine dehydrogenase subunit alpha/beta           259   5e-77    
ref|WP_017008390.1|  glycine dehydrogenase                              259   5e-77    
ref|WP_013939616.1|  glycine dehydrogenase                              259   5e-77    
ref|WP_015227846.1|  glycine dehydrogenase, decarboxylating             259   5e-77    
ref|WP_004452658.1|  glycine dehydrogenase                              259   6e-77    
ref|WP_004451582.1|  glycine dehydrogenase                              259   6e-77    
dbj|BAK62095.1|  glycine dehydrogenase [decarboxylating], mitocho...    248   6e-77    
ref|WP_004447455.1|  glycine dehydrogenase                              259   6e-77    
ref|WP_020402760.1|  glycine dehydrogenase                              259   6e-77    
ref|WP_004419733.1|  glycine dehydrogenase                              259   6e-77    
ref|XP_007440133.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    258   6e-77    
ref|WP_014397794.1|  glycine dehydrogenase                              259   7e-77    
ref|WP_002538646.1|  Glycine dehydrogenase                              259   7e-77    
ref|WP_008055246.1|  hypothetical protein                               241   8e-77    
ref|WP_015813524.1|  glycine dehydrogenase                              259   8e-77    
ref|XP_004359501.1|  glycine dehydrogenase                              259   8e-77    
ref|WP_044206069.1|  glycine dehydrogenase                              259   8e-77    
ref|WP_016415071.1|  glycine dehydrogenase                              258   8e-77    
ref|WP_008545393.1|  glycine dehydrogenase                              258   9e-77    
ref|WP_027001579.1|  glycine dehydrogenase                              258   9e-77    
gb|EDX77003.1|  glycine dehydrogenase                                   259   9e-77    
ref|WP_015225454.1|  glycine dehydrogenase (decarboxylating) beta...    258   9e-77    
ref|XP_005015417.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    258   9e-77    
ref|WP_029313377.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_019596339.1|  glycine dehydrogenase                              258   1e-76    
ref|XP_009869925.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    258   1e-76    
ref|XP_009934335.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    258   1e-76    
gb|EOQ89615.1|  glycine dehydrogenase                                   258   1e-76    
ref|XP_009816061.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   1e-76    
dbj|GAL03187.1|  glycine dehydrogenase                                  240   1e-76    
ref|WP_010628682.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_000663146.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_010323338.1|  glycine dehydrogenase                              258   1e-76    
ref|XP_005702688.1|  glycine dehydrogenase                              256   1e-76    
ref|WP_039928551.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_038029267.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_044106198.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089341.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089346.1|  glycine dehydrogenase                              258   1e-76    
ref|XP_009924265.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   1e-76    
ref|WP_001089345.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_017015362.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089356.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_028022040.1|  glycine dehydrogenase                              258   1e-76    
gb|AJR12912.1|  glycine dehydrogenase                                   258   1e-76    
ref|WP_015220113.1|  glycine dehydrogenase (decarboxylating) beta...    258   1e-76    
ref|WP_036093294.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089339.1|  glycine dehydrogenase                              258   1e-76    
ref|XP_009869926.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    257   1e-76    
ref|WP_001089338.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089354.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089352.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_017853790.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_002106132.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089359.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089343.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089350.1|  glycine dehydrogenase                              258   1e-76    
gb|EMF81634.1|  glycine dehydrogenase                                   258   1e-76    
ref|WP_001089342.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089351.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089336.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089355.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_002101413.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089357.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_002121772.1|  glycine dehydrogenase                              258   1e-76    
ref|WP_001089340.1|  glycine dehydrogenase                              258   2e-76    
gb|KFP90011.1|  hypothetical protein N311_05525                         257   2e-76    
ref|WP_011553098.1|  glycine dehydrogenase                              258   2e-76    
ref|WP_001089349.1|  glycine dehydrogenase                              258   2e-76    
ref|WP_001089347.1|  glycine dehydrogenase                              258   2e-76    
ref|XP_011175829.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    258   2e-76    
ref|WP_001089335.1|  glycine dehydrogenase                              258   2e-76    
ref|WP_033044682.1|  glycine dehydrogenase                              240   2e-76    
ref|WP_029456180.1|  glycine dehydrogenase                              258   2e-76    
ref|XP_009502061.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    257   2e-76    
ref|WP_028260881.1|  glycine dehydrogenase                              258   2e-76    
ref|WP_019941473.1|  glycine dehydrogenase                              258   2e-76    
ref|WP_017852063.1|  glycine dehydrogenase                              258   2e-76    
ref|XP_005425639.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    257   2e-76    
gb|EFZ21248.1|  hypothetical protein SINV_03018                         257   2e-76    
ref|XP_005425638.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    257   2e-76    
ref|XP_006018433.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    258   2e-76    
ref|XP_008539869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    251   2e-76    
ref|XP_005352188.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    258   2e-76    
ref|WP_004428948.1|  glycine dehydrogenase                              258   2e-76    
ref|XP_006268968.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    258   2e-76    
ref|XP_010391188.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   2e-76    
ref|WP_006980349.1|  glycine dehydrogenase                              257   2e-76    
ref|WP_043999766.1|  glycine dehydrogenase                              258   2e-76    
emb|CEF99477.1|  Pyridoxal phosphate-dependent transferase, major...    258   2e-76    
ref|XP_010286979.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   3e-76    
emb|CCI15528.1|  Glycine cleavage system P-protein (glycine dehyd...    258   3e-76    
ref|WP_043225771.1|  glycine dehydrogenase                              239   3e-76    
ref|XP_010286980.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   3e-76    
ref|XP_009636514.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   3e-76    
ref|XP_009998946.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   3e-76    
ref|XP_009901190.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    257   3e-76    
ref|WP_025553731.1|  hypothetical protein                               240   3e-76    
ref|XP_007902171.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    257   3e-76    
ref|XP_009326324.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   3e-76    
gb|EVT85785.1|  glycine dehydrogenase                                   248   3e-76    
ref|WP_044523300.1|  glycine dehydrogenase                              257   3e-76    
ref|WP_025621559.1|  hypothetical protein                               240   3e-76    
sp|Q8YNF9.1|GCSP_NOSS1  RecName: Full=Glycine dehydrogenase (deca...    257   3e-76    
ref|WP_008198699.1|  glycine dehydrogenase                              257   3e-76    
ref|XP_007062689.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    257   3e-76    
ref|XP_008539868.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    252   3e-76    
ref|XP_009272544.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   3e-76    
ref|WP_036795682.1|  glycine dehydrogenase                              257   3e-76    
ref|XP_008539867.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    252   3e-76    
ref|XP_006117910.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    256   3e-76    
ref|XP_009888966.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   3e-76    
ref|XP_005060945.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    257   4e-76    
gb|EPR71506.1|  Glycine dehydrogenase [decarboxylating] (glycine ...    256   4e-76    
ref|WP_042751943.1|  glycine dehydrogenase                              257   4e-76    
ref|WP_001089344.1|  glycine dehydrogenase                              257   4e-76    
ref|WP_001089348.1|  glycine dehydrogenase                              257   4e-76    
ref|WP_001089353.1|  glycine dehydrogenase                              257   4e-76    
gb|KIG16915.1|  Glycine dehydrogenase                                   257   4e-76    
ref|WP_007659102.1|  glycine dehydrogenase                              255   4e-76    
ref|WP_002130962.1|  glycine dehydrogenase                              257   4e-76    
ref|WP_002080557.1|  glycine dehydrogenase                              257   4e-76    
ref|WP_001089337.1|  glycine dehydrogenase                              257   4e-76    
ref|WP_017858293.1|  glycine dehydrogenase                              257   4e-76    
gb|AAD56281.1|AF137264_1  glycine decarboxylase p protein               257   4e-76    
dbj|GAL33351.1|  glycine dehydrogenase                                  239   4e-76    
ref|WP_029811212.1|  glycine dehydrogenase                              241   4e-76    
ref|WP_044202817.1|  glycine dehydrogenase                              257   4e-76    
ref|XP_009473192.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   4e-76    
ref|WP_024546130.1|  glycine dehydrogenase                              256   4e-76    
ref|XP_009097244.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   4e-76    
ref|XP_010118639.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   4e-76    
ref|WP_002107619.1|  glycine dehydrogenase                              256   4e-76    
ref|XP_010157866.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   4e-76    
ref|XP_009097243.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   5e-76    
ref|WP_016752735.1|  glycine dehydrogenase                              256   5e-76    
ref|XP_005443683.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    256   5e-76    
ref|WP_020779518.1|  glycine dehydrogenase                              256   5e-76    
ref|XP_009077461.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    255   5e-76    
ref|XP_011068230.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    257   5e-76    
ref|WP_020763306.1|  glycine dehydrogenase                              256   5e-76    
ref|WP_004778628.1|  glycine dehydrogenase                              256   5e-76    
ref|WP_004767017.1|  glycine dehydrogenase                              256   5e-76    
ref|WP_004754400.1|  glycine dehydrogenase                              256   5e-76    
ref|XP_005443682.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    256   5e-76    
ref|WP_037356834.1|  glycine dehydrogenase                              256   5e-76    
ref|WP_011163253.1|  glycine dehydrogenase                              256   5e-76    
ref|WP_031772836.1|  glycine dehydrogenase                              250   5e-76    
ref|WP_020766118.1|  glycine dehydrogenase                              256   5e-76    
ref|XP_011403739.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   5e-76    
ref|XP_010584356.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   5e-76    
ref|XP_006609844.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    255   6e-76    
ref|XP_005716298.1|  glycine dehydrogenase (decarboxylating), mit...    257   6e-76    
ref|WP_014560840.1|  glycine dehydrogenase                              256   6e-76    
gb|EGI69417.1|  Glycine dehydrogenase [decarboxylating], mitochon...    256   6e-76    
ref|XP_009965224.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    255   6e-76    
gb|KEF58987.1|  glycine dehydrogenase                                   257   6e-76    
ref|WP_031528933.1|  glycine dehydrogenase                              256   6e-76    
gb|ELS47332.1|  glycine dehydrogenase                                   256   6e-76    
ref|XP_005241663.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    255   7e-76    
ref|WP_043996308.1|  glycine dehydrogenase                              256   7e-76    
ref|WP_006527089.1|  glycine dehydrogenase, decarboxylating             256   7e-76    
ref|WP_020775241.1|  glycine dehydrogenase                              256   7e-76    
ref|WP_024285047.1|  glycine dehydrogenase                              256   7e-76    
ref|XP_005241664.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    255   7e-76    
ref|WP_017652835.1|  glycine dehydrogenase                              256   7e-76    
ref|XP_008630804.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   7e-76    
emb|CCI02130.1|  Glycine cleavage system P-protein (glycine dehyd...    256   7e-76    
ref|WP_004769189.1|  glycine dehydrogenase                              256   7e-76    
ref|XP_008494472.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    255   7e-76    
ref|WP_004763371.1|  glycine dehydrogenase                              256   8e-76    
ref|WP_004758071.1|  glycine dehydrogenase                              256   8e-76    
ref|WP_009187084.1|  glycine dehydrogenase                              256   8e-76    
ref|WP_004781178.1|  glycine dehydrogenase                              256   8e-76    
ref|WP_036401293.1|  glycine dehydrogenase                              256   8e-76    
ref|WP_023854948.1|  glycine dehydrogenase, decarboxylating             256   8e-76    
ref|WP_008624248.1|  Glycine dehydrogenase                              256   8e-76    
gb|AFY00368.1|  glycine dehydrogenase                                   256   8e-76    
ref|WP_029453644.1|  glycine dehydrogenase                              256   8e-76    
ref|XP_008919878.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   8e-76    
gb|EDL41699.1|  glycine decarboxylase, isoform CRA_b                    244   8e-76    
ref|XP_009569917.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    255   8e-76    
ref|XP_003762187.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    256   9e-76    
ref|XP_005499825.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    255   9e-76    
ref|XP_004072176.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   9e-76    
ref|WP_026638871.1|  glycine dehydrogenase                              256   9e-76    
ref|WP_014217230.1|  glycine dehydrogenase                              256   9e-76    
ref|WP_026945428.1|  glycine dehydrogenase                              256   9e-76    
ref|WP_041576958.1|  glycine dehydrogenase                              256   1e-75    
ref|XP_005538536.1|  glycine dehydrogenase, mitochondrial precursor     256   1e-75    
ref|XP_011251794.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    256   1e-75    
dbj|GAK83153.1|  glycine dehydrogenase                                  239   1e-75    
gb|EFN74714.1|  Glycine dehydrogenase [decarboxylating], mitochon...    256   1e-75    
ref|XP_005488208.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    256   1e-75    
ref|XP_002194693.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    256   1e-75    
ref|XP_005522737.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    256   1e-75    
ref|WP_015956701.1|  glycine dehydrogenase                              256   1e-75    
ref|WP_010577155.1|  glycine dehydrogenase                              255   1e-75    
ref|XP_005522738.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    256   1e-75    
ref|WP_004161677.1|  glycine dehydrogenase                              256   1e-75    
ref|WP_038015182.1|  glycine dehydrogenase                              255   1e-75    
gb|EQA63776.1|  glycine dehydrogenase                                   255   1e-75    
ref|NP_989653.1|  glycine dehydrogenase (decarboxylating), mitoch...    256   1e-75    
ref|XP_005488209.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    256   1e-75    
ref|WP_033563801.1|  glycine dehydrogenase                              255   1e-75    
ref|WP_035151567.1|  glycine dehydrogenase                              255   1e-75    
dbj|GAL16095.1|  glycine dehydrogenase                                  241   1e-75    
ref|WP_015157279.1|  glycine dehydrogenase subunit alpha/beta           255   1e-75    
ref|WP_026850038.1|  glycine dehydrogenase                              255   1e-75    
emb|CDQ32736.1|  Glycine dehydrogenase [decarboxylating]                255   1e-75    
ref|WP_002988516.1|  glycine dehydrogenase                              255   2e-75    
ref|WP_002639796.1|  glycine dehydrogenase                              255   2e-75    
ref|WP_036859587.1|  glycine dehydrogenase                              255   2e-75    



>gb|KJB65560.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=1047

 Score =   383 bits (983),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 186/194 (96%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  854   SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  913

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIA+IE GK DI+N
Sbjct  914   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAEIENGKADIHN  973

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMADAWTKPYSREYAAFPA WL+TAKFWPTTGRVDNVYGDRN+ICTLL
Sbjct  974   NVLKGAPHPPSLLMADAWTKPYSREYAAFPASWLRTAKFWPTTGRVDNVYGDRNVICTLL  1033

Query  45    PVSQMVEDEAAASA  4
             PVSQMVE+ AAA+A
Sbjct  1034  PVSQMVEEAAAANA  1047



>gb|KHG00684.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1047

 Score =   382 bits (982),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 186/194 (96%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  854   SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  913

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIA+IE GK DI+N
Sbjct  914   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAEIENGKADIHN  973

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMADAWTKPYSREYAAFPA WL+TAKFWPTTGRVDNVYGDRN+ICTLL
Sbjct  974   NVLKGAPHPPSLLMADAWTKPYSREYAAFPASWLRTAKFWPTTGRVDNVYGDRNVICTLL  1033

Query  45    PVSQMVEDEAAASA  4
             PVSQMVE+ AAA+A
Sbjct  1034  PVSQMVEEAAAANA  1047



>gb|KJB54687.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1050

 Score =   381 bits (978),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YPVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVA
Sbjct  857   SKGLTDASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVA  916

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIE GK DI+N
Sbjct  917   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIENGKADIHN  976

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPY+REYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLL
Sbjct  977   NVLKGAPHPPSLLMGDAWTKPYTREYAAFPASWLRTAKFWPTTGRVDNVYGDRNLICTLL  1036

Query  45    PVSQMVEDEAAASA  4
             PVSQMVE+EAAA+A
Sbjct  1037  PVSQMVEEEAAANA  1050



>gb|KHG06307.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1028

 Score =   379 bits (973),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YPVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVA
Sbjct  835   SKGLTDASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVA  894

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIE GK DI+N
Sbjct  895   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIENGKADIHN  954

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPY+REYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLL
Sbjct  955   NVLKGAPHPPSLLMGDAWTKPYTREYAAFPASWLRTAKFWPTTGRVDNVYGDRNLICTLL  1014

Query  45    PVSQMVEDEAAASA  4
             PVSQMVE+EAAA+A
Sbjct  1015  PVSQMVEEEAAANA  1028



>ref|XP_009620998.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana tomentosiformis]
Length=1043

 Score =   379 bits (973),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVA
Sbjct  850   SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVA  909

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  DINN
Sbjct  910   KRLIDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADINN  969

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPS+LMADAW KPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTLL
Sbjct  970   NVLKGAPHPPSMLMADAWVKPYSREYAAFPAPWLRNAKFWPTTARVDNVYGDRNLICTLL  1029

Query  45    PVSQMVEDEAAASA  4
             PVSQMVE+EAAA+A
Sbjct  1030  PVSQMVEEEAAANA  1043



>ref|XP_007012280.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
 gb|EOY29899.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
Length=1050

 Score =   378 bits (970),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFI+DLR FKNTAGIE EDVA
Sbjct  857   SKGLTEASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIVDLRAFKNTAGIEPEDVA  916

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIE GK DI+N
Sbjct  917   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIENGKADIHN  976

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL+TAKFWPTTGRVDNVYGDRN+ICTLL
Sbjct  977   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRTAKFWPTTGRVDNVYGDRNVICTLL  1036

Query  45    PVSQMVEDEAAASA  4
             PV+QMVE+EAAA+A
Sbjct  1037  PVTQMVEEEAAANA  1050



>ref|XP_003544533.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1059

 Score =   378 bits (970),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 184/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  866   SKGLTDASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  925

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKGK DINN
Sbjct  926   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGKVDINN  985

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMADAWTKPYSREYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLL
Sbjct  986   NVLKGAPHPPSLLMADAWTKPYSREYAAFPAPWLRTAKFWPTTGRVDNVYGDRNLICTLL  1045

Query  45    PVSQMVEDEAAASA  4
             P SQ VE++AAA+A
Sbjct  1046  PASQAVEEQAAATA  1059



>ref|XP_009797115.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana sylvestris]
Length=1046

 Score =   377 bits (967),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGT AHEFIIDLRGFK+TAGIE EDVA
Sbjct  853   SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKSTAGIEPEDVA  912

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  DINN
Sbjct  913   KRLIDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADINN  972

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPS+LMADAW KPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTLL
Sbjct  973   NVLKGAPHPPSMLMADAWVKPYSREYAAFPAPWLRNAKFWPTTARVDNVYGDRNLICTLL  1032

Query  45    PVSQMVEDEAAASA  4
             PVSQMVE+EAAA+A
Sbjct  1033  PVSQMVEEEAAANA  1046



>ref|XP_010262151.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nelumbo nucifera]
Length=1043

 Score =   376 bits (965),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL +ASKIAILNANYMAKRLE HYP+LFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  850   SGGLTEASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  909

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA IE GK DINN
Sbjct  910   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIALIENGKADINN  969

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMADAWTKPYSREYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLL
Sbjct  970   NVLKGAPHPPSLLMADAWTKPYSREYAAFPASWLRTAKFWPTTGRVDNVYGDRNLICTLL  1029

Query  45    PVSQMVEDEAAASA  4
             P SQ+VE++AAA+A
Sbjct  1030  PASQVVEEQAAATA  1043



>emb|CBI20667.3| unnamed protein product [Vitis vinifera]
Length=695

 Score =   367 bits (942),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 182/194 (94%), Gaps = 1/194 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL DASKIAILNANYMAKRLEKHYP+LFRGVNGTVAHEFI+DLRGFKNTAGIE ED+A
Sbjct  503  SKGLTDASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDIA  562

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIAQIE GK D++N
Sbjct  563  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAQIENGKADVHN  622

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APHPPSLLM D WTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLL
Sbjct  623  NVLKGAPHPPSLLMGDTWTKPYSREYAAFPAPWLRVAKFWPTTGRVDNVYGDRNLICTLL  682

Query  45   PVSQMVEDEAAASA  4
            P SQ +E++AAA+A
Sbjct  683  PASQ-IEEQAAATA  695



>ref|XP_004245101.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Solanum lycopersicum]
Length=1036

 Score =   374 bits (960),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAIL+ANYMAKRLEKHYPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVA
Sbjct  844   SKGLTDASKIAILSANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVA  903

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  DINN
Sbjct  904   KRLIDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNVDINN  963

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPS+LMADAWTKPYSREYAA+PA WL++AKFWPTTGRVDNVYGDRNLICTLL
Sbjct  964   NVLKGAPHPPSMLMADAWTKPYSREYAAYPAPWLRSAKFWPTTGRVDNVYGDRNLICTLL  1023

Query  45    PVSQMVEDEAAAS  7
             PVS+M E++AA +
Sbjct  1024  PVSEMAEEKAATA  1036



>sp|O49954.1|GCSP_SOLTU RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Solanum 
tuberosum]
 emb|CAB16918.1| P-Protein precursor [Solanum tuberosum]
Length=1035

 Score =   374 bits (959),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAIL+ANYMAKRLEKHYPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVA
Sbjct  843   SKGLTDASKIAILSANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVA  902

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  DINN
Sbjct  903   KRLIDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNVDINN  962

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPS+LMADAWTKPYSREYAA+PA WL++AKFWPTTGRVDNVYGDRNLICTLL
Sbjct  963   NVLKGAPHPPSMLMADAWTKPYSREYAAYPAPWLRSAKFWPTTGRVDNVYGDRNLICTLL  1022

Query  45    PVSQMVEDEAAAS  7
             PVS+M E++AA +
Sbjct  1023  PVSEMAEEKAATA  1035



>gb|AEP95746.1| glycine decarboxylase complex subunit P [Cicer arietinum]
Length=264

 Score =   350 bits (898),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            SQGL DASKIAILNANYMAKRLE +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  85   SQGLTDASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  144

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA++EKG  DI+N
Sbjct  145  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAEVEKGNADIHN  204

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLL
Sbjct  205  NVLKGAPHPPSLLMADAWTKPYSREYAAFPAAWLRVAKFWPTTGRVDNVYGDRNLICTLL  264



>ref|XP_011081684.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1037

 Score =   373 bits (957),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 174/185 (94%), Positives = 178/185 (96%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  844   SKGLTEASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  903

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIA IEKGK DI+N
Sbjct  904   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIALIEKGKADIHN  963

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD WTKPYSREYAA+PA WLKTAKFWPTTGRVDNVYGDRNLICTLL
Sbjct  964   NVLKGAPHPPSLLMADVWTKPYSREYAAYPAAWLKTAKFWPTTGRVDNVYGDRNLICTLL  1023

Query  45    PVSQM  31
             PVSQM
Sbjct  1024  PVSQM  1028



>ref|XP_003550270.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
 gb|KHN37032.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1056

 Score =   372 bits (956),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 183/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  863   SKGLTDASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  922

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  DINN
Sbjct  923   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNADINN  982

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK+APHPPSLLMADAWTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLL
Sbjct  983   NVLKSAPHPPSLLMADAWTKPYSREYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLL  1042

Query  45    PVSQMVEDEAAASA  4
             P SQ VE++AAA+A
Sbjct  1043  PASQAVEEQAAATA  1056



>dbj|BAD81531.1| P protein-like [Oryza sativa Japonica Group]
 dbj|BAD82266.1| P protein-like [Oryza sativa Japonica Group]
Length=197

 Score =   347 bits (889),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  4    SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  63

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NN
Sbjct  64   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNN  123

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK+APHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  124  NVLKSAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  183

Query  45   PVSQM  31
              SQ+
Sbjct  184  QGSQV  188



>gb|AEP95751.1| glycine decarboxylase complex subunit P [Cicer arietinum]
Length=274

 Score =   349 bits (895),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            SQGL DASKIAILNANYMAKRLE +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  96   SQGLTDASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  155

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA++EKG  DI+N
Sbjct  156  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAEVEKGNADIHN  215

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  49
            NVLK APHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL
Sbjct  216  NVLKGAPHPPSLLMADAWTKPYSREYAAFPAAWLRVAKFWPTTGRVDNVYGDRNLICTL  274



>ref|XP_011097886.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1071

 Score =   372 bits (955),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/187 (93%), Positives = 179/187 (96%), Gaps = 0/187 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  846   SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  905

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDR+CD LISIREEIA IEKGK DI+N
Sbjct  906   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRYCDALISIREEIAMIEKGKADIHN  965

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK+APHPPSLLMAD W+KPYSREYAA+PA WLKTAKFWPTTGRVDNVYGDRNLICTLL
Sbjct  966   NVLKSAPHPPSLLMADVWSKPYSREYAAYPAPWLKTAKFWPTTGRVDNVYGDRNLICTLL  1025

Query  45    PVSQMVE  25
             PVSQM E
Sbjct  1026  PVSQMAE  1032



>ref|XP_002516446.1| glycine dehydrogenase, putative [Ricinus communis]
 gb|EEF45787.1| glycine dehydrogenase, putative [Ricinus communis]
Length=1057

 Score =   371 bits (952),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL DASKIAILNANYMAKRLE +YPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVA
Sbjct  864   SQGLTDASKIAILNANYMAKRLENYYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVA  923

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D++N
Sbjct  924   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIENGKADVHN  983

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLL
Sbjct  984   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRGAKFWPTTGRVDNVYGDRNLICTLL  1043

Query  45    PVSQMVEDEAAASA  4
             P SQ VE++AAASA
Sbjct  1044  PASQYVEEQAAASA  1057



>ref|XP_010047334.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Eucalyptus grandis]
 gb|KCW79221.1| hypothetical protein EUGRSUZ_C00646 [Eucalyptus grandis]
Length=1053

 Score =   370 bits (951),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLR FKNTAGIE EDVA
Sbjct  860   SKGLTEASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRAFKNTAGIEPEDVA  919

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGK DI+N
Sbjct  920   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKADIHN  979

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK+APHPPSLLM D+WTKPYSREYAAFPA WL+TAKFWP+TGR+DNVYGDRNL+CTL 
Sbjct  980   NVLKSAPHPPSLLMGDSWTKPYSREYAAFPASWLRTAKFWPSTGRIDNVYGDRNLVCTLQ  1039

Query  45    PVSQMVEDEAAASA  4
             P SQ+VE++AAA+A
Sbjct  1040  PTSQVVEEQAAATA  1053



>ref|XP_004498895.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X1 [Cicer arietinum]
 ref|XP_004498896.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=1114

 Score =   371 bits (953),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL DASKIAILNANYMAKRLE +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  921   SQGLTDASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  980

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA++EKG  DI+N
Sbjct  981   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAEVEKGNADIHN  1040

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL 
Sbjct  1041  NVLKGAPHPPSLLMADAWTKPYSREYAAFPAAWLRVAKFWPTTGRVDNVYGDRNLICTLQ  1100

Query  45    PVSQMVEDEAAASA  4
             P SQ VE++AAA+A
Sbjct  1101  PASQGVEEQAAATA  1114



>emb|CDP08258.1| unnamed protein product [Coffea canephora]
Length=1031

 Score =   369 bits (947),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 185/194 (95%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLE +YPVLFRGVNGTVAHEFIIDLRGFK+TAGIE EDVA
Sbjct  838   SKGLTEASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKHTAGIEPEDVA  897

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLM+EPTESESKAELDRFCD LISIREEIAQIEKGKFD++N
Sbjct  898   KRLMDYGFHGPTMSWPVPGTLMVEPTESESKAELDRFCDALISIREEIAQIEKGKFDLHN  957

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK+APHPPSLLMA+ WTKPYSREYAAFPA WL+TAKFWPTT RVDNVYGDRNL+CTLL
Sbjct  958   NVLKSAPHPPSLLMANVWTKPYSREYAAFPAPWLRTAKFWPTTERVDNVYGDRNLVCTLL  1017

Query  45    PVSQMVEDEAAASA  4
             P +Q+VE+E AA+A
Sbjct  1018  PAAQVVEEEKAATA  1031



>gb|KDP34101.1| hypothetical protein JCGZ_07672 [Jatropha curcas]
Length=1059

 Score =   369 bits (948),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL +ASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRGFKNTAGIE EDVA
Sbjct  866   SQGLTEASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVA  925

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  DINN
Sbjct  926   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNADINN  985

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM D WTKPY+REYAAFPA WL+T+KFWPTTGRVDNVYGDRNLICTLL
Sbjct  986   NVLKGAPHPPSLLMGDTWTKPYTREYAAFPASWLRTSKFWPTTGRVDNVYGDRNLICTLL  1045

Query  45    PVSQMVEDEAAASA  4
             P SQ VE++AAA+A
Sbjct  1046  PASQYVEEQAAATA  1059



>ref|XP_006361002.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Solanum tuberosum]
Length=1092

 Score =   370 bits (950),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAIL+ANYMAKRLEKHYPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVA
Sbjct  843   SKGLTDASKIAILSANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVA  902

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  DINN
Sbjct  903   KRLIDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNVDINN  962

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPS+LMADAWTKPYSREYAA+PA WL++AKFWPTTGRVDNVYGDRNLICTLL
Sbjct  963   NVLKGAPHPPSMLMADAWTKPYSREYAAYPAPWLRSAKFWPTTGRVDNVYGDRNLICTLL  1022

Query  45    PVSQMVEDE  19
             PVS+M E++
Sbjct  1023  PVSEMAEEK  1031



>emb|CAN63089.1| hypothetical protein VITISV_032016 [Vitis vinifera]
Length=1036

 Score =   369 bits (946),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 182/194 (94%), Gaps = 1/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYP+LFRGVNGTVAHEFI+DLRGFKNTAGIE ED+A
Sbjct  844   SKGLTDASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDIA  903

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIAQIE GK D++N
Sbjct  904   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAQIENGKADVHN  963

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM D WTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLL
Sbjct  964   NVLKGAPHPPSLLMGDTWTKPYSREYAAFPAPWLRVAKFWPTTGRVDNVYGDRNLICTLL  1023

Query  45    PVSQMVEDEAAASA  4
             P SQ +E++AAA+A
Sbjct  1024  PASQ-IEEQAAATA  1036



>sp|P26969.1|GCSP_PEA RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Pisum 
sativum]
 emb|CAA42443.1| P protein [Pisum sativum]
Length=1057

 Score =   369 bits (946),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL DASKIAILNANYMAKRLE +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  864   SQGLTDASKIAILNANYMAKRLESYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  923

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPV GTLMIEPTESESKAELDRFCD LISIR+EIA++EKG  D++N
Sbjct  924   KRLMDYGFHGPTMSWPVAGTLMIEPTESESKAELDRFCDALISIRKEIAEVEKGNADVHN  983

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNL+CTLL
Sbjct  984   NVLKGAPHPPSLLMADAWTKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLVCTLL  1043

Query  45    PVSQMVEDEAAASA  4
             P SQ VE++AAA+A
Sbjct  1044  PASQAVEEQAAATA  1057



>ref|XP_010648358.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1053

 Score =   368 bits (945),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 182/194 (94%), Gaps = 1/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYP+LFRGVNGTVAHEFI+DLRGFKNTAGIE ED+A
Sbjct  861   SKGLTDASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDIA  920

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIAQIE GK D++N
Sbjct  921   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAQIENGKADVHN  980

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM D WTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLL
Sbjct  981   NVLKGAPHPPSLLMGDTWTKPYSREYAAFPAPWLRVAKFWPTTGRVDNVYGDRNLICTLL  1040

Query  45    PVSQMVEDEAAASA  4
             P SQ +E++AAA+A
Sbjct  1041  PASQ-IEEQAAATA  1053



>dbj|BAD81530.1| P protein-like [Oryza sativa Japonica Group]
 dbj|BAD82265.1| P protein-like [Oryza sativa Japonica Group]
Length=294

 Score =   346 bits (887),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  101  SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  160

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NN
Sbjct  161  KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNN  220

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK+APHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  221  NVLKSAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  280

Query  45   PVSQM  31
              SQ+
Sbjct  281  QGSQV  285



>ref|XP_008220472.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Prunus mume]
Length=1054

 Score =   367 bits (942),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRGFK+TAGIE EDVA
Sbjct  861   SKGLTDASKIAILNANYMAKRLEDYYPILFRGVNGTVAHEFIVDLRGFKHTAGIEPEDVA  920

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IEKGK D++N
Sbjct  921   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIEKGKADLHN  980

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM D WTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNLICTL 
Sbjct  981   NVLKGAPHPPSLLMGDTWTKPYSREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLICTLQ  1040

Query  45    PVSQMVEDEAAASA  4
             P SQ VE++AAA+A
Sbjct  1041  PASQAVEEQAAATA  1054



>gb|ABO61734.1| mitochondrial glycine decarboxylase complex P-protein [Populus 
tremuloides]
Length=1060

 Score =   367 bits (942),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVA
Sbjct  867   SKGLTDASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGVKNTAGIEPEDVA  926

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIA+IEKGK DI+N
Sbjct  927   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAEIEKGKADIHN  986

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL
Sbjct  987   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLL  1046

Query  45    PVSQMVEDEAAASA  4
              VSQ VE++AAA+A
Sbjct  1047  SVSQTVEEQAAATA  1060



>ref|XP_003589000.1| Glycine dehydrogenase P protein [Medicago truncatula]
 gb|AES59251.1| glycine dehydrogenase [decarboxylating] protein [Medicago truncatula]
Length=1056

 Score =   366 bits (940),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVA
Sbjct  863   SKGLTDASKIAILNANYMAKRLESYYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVA  922

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D++N
Sbjct  923   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAEIEKGNADVHN  982

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWPT GRVDNVYGDRNLICTLL
Sbjct  983   NVLKGAPHPPSLLMADAWTKPYSREYAAFPAPWLRVAKFWPTNGRVDNVYGDRNLICTLL  1042

Query  45    PVSQMVEDEAAASA  4
             P SQ VE+ AAA+A
Sbjct  1043  PASQAVEEPAAATA  1056



>ref|XP_008797766.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   365 bits (938),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE HYP+LF GVNGTVAHEFI+DLRGFK TAGIE+EDVA
Sbjct  847   SKGLTDASKIAILNANYMAKRLENHYPILFCGVNGTVAHEFIVDLRGFKATAGIESEDVA  906

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NN
Sbjct  907   KRLIDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNN  966

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLL
Sbjct  967   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRGSKFWPTTGRVDNVYGDRNLICTLL  1026

Query  45    PVSQMVEDEAAASA  4
             PVSQM E+ AAA+A
Sbjct  1027  PVSQMAEEPAAATA  1040



>ref|XP_003523643.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1031

 Score =   365 bits (937),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASK AILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  838   SKGLTEASKTAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  897

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKGK DINN
Sbjct  898   KRLMDYGFHSPTMSFPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGKADINN  957

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPS+LM DAWTKPYSREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLL
Sbjct  958   NVLKCAPHPPSVLMGDAWTKPYSREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLL  1017

Query  45    PVSQMVEDEAAASA  4
             P SQ+VE++AAA+A
Sbjct  1018  PTSQVVEEQAAATA  1031



>gb|KHN29723.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1031

 Score =   365 bits (937),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 182/194 (94%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASK AILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  838   SKGLTEASKTAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  897

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKGK DINN
Sbjct  898   KRLMDYGFHSPTMSFPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGKADINN  957

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPS+LM DAWTKPYSREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLL
Sbjct  958   NVLKCAPHPPSVLMGDAWTKPYSREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLL  1017

Query  45    PVSQMVEDEAAASA  4
             P SQ+VE++AAA+A
Sbjct  1018  PTSQVVEEQAAATA  1031



>ref|XP_011019466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Populus euphratica]
Length=1060

 Score =   365 bits (938),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVA
Sbjct  867   SKGLTDASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGVKNTAGIEPEDVA  926

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IEKGK DI+N
Sbjct  927   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIEKGKADIHN  986

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL
Sbjct  987   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLL  1046

Query  45    PVSQMVEDEAAASA  4
              VSQ+VE++AAA+A
Sbjct  1047  SVSQVVEEQAAATA  1060



>gb|EYU29323.1| hypothetical protein MIMGU_mgv1a000648mg [Erythranthe guttata]
Length=1032

 Score =   365 bits (936),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 171/185 (92%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYPVLF GVNGT AHEFIIDLRGFK TAGIEAEDVA
Sbjct  839   SKGLTDASKIAILNANYMAKRLEKHYPVLFWGVNGTCAHEFIIDLRGFKTTAGIEAEDVA  898

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+ IE GK DINN
Sbjct  899   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISLIENGKADINN  958

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMADAWTKPYSREYAA+PA WLKTAKFWPTTGRVDNVYGDRNLICTLL
Sbjct  959   NVLKGAPHPPSLLMADAWTKPYSREYAAYPAAWLKTAKFWPTTGRVDNVYGDRNLICTLL  1018

Query  45    PVSQM  31
              VSQM
Sbjct  1019  SVSQM  1023



>ref|XP_010519851.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Tarenaya hassleriana]
Length=1054

 Score =   365 bits (937),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYM KRLEKH+PVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  861   SKGLTDASKIAILNANYMVKRLEKHFPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  920

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKG  DI+N
Sbjct  921   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGNADIHN  980

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM D+W+KPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTL 
Sbjct  981   NVLKGAPHPPSLLMGDSWSKPYSREYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLQ  1040

Query  45    PVSQMVEDEAAASA  4
             P +Q  E++AAA+A
Sbjct  1041  PAAQNGEEQAAATA  1054



>ref|XP_002308562.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
 gb|EEE92085.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
Length=1060

 Score =   365 bits (937),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVA
Sbjct  867   SKGLTDASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGVKNTAGIEPEDVA  926

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IEKGK DI+N
Sbjct  927   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIEKGKADIHN  986

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL
Sbjct  987   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLL  1046

Query  45    PVSQMVEDEAAASA  4
              VSQ+VE++AAA+A
Sbjct  1047  SVSQVVEEQAAATA  1060



>ref|XP_007227061.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
 gb|EMJ28260.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
Length=1039

 Score =   364 bits (935),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 181/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRGFK+TAGIE EDVA
Sbjct  846   SKGLTDASKIAILNANYMAKRLEDYYPILFRGVNGTVAHEFIVDLRGFKHTAGIEPEDVA  905

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IEKGK D++N
Sbjct  906   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIEKGKADLHN  965

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM D WTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNLICTL 
Sbjct  966   NVLKGAPHPPSLLMGDTWTKPYSREYAAFPALWLRSAKFWPTTGRVDNVYGDRNLICTLQ  1025

Query  45    PVSQMVEDEAAASA  4
             P  Q VE++AAA+A
Sbjct  1026  PAPQAVEEQAAATA  1039



>ref|XP_004159575.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Cucumis sativus]
Length=880

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL +ASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  687  SEGLTNASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKQTAGIEPEDVA  746

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK DINN
Sbjct  747  KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADINN  806

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APHPPSLLM DAWTKPYSREYAAFPA WL+ +KFWP+TGRVDNVYGDRNLICTL 
Sbjct  807  NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRASKFWPSTGRVDNVYGDRNLICTLQ  866

Query  45   PVSQMVED  22
            P +Q+VE+
Sbjct  867  PANQVVEE  874



>ref|XP_009361863.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361876.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X3 [Pyrus x bretschneideri]
Length=1049

 Score =   364 bits (934),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 182/194 (94%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRGFKNTAG+E EDVA
Sbjct  858   SKGLTDASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKNTAGVEPEDVA  917

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D++N
Sbjct  918   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADLHN  977

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL 
Sbjct  978   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQ  1037

Query  45    PVSQMVEDEAAASA  4
             P  + VE++AAA+A
Sbjct  1038  P--EAVEEQAAATA  1049



>ref|XP_008393646.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Malus domestica]
Length=1049

 Score =   363 bits (933),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 182/194 (94%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRGFKNTAG+E EDVA
Sbjct  858   SKGLTDASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKNTAGVEPEDVA  917

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D++N
Sbjct  918   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADLHN  977

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL 
Sbjct  978   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQ  1037

Query  45    PVSQMVEDEAAASA  4
             P  + VE++AAA+A
Sbjct  1038  P--EAVEEQAAATA  1049



>ref|XP_009361869.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X2 [Pyrus x bretschneideri]
Length=1049

 Score =   363 bits (932),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 182/194 (94%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRGFKNTAG+E EDVA
Sbjct  858   SKGLTDASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKNTAGVEPEDVA  917

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D++N
Sbjct  918   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADLHN  977

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL 
Sbjct  978   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQ  1037

Query  45    PVSQMVEDEAAASA  4
             P  + VE+++AA+A
Sbjct  1038  P--EAVEEQSAATA  1049



>ref|XP_008444466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Cucumis melo]
Length=1047

 Score =   363 bits (932),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 168/188 (89%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  854   SEGLTNASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKQTAGIEPEDVA  913

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK DINN
Sbjct  914   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADINN  973

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTL 
Sbjct  974   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRASKFWPTTGRVDNVYGDRNLICTLQ  1033

Query  45    PVSQMVED  22
             P +Q+VE+
Sbjct  1034  PANQVVEE  1041



>dbj|BAD81529.1| P protein-like [Oryza sativa Japonica Group]
 dbj|BAD82264.1| P protein-like [Oryza sativa Japonica Group]
Length=493

 Score =   348 bits (893),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  300  SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  359

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NN
Sbjct  360  KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNN  419

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK+APHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  420  NVLKSAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  479

Query  45   PVSQM  31
              SQ+
Sbjct  480  QGSQV  484



>gb|EYU20359.1| hypothetical protein MIMGU_mgv1a000655mg [Erythranthe guttata]
Length=1030

 Score =   362 bits (929),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 168/185 (91%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLE HYP+LFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  837   SNGLTDASKIAILNANYMAKRLEDHYPILFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  896

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLI IREEI+ IEKGK DI+N
Sbjct  897   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLILIREEISLIEKGKADIHN  956

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD WTKPYSREYAA+PA WL+TAKFWPTTGRVDNVYGDRNL+CTLL
Sbjct  957   NVLKGAPHPPSLLMADEWTKPYSREYAAYPAAWLRTAKFWPTTGRVDNVYGDRNLVCTLL  1016

Query  45    PVSQM  31
              VSQM
Sbjct  1017  SVSQM  1021



>ref|NP_001289247.1| glycine dehydrogenase (decarboxylating), mitochondrial [Pyrus 
x bretschneideri]
 gb|AHM26626.1| glycine dehydrogenase decarboxylating protein [Pyrus x bretschneideri]
Length=1049

 Score =   362 bits (930),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 182/194 (94%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRGFK+TAGIE EDVA
Sbjct  858   SKGLTDASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKSTAGIEPEDVA  917

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D++N
Sbjct  918   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADLHN  977

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL 
Sbjct  978   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQ  1037

Query  45    PVSQMVEDEAAASA  4
             P  + VE++AAA+A
Sbjct  1038  P--EAVEEQAAATA  1049



>ref|XP_010049196.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW81692.1| hypothetical protein EUGRSUZ_C03047 [Eucalyptus grandis]
Length=1053

 Score =   362 bits (929),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE ++PVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVA
Sbjct  860   SKGLTDASKIAILNANYMAKRLESYFPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVA  919

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAE+DRFCD +ISIREEIA+IEKGK DI+N
Sbjct  920   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAEMDRFCDAMISIREEIAEIEKGKADIHN  979

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSR+YAAFPA WL+T+KFWP+TGRVDNVYGDRNL CTLL
Sbjct  980   NVLKGAPHPPSLLMGDAWTKPYSRDYAAFPASWLRTSKFWPSTGRVDNVYGDRNLTCTLL  1039

Query  45    PVSQMVEDEAAASA  4
             P SQ  E+ AAA+A
Sbjct  1040  PASQYTEEPAAATA  1053



>gb|AAL24244.1| AT4g33010/F26P21_130 [Arabidopsis thaliana]
Length=694

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 174/194 (90%), Gaps = 2/194 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S GL DASKIAILNANYMAK LEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  503  SGGLTDASKIAILNANYMAKCLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  562

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ N
Sbjct  563  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQN  622

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLL
Sbjct  623  NVLKGAPHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLL  682

Query  45   PVSQMVEDEAAASA  4
            P  + V   AA SA
Sbjct  683  PEEEQV--AAAVSA  694



>ref|XP_004142925.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Cucumis sativus]
 gb|KGN62389.1| hypothetical protein Csa_2G351700 [Cucumis sativus]
Length=1046

 Score =   362 bits (928),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  853   SEGLTNASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKQTAGIEPEDVA  912

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK DINN
Sbjct  913   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADINN  972

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL+ +KFWP+TGRVDNVYGDRNLICTL 
Sbjct  973   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRASKFWPSTGRVDNVYGDRNLICTLQ  1032

Query  45    PVSQMVED  22
             P +Q+VE+
Sbjct  1033  PANQVVEE  1040



>ref|XP_004291039.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Fragaria vesca subsp. vesca]
Length=1048

 Score =   361 bits (927),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 180/194 (93%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRGFKNTAGIEAED+A
Sbjct  857   SKGLTDASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKNTAGIEAEDIA  916

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI QIEKGK DI+N
Sbjct  917   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIGQIEKGKADIHN  976

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM D W+KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNLICTL 
Sbjct  977   NVLKGAPHPPSLLMGDTWSKPYSREYAAFPASWLRSSKFWPTTGRVDNVYGDRNLICTLQ  1036

Query  45    PVSQMVEDEAAASA  4
             P  + VE+ AAA+A
Sbjct  1037  P--EPVEEAAAATA  1048



>ref|XP_003526001.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1023

 Score =   360 bits (925),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASK AILNANYMAKRLE HYPVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVA
Sbjct  830   SKGLTEASKTAILNANYMAKRLENHYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVA  889

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PVPGTLMIEPTESESK+ELDRFCD LISIR+EIA+IEKGK DINN
Sbjct  890   KRLMDYGFHSPTMSFPVPGTLMIEPTESESKSELDRFCDALISIRQEIAEIEKGKADINN  949

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPP +LM DAWTKPYSREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLL
Sbjct  950   NVLKCAPHPPPVLMGDAWTKPYSREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLL  1009

Query  45    PVSQMVEDEAAASA  4
             P SQ VE++AAA+A
Sbjct  1010  PTSQAVEEQAAATA  1023



>gb|KHN32209.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1023

 Score =   360 bits (925),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASK AILNANYMAKRLE HYPVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVA
Sbjct  830   SKGLTEASKTAILNANYMAKRLENHYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVA  889

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PVPGTLMIEPTESESK+ELDRFCD LISIR+EIA+IEKGK DINN
Sbjct  890   KRLMDYGFHSPTMSFPVPGTLMIEPTESESKSELDRFCDALISIRQEIAEIEKGKADINN  949

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPP +LM DAWTKPYSREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLL
Sbjct  950   NVLKCAPHPPPVLMGDAWTKPYSREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLL  1009

Query  45    PVSQMVEDEAAASA  4
             P SQ VE++AAA+A
Sbjct  1010  PTSQAVEEQAAATA  1023



>ref|XP_010526062.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Tarenaya hassleriana]
Length=1051

 Score =   360 bits (924),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  858   SEGLTNASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  917

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+ IEKG  DI+N
Sbjct  918   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISLIEKGNADIHN  977

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMADAW KPYSRE AAFPA WL+++KFWP+TGRVDNVYGDRNL+CTLL
Sbjct  978   NVLKGAPHPPSLLMADAWKKPYSRECAAFPAPWLRSSKFWPSTGRVDNVYGDRNLVCTLL  1037

Query  45    PVSQMVEDEAAASA  4
              VSQ+ E++AAASA
Sbjct  1038  SVSQVAEEQAAASA  1051



>gb|ADM18296.1| mitochondrial glycine decarboxylase complex P-protein-like protein 
[Nicotiana benthamiana]
Length=350

 Score =   340 bits (872),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 173/194 (89%), Gaps = 10/194 (5%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGT AHEFIIDLRGFKNTAGIE EDVA
Sbjct  167  SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVA  226

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL+DYGFHGPTMSWPVPGTLMIEPTESE          TLISIREEIA+IEKGK DI+N
Sbjct  227  KRLIDYGFHGPTMSWPVPGTLMIEPTESE----------TLISIREEIAEIEKGKADIHN  276

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APHPPSLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL
Sbjct  277  NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLL  336

Query  45   PVSQMVEDEAAASA  4
             VSQ VE++AAA+A
Sbjct  337  SVSQTVEEQAAATA  350



>ref|XP_007161011.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
 gb|ESW33005.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
Length=1062

 Score =   359 bits (921),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLE +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  869   SGGLTDASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  928

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYG+H PTMSWPVPGTLMIEPTESESKAELDRFCDTLISIR+EIA+IEKGK DINN
Sbjct  929   KRLMDYGYHAPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIRQEIAEIEKGKVDINN  988

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMADAWTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLL
Sbjct  989   NVLKGAPHPPSLLMADAWTKPYSREYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLL  1048

Query  45    P  43
             P
Sbjct  1049  P  1049



>gb|AFW56072.1| hypothetical protein ZEAMMB73_271256 [Zea mays]
Length=495

 Score =   344 bits (883),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            SQGL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLR FK TAGIE EDVA
Sbjct  300  SQGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRAFKTTAGIEPEDVA  359

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+ N
Sbjct  360  KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVLN  419

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APHPP LLM D W+KPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL 
Sbjct  420  NVLKGAPHPPQLLMGDTWSKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQ  479

Query  45   PVSQM  31
              +Q+
Sbjct  480  QATQV  484



>ref|NP_195027.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 sp|Q94B78.2|GCSP1_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 1, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 1; 
AltName: Full=Glycine decarboxylase 1; AltName: Full=Glycine 
decarboxylase P-protein 1; Short=AtGLDP1; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA21210.1| P-Protein-like protein [Arabidopsis thaliana]
 emb|CAB80018.1| P-Protein-like protein [Arabidopsis thaliana]
 gb|AAL36259.1| putative P-Protein [Arabidopsis thaliana]
 gb|AAM14125.1| putative P-protein [Arabidopsis thaliana]
 gb|AEE86159.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=1037

 Score =   358 bits (918),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  846   SGGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  905

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ N
Sbjct  906   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQN  965

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLL
Sbjct  966   NVLKGAPHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLL  1025

Query  45    PVSQMVEDEAAASA  4
             P  + V   AA SA
Sbjct  1026  PEEEQV--AAAVSA  1037



>gb|AAK68740.1| P-Protein - like protein [Arabidopsis thaliana]
 gb|AAM91322.1| P-protein-like protein [Arabidopsis thaliana]
Length=1037

 Score =   358 bits (918),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  846   SGGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  905

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ N
Sbjct  906   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQN  965

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLL
Sbjct  966   NVLKGAPHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLL  1025

Query  45    PVSQMVEDEAAASA  4
             P  + V   AA SA
Sbjct  1026  PEEEQV--TAAVSA  1037



>ref|XP_008808050.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   358 bits (918),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYP+LF GVNGTVAHEFI+DLRGFK TAGIE EDVA
Sbjct  847   SKGLTDASKIAILNANYMAKRLEKHYPILFCGVNGTVAHEFIVDLRGFKATAGIEPEDVA  906

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK DINN
Sbjct  907   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIENGKADINN  966

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NV+K APHPPS+LM D WTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLL
Sbjct  967   NVMKGAPHPPSMLMGDTWTKPYSREYAAFPASWLRGSKFWPTTGRVDNVYGDRNLICTLL  1026

Query  45    PVSQM  31
             P SQM
Sbjct  1027  PASQM  1031



>ref|XP_002867212.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43471.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
Length=1037

 Score =   357 bits (917),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  846   SGGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  905

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ N
Sbjct  906   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQN  965

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLL
Sbjct  966   NVLKGAPHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLL  1025

Query  45    PVSQMVEDEAAASA  4
             P  + V   AA SA
Sbjct  1026  PEEEQV--AAAVSA  1037



>ref|NP_180178.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
 sp|O80988.1|GCSP2_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 2, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 2; 
AltName: Full=Glycine decarboxylase 2; AltName: Full=Glycine 
decarboxylase P-protein 2; Short=AtGLDP2; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC31228.1| putative glycine dehydrogenase [Arabidopsis thaliana]
 gb|AEC07793.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
Length=1044

 Score =   356 bits (913),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 176/193 (91%), Gaps = 3/193 (2%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  852   SGGLTDASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  911

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D NN
Sbjct  912   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPNN  971

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL 
Sbjct  972   NVLKGAPHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQ  1031

Query  45    PVSQMVEDEAAAS  7
             P +   E++AAA+
Sbjct  1032  PAN---EEQAAAA  1041



>dbj|BAE98954.1| putative glycine dehydrogenase [Arabidopsis thaliana]
Length=1044

 Score =   356 bits (913),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 176/193 (91%), Gaps = 3/193 (2%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  852   SGGLTDASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  911

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D NN
Sbjct  912   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPNN  971

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL 
Sbjct  972   NVLKGAPHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQ  1031

Query  45    PVSQMVEDEAAAS  7
             P +   E++AAA+
Sbjct  1032  PAN---EEQAAAA  1041



>ref|XP_006644607.1| PREDICTED: glycine dehydrogenase [decarboxylating] 2, mitochondrial-like 
[Oryza brachyantha]
Length=946

 Score =   353 bits (906),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 176/194 (91%), Gaps = 1/194 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL +ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  754  SKGLTEASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  813

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NN
Sbjct  814  KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIENGKADVNN  873

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK+APHPP LLM D WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  874  NVLKSAPHPPQLLMGDTWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  933

Query  45   PVSQMVEDEAAASA  4
              SQ VE+ AAA+A
Sbjct  934  QGSQ-VEEAAAATA  946



>gb|EMS46370.1| Glycine dehydrogenase [decarboxylating] B, mitochondrial [Triticum 
urartu]
Length=796

 Score =   350 bits (897),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            SQGL +ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  603  SQGLTEASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVA  662

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA++E GK D +N
Sbjct  663  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEVENGKADAHN  722

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APHPP LLM DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  723  NVLKGAPHPPQLLMGDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  782

Query  45   PVSQM  31
              SQ+
Sbjct  783  QASQV  787



>ref|XP_009392931.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1038

 Score =   355 bits (910),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRGFK TAG+EAEDVA
Sbjct  845   SKGLTDASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKATAGLEAEDVA  904

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIE GK DIN 
Sbjct  905   KRLIDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIENGKADINI  964

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSL+M D W+KPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLL
Sbjct  965   NVLKGAPHPPSLIMGDTWSKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLL  1024

Query  45    PVSQM  31
             PVSQM
Sbjct  1025  PVSQM  1029



>gb|KFK29912.1| hypothetical protein AALP_AA7G194500 [Arabis alpina]
Length=1042

 Score =   355 bits (910),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAG+E EDVA
Sbjct  851   SGGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGVEPEDVA  910

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ N
Sbjct  911   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQN  970

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD+W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLL
Sbjct  971   NVLKGAPHPPSLLMADSWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLL  1030

Query  45    PVSQMVEDEAAASA  4
             P  + V   AA SA
Sbjct  1031  PDEEQV--AAAVSA  1042



>ref|XP_006408846.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
 gb|ESQ50299.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
Length=1041

 Score =   355 bits (910),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  847   SEGLTDASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  906

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D NN
Sbjct  907   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPNN  966

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL 
Sbjct  967   NVLKGAPHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQ  1026

Query  45    P  43
             P
Sbjct  1027  P  1027



>gb|AAA63798.1| victorin binding protein [Avena sativa]
Length=1032

 Score =   354 bits (909),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  839   SQGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVA  898

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQ+E G  D+NN
Sbjct  899   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQVENGIADVNN  958

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPP LLM+DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  959   NVLKGAPHPPQLLMSDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  1018

Query  45    PVSQM  31
               SQ+
Sbjct  1019  QASQV  1023



>gb|AAL57651.1| AT4g33010/F26P21_130 [Arabidopsis thaliana]
 gb|AAN64523.1| At4g33010/F26P21_130 [Arabidopsis thaliana]
Length=1037

 Score =   354 bits (909),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 174/194 (90%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVA EFIIDLRGFKNTAGIE EDVA
Sbjct  846   SGGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAREFIIDLRGFKNTAGIEPEDVA  905

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ N
Sbjct  906   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQN  965

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLL
Sbjct  966   NVLKGAPHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLL  1025

Query  45    PVSQMVEDEAAASA  4
             P  + V   AA SA
Sbjct  1026  PEEEQV--AAAVSA  1037



>ref|XP_010667776.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=1042

 Score =   353 bits (907),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL +ASK AILNANYMAKRLE HYPVLFRGVNGT AHEFIIDLRGFKNTAGIEAEDVA
Sbjct  850   SNGLTEASKQAILNANYMAKRLEDHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEAEDVA  909

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAE+DRFCD LISIREEIA+IE GK D NN
Sbjct  910   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAEMDRFCDALISIREEIAEIENGKADANN  969

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPS+LMAD+W KPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTLL
Sbjct  970   NVLKGAPHPPSMLMADSWNKPYSREYAAYPADWLRAAKFWPTTARVDNVYGDRNLICTLL  1029

Query  45    PVSQMVEDEAAAS  7
             P +   E++AA +
Sbjct  1030  PANHYEEEKAATA  1042



>ref|XP_002880741.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57000.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
Length=1043

 Score =   353 bits (906),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 176/193 (91%), Gaps = 3/193 (2%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  851   SGGLTDASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVA  910

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EI+QIEKG  D NN
Sbjct  911   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRDEISQIEKGNADPNN  970

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD W KPYSREYAAFPA WL+++KFWP+TGRVDNVYGDRNL+CTL 
Sbjct  971   NVLKGAPHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPSTGRVDNVYGDRNLVCTLQ  1030

Query  45    PVSQMVEDEAAAS  7
             P +   E++AAA+
Sbjct  1031  PAN---EEQAAAA  1040



>ref|XP_010925018.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Elaeis guineensis]
Length=1040

 Score =   353 bits (906),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYM KRLE HYP+LF GVNGTVAHEFI+DLRGFK TAGIE EDVA
Sbjct  847   SKGLTDASKIAILNANYMVKRLENHYPILFCGVNGTVAHEFIVDLRGFKATAGIEPEDVA  906

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK DINN
Sbjct  907   KRLIDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADINN  966

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPS+LM D W KPYSR+ AAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLL
Sbjct  967   NVLKGAPHPPSMLMGDTWIKPYSRDIAAFPASWLQGSKFWPTTGRVDNVYGDRNLICTLL  1026

Query  45    PVSQMVEDEAAASA  4
             P SQM E+ AAA+A
Sbjct  1027  PASQMAEEPAAATA  1040



>ref|XP_006412401.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
 gb|ESQ53854.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
Length=1146

 Score =   355 bits (910),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAG+E EDVA
Sbjct  955   SGGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGVEPEDVA  1014

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ +
Sbjct  1015  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQD  1074

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLL
Sbjct  1075  NVLKGAPHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLL  1134

Query  45    PVSQMVEDEAAASA  4
             P  + V   AA SA
Sbjct  1135  PEEEQV--AAAVSA  1146



>gb|KFK32542.1| hypothetical protein AALP_AA6G256500 [Arabis alpina]
Length=1041

 Score =   353 bits (905),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  849   SVGLTDASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  908

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D NN
Sbjct  909   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPNN  968

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLMADAW KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL 
Sbjct  969   NVLKGAPHPPSLLMADAWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQ  1028

Query  45    PVSQ  34
             P ++
Sbjct  1029  PANE  1032



>gb|KHN37049.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=195

 Score =   327 bits (839),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  519  EKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  340
            + +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  24   KNYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  83

Query  339  IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPY  160
            IEPTESESKAELDRFCD LISIR+EIA+IEKG  DINNNVLK+APHPPSLLMADAWTKPY
Sbjct  84   IEPTESESKAELDRFCDALISIRQEIAEIEKGNADINNNVLKSAPHPPSLLMADAWTKPY  143

Query  159  SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  4
            SREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP SQ VE++AAA+A
Sbjct  144  SREYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLLPASQAVEEQAAATA  195



>gb|KDO80088.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=946

 Score =   350 bits (898),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL +ASKIAILNANYMAKRLEKHYP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVA
Sbjct  753  SKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVA  812

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFHGPTMSWPVPGTLMIEPTESESK ELDR+CD LISIREEIAQIE GK DI+N
Sbjct  813  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKEELDRYCDALISIREEIAQIENGKADIHN  872

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APHPPSLLM D WTKPYSREYAA+PA WL+ AKFWP TGRVDNVYGDRNLICTLL
Sbjct  873  NVLKGAPHPPSLLMGDTWTKPYSREYAAYPASWLRFAKFWPATGRVDNVYGDRNLICTLL  932

Query  45   P  43
            P
Sbjct  933  P  933



>emb|CDM83805.1| unnamed protein product [Triticum aestivum]
Length=1031

 Score =   352 bits (902),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL +ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  838   SQGLTEASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVA  897

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQ+E GK D +N
Sbjct  898   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQVENGKADAHN  957

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPP LLM DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  958   NVLKGAPHPPQLLMGDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  1017

Query  45    PVSQM  31
               SQ+
Sbjct  1018  QASQV  1022



>gb|EAZ13293.1| hypothetical protein OsJ_03218 [Oryza sativa Japonica Group]
Length=1035

 Score =   351 bits (901),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  842   SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  901

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NN
Sbjct  902   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNN  961

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK+APHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  962   NVLKSAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  1021

Query  45    PVSQM  31
               SQ+
Sbjct  1022  QGSQV  1026



>ref|XP_006601224.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like, 
partial [Glycine max]
Length=170

 Score =   325 bits (834),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -3

Query  513  HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLMIE  334
            +YPVLFRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLMIE
Sbjct  1    YYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLMIE  60

Query  333  PTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPYSR  154
            PTESESKAELDRFCD LISIR EIA+IEKG  DINNNVLK+APHPPSLLMADAWTKPYSR
Sbjct  61   PTESESKAELDRFCDALISIRHEIAEIEKGNADINNNVLKSAPHPPSLLMADAWTKPYSR  120

Query  153  EYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  4
            EYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP SQ VE++AAA+A
Sbjct  121  EYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLLPASQAVEEQAAATA  170



>ref|XP_010942763.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Elaeis guineensis]
Length=1042

 Score =   351 bits (901),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYM KRLE HYP+LF GVNGTVAHEFI+DLRG+K TAGIE EDVA
Sbjct  849   SKGLTDASKIAILNANYMVKRLENHYPILFCGVNGTVAHEFIVDLRGYKATAGIEPEDVA  908

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE G+ DI+N
Sbjct  909   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGRADISN  968

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM D WTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLL
Sbjct  969   NVLKGAPHPPSLLMGDTWTKPYSREYAAFPASWLRGSKFWPTTGRVDNVYGDRNLICTLL  1028

Query  45    PVSQM  31
             PVSQM
Sbjct  1029  PVSQM  1033



>ref|NP_001044046.1| Os01g0711400 [Oryza sativa Japonica Group]
 gb|AAQ24377.1| glycine dehydrogenase P protein [Oryza sativa Japonica Group]
 dbj|BAF05960.1| Os01g0711400 [Oryza sativa Japonica Group]
Length=1033

 Score =   351 bits (900),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  840   SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  899

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NN
Sbjct  900   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNN  959

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK+APHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  960   NVLKSAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  1019

Query  45    PVSQM  31
               SQ+
Sbjct  1020  QGSQV  1024



>gb|EAY75571.1| hypothetical protein OsI_03474 [Oryza sativa Indica Group]
Length=1033

 Score =   351 bits (900),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  840   SKGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  899

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NN
Sbjct  900   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNN  959

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK+APHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  960   NVLKSAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  1019

Query  45    PVSQM  31
               SQ+
Sbjct  1020  QGSQV  1024



>ref|XP_002441849.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
 gb|EES15687.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
Length=1042

 Score =   351 bits (900),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  848   SQGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  907

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+ N
Sbjct  908   KRLMDYGFHSPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIENGKADVLN  967

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPP LLM D W+KPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL 
Sbjct  968   NVLKGAPHPPQLLMGDTWSKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQ  1027

Query  45    PVSQM  31
               SQ+
Sbjct  1028  QASQV  1032



>ref|XP_003569669.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Brachypodium distachyon]
Length=1033

 Score =   350 bits (899),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL +ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  838   SQGLTEASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVA  897

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA++E GK D +N
Sbjct  898   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEVENGKADAHN  957

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPP LLM+DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  958   NVLKGAPHPPQLLMSDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  1017

Query  45    PVSQM  31
               SQ+
Sbjct  1018  QASQV  1022



>gb|EAZ37623.1| hypothetical protein OsJ_21958 [Oryza sativa Japonica Group]
Length=1005

 Score =   350 bits (897),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL DASKIAILNANYM KRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  812  SKGLTDASKIAILNANYMTKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  871

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NN
Sbjct  872  KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNN  931

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK+APHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  932  NVLKSAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  991

Query  45   PVSQM  31
              SQ+
Sbjct  992  QGSQV  996



>gb|EMT12369.1| Glycine dehydrogenase (decarboxylating), mitochondrial [Aegilops 
tauschii]
Length=1027

 Score =   350 bits (898),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL +ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  834   SQGLTEASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVA  893

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA++E GK D +N
Sbjct  894   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEVENGKADAHN  953

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPP LLM DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  954   NVLKGAPHPPQLLMGDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  1013

Query  45    PVSQM  31
               SQ+
Sbjct  1014  QASQV  1018



>ref|XP_006450834.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
 gb|ESR64074.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
Length=1058

 Score =   351 bits (900),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLEKHYP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVA
Sbjct  865   SKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVA  924

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESK ELDR+CD LISIREEIAQIE GK DI+N
Sbjct  925   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKEELDRYCDALISIREEIAQIENGKADIHN  984

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM D WTKPYSREYAA+PA WL+ AKFWP TGRVDNVYGDRNLICTLL
Sbjct  985   NVLKGAPHPPSLLMGDTWTKPYSREYAAYPASWLRFAKFWPATGRVDNVYGDRNLICTLL  1044

Query  45    P  43
             P
Sbjct  1045  P  1045



>ref|XP_008347531.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase (decarboxylating), 
mitochondrial-like [Malus domestica]
Length=235

 Score =   327 bits (839),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 166/183 (91%), Gaps = 2/183 (1%)
 Frame = -3

Query  585  SQGLXDASKI--AILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAED  412
            S+GL DASKI  AILNAN MAKRLE +YP+LF GVNGTVAHEFI+DL+GFKNTAGIE ED
Sbjct  42   SKGLTDASKIIIAILNANCMAKRLENYYPILFXGVNGTVAHEFIVDLKGFKNTAGIEPED  101

Query  411  VAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDI  232
            V KRLMDYGFHGPTMSWPVPGT MI+PTESESKAELDRFCD LISIREEIA I+KGK DI
Sbjct  102  VPKRLMDYGFHGPTMSWPVPGTRMIDPTESESKAELDRFCDALISIREEIALIQKGKADI  161

Query  231  NNNVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  52
             NNVLK APHPPSLL+ DAWTKPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNLICT
Sbjct  162  LNNVLKGAPHPPSLLIGDAWTKPYSREYAAFPASWLRSSKFWPTTGRVDNVYGDRNLICT  221

Query  51   LLP  43
            L P
Sbjct  222  LQP  224



>ref|XP_006475931.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Citrus sinensis]
 gb|KDO80086.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
 gb|KDO80087.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1058

 Score =   351 bits (900),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLEKHYP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVA
Sbjct  865   SKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVA  924

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESK ELDR+CD LISIREEIAQIE GK DI+N
Sbjct  925   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKEELDRYCDALISIREEIAQIENGKADIHN  984

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM D WTKPYSREYAA+PA WL+ AKFWP TGRVDNVYGDRNLICTLL
Sbjct  985   NVLKGAPHPPSLLMGDTWTKPYSREYAAYPASWLRFAKFWPATGRVDNVYGDRNLICTLL  1044

Query  45    P  43
             P
Sbjct  1045  P  1045



>gb|AAB82711.1| glycine decarboxylase P subunit [x Tritordeum sp.]
Length=1031

 Score =   350 bits (897),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL +ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  838   SQGLTEASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVA  897

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA++E GK D +N
Sbjct  898   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEVENGKADAHN  957

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPP LLM DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  958   NVLKGAPHPPQLLMGDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  1017

Query  45    PVSQM  31
               SQ+
Sbjct  1018  QASQV  1022



>dbj|BAD35509.1| putative glycine dehydrogenase [Oryza sativa Japonica Group]
 gb|EAZ01651.1| hypothetical protein OsI_23687 [Oryza sativa Indica Group]
Length=1031

 Score =   350 bits (897),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYM KRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  838   SKGLTDASKIAILNANYMTKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  897

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NN
Sbjct  898   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNN  957

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK+APHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  958   NVLKSAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQ  1017

Query  45    PVSQM  31
               SQ+
Sbjct  1018  QGSQV  1022



>ref|XP_004969722.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Setaria italica]
Length=1033

 Score =   349 bits (896),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK TAGIE EDVA
Sbjct  840   SQGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVA  899

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D  N
Sbjct  900   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIENGKADALN  959

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL 
Sbjct  960   NVLKGAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQ  1019

Query  45    PVSQM  31
                Q+
Sbjct  1020  QAGQV  1024



>emb|CBI27919.3| unnamed protein product [Vitis vinifera]
Length=1024

 Score =   348 bits (894),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAIL ANYMAKRLE HYP+LFRG+NGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  830   SKGLTEASKIAILKANYMAKRLEDHYPILFRGINGTVAHEFIIDLRGFKNTAGIEPEDVA  889

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D NN
Sbjct  890   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADPNN  949

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHP SLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL
Sbjct  950   NVLKGAPHPQSLLMQDAWTKPYSREYAAFPASWLRAAKFWPSTGRVDNVYGDRNLTCTLL  1009



>ref|XP_002282271.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1046

 Score =   348 bits (894),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/180 (89%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAIL ANYMAKRLE HYP+LFRG+NGTVAHEFIIDLRGFKNTAGIE EDVA
Sbjct  852   SKGLTEASKIAILKANYMAKRLEDHYPILFRGINGTVAHEFIIDLRGFKNTAGIEPEDVA  911

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D NN
Sbjct  912   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADPNN  971

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHP SLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL
Sbjct  972   NVLKGAPHPQSLLMQDAWTKPYSREYAAFPASWLRAAKFWPSTGRVDNVYGDRNLTCTLL  1031



>ref|XP_010097067.1| Glycine cleavage system P protein 1 [Morus notabilis]
 gb|EXB66868.1| Glycine cleavage system P protein 1 [Morus notabilis]
Length=1059

 Score =   348 bits (892),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 171/186 (92%), Gaps = 5/186 (3%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFK-----NTAGIE  421
             S+GL DASKIAILNANYMAKRLE +YPVLFRGVNGT AHEFI+DLRGFK     NTAGIE
Sbjct  861   SKGLTDASKIAILNANYMAKRLENYYPVLFRGVNGTCAHEFIVDLRGFKAGFLFNTAGIE  920

Query  420   AEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGK  241
              EDVAKRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK
Sbjct  921   PEDVAKRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGK  980

Query  240   FDINNNVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNL  61
              DI+NNVLK+APHPPSLLMADAWTKPYSRE AAFPA WL+ +KFWPTTGRVDNVYGDRNL
Sbjct  981   ADIHNNVLKSAPHPPSLLMADAWTKPYSRESAAFPAPWLRASKFWPTTGRVDNVYGDRNL  1040

Query  60    ICTLLP  43
             ICTLLP
Sbjct  1041  ICTLLP  1046



>ref|XP_008662474.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Zea mays]
 gb|AFW56070.1| glycine cleavage complex P-protein [Zea mays]
Length=1042

 Score =   347 bits (890),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQGL DASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLR FK TAGIE EDVA
Sbjct  847   SQGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRAFKTTAGIEPEDVA  906

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+ N
Sbjct  907   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVLN  966

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPP LLM D W+KPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL 
Sbjct  967   NVLKGAPHPPQLLMGDTWSKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQ  1026

Query  45    PVSQM  31
               +Q+
Sbjct  1027  QATQV  1031



>ref|XP_010432628.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Camelina sativa]
Length=1045

 Score =   344 bits (882),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLEKHYPVLFRG NGTVAHEFIIDLRGFKNTAG+EAEDVA
Sbjct  854   SGGLTDASKIAILNANYMAKRLEKHYPVLFRGANGTVAHEFIIDLRGFKNTAGLEAEDVA  913

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PV GTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ N
Sbjct  914   KRLMDYGFHAPTMSFPVSGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQN  973

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPS+LM+D W KPYSREYAAFPA WL++AKFWP+T RVDNVYGDR L+CTLL
Sbjct  974   NVLKGAPHPPSMLMSDTWKKPYSREYAAFPAPWLRSAKFWPSTSRVDNVYGDRKLVCTLL  1033

Query  45    PVSQMVEDEAAASA  4
             P  + V   AA SA
Sbjct  1034  PEEEQV--AAAVSA  1045



>emb|CDX75316.1| BnaA01g03860D [Brassica napus]
Length=1044

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 173/194 (89%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLEKH+PVLFRG NGTVAHEFIIDLRGFKNTAGIEAEDVA
Sbjct  853   SRGLTEASKIAILNANYMAKRLEKHFPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVA  912

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PV GTLMIEPTESESKAELDRFCDTLISIREEIAQIEKG  D+ N
Sbjct  913   KRLMDYGFHAPTMSFPVSGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGNADVQN  972

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APH P++LM+D W KPYSREYAAFP  WL++AKFWPTTGRVDNVYGDR L+CTLL
Sbjct  973   NVLKGAPHSPAMLMSDTWKKPYSREYAAFPTPWLRSAKFWPTTGRVDNVYGDRKLVCTLL  1032

Query  45    PVSQMVEDEAAASA  4
             P  + V   AA SA
Sbjct  1033  PEEEQV--AAAVSA  1044



>ref|XP_009125119.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Brassica rapa]
Length=1045

 Score =   342 bits (878),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 173/194 (89%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLEKH+PVLFRG NGTVAHEFIIDLRGFKNTAGIEAEDVA
Sbjct  854   SRGLTEASKIAILNANYMAKRLEKHFPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVA  913

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PV GTLMIEPTESESKAELDRFCDTLISIREEIAQIEKG  D+ N
Sbjct  914   KRLMDYGFHAPTMSFPVSGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGNADVQN  973

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APH P++LM+D W KPYSREYAAFP  WL++AKFWPTTGRVDNVYGDR L+CTLL
Sbjct  974   NVLKGAPHSPAMLMSDTWKKPYSREYAAFPTPWLRSAKFWPTTGRVDNVYGDRKLVCTLL  1033

Query  45    PVSQMVEDEAAASA  4
             P  + V   AA SA
Sbjct  1034  PEEEQV--AAAVSA  1045



>ref|XP_010437818.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Camelina sativa]
Length=1040

 Score =   342 bits (877),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 171/194 (88%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLEKHYPVLFRG NGTVAHEFIIDLRGFKNTAG+EAEDVA
Sbjct  849   SGGLTDASKIAILNANYMAKRLEKHYPVLFRGANGTVAHEFIIDLRGFKNTAGLEAEDVA  908

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PV GTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D+ N
Sbjct  909   KRLMDYGFHAPTMSFPVSGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADVQN  968

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPP LLM+D W KPYSREYAAFPA WL++AKFWP+T RVDNVYGDR L+CTLL
Sbjct  969   NVLKGAPHPPQLLMSDTWKKPYSREYAAFPAPWLRSAKFWPSTSRVDNVYGDRKLVCTLL  1028

Query  45    PVSQMVEDEAAASA  4
             P  + V   AA SA
Sbjct  1029  PEEEQV--AAAVSA  1040



>ref|XP_009401914.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1033

 Score =   342 bits (876),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASK AILNANYMAKRLE +YP+LFRGVNGTVAHEFI+DLRGFK TAGIE EDVA
Sbjct  840   SKGLTNASKTAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKATAGIEPEDVA  899

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI QIE GK DINN
Sbjct  900   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEITQIESGKADINN  959

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHP S+LM D+W KPYSRE AAFP  WL+ AKFWPT GR+DNVYGDRNLICTL 
Sbjct  960   NVLKGAPHPLSMLMGDSWNKPYSRECAAFPVSWLRDAKFWPTAGRIDNVYGDRNLICTLP  1019

Query  45    PVSQM  31
             PVSQM
Sbjct  1020  PVSQM  1024



>emb|CAA81076.1| P protein [Flaveria pringlei]
Length=1037

 Score =   342 bits (876),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 173/194 (89%), Gaps = 1/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQG+ +ASKIAILNANYMAKRLE HYP+LFRGVNGTVAHEFI+DLR  K TAGIE EDVA
Sbjct  845   SQGITNASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVA  904

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D+NN
Sbjct  905   KRLIDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNVDLNN  964

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NV+K APHPP LLMAD WTKPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  965   NVIKGAPHPPQLLMADKWTKPYSREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQ  1024

Query  45    PVSQMVEDEAAASA  4
             P  Q  E++A A+A
Sbjct  1025  P-PQEYEEKAEATA  1037



>ref|XP_010429623.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial 
[Camelina sativa]
Length=1044

 Score =   342 bits (877),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 174/193 (90%), Gaps = 3/193 (2%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLE HYPVLFRG NGTVAHEFIIDLRGFKNTAGIEAEDVA
Sbjct  852   SGGLTDASKIAILNANYMAKRLESHYPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVA  911

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D +N
Sbjct  912   KRLMDYGFHAPTMSFPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPHN  971

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHP S LMADAW KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR+L+CTL 
Sbjct  972   NVLKGAPHPLSSLMADAWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRHLVCTLQ  1031

Query  45    PVSQMVEDEAAAS  7
             P +   E++AAA+
Sbjct  1032  PAN---EEQAAAA  1041



>sp|P49361.1|GCSPA_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) A, mitochondrial; 
AltName: Full=Glycine cleavage system P protein A; 
AltName: Full=Glycine decarboxylase A; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) A; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA85353.1| P-protein of the glycine cleavage system [Flaveria pringlei]
Length=1037

 Score =   342 bits (876),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 173/194 (89%), Gaps = 1/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQG+ +ASKIAILNANYMAKRLE HYP+LFRGVNGTVAHEFI+DLR  K TAGIE EDVA
Sbjct  845   SQGITNASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVA  904

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D+NN
Sbjct  905   KRLIDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNVDLNN  964

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NV+K APHPP LLMAD WTKPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  965   NVIKGAPHPPQLLMADKWTKPYSREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQ  1024

Query  45    PVSQMVEDEAAASA  4
             P  Q  E++A A+A
Sbjct  1025  P-PQEYEEKAEATA  1037



>ref|XP_010417387.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1041

 Score =   341 bits (875),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 174/193 (90%), Gaps = 3/193 (2%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA
Sbjct  849   SGGLTDASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  908

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D +N
Sbjct  909   KRLMDYGFHAPTMSFPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPHN  968

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHP S LMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR+L+CTL 
Sbjct  969   NVLKGAPHPLSSLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRHLVCTLQ  1028

Query  45    PVSQMVEDEAAAS  7
             P +   E++AAA+
Sbjct  1029  PAN---EEQAAAA  1038



>sp|O49852.1|GCSP_FLATR RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
trinervia]
 emb|CAB16916.1| P-Protein precursor [Flaveria trinervia]
Length=1034

 Score =   341 bits (875),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQG+ +ASKIAILNANYMAKRLE HYP+LFRGVNGTVAHEFI+DLR  K TAGIE EDVA
Sbjct  842   SQGITNASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVA  901

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D NN
Sbjct  902   KRLIDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGTVDFNN  961

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NV+K APHPP LLMAD WTKPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  962   NVIKGAPHPPQLLMADKWTKPYSREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQ  1021

Query  45    PVSQMVEDEAAASA  4
             P  Q  E++A A+A
Sbjct  1022  P-PQEYEEKAEATA  1034



>emb|CDX68930.1| BnaC01g05230D [Brassica napus]
Length=1045

 Score =   341 bits (875),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL +ASKIAILNANYMAKRLEKH+PVLFRG NGTVAHEFIIDLRGFKNTAGIEAEDVA
Sbjct  854   SGGLTEASKIAILNANYMAKRLEKHFPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVA  913

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PV GTLMIEPTESESKAELDRFCDTLISIREEIAQIEKG  D+ N
Sbjct  914   KRLMDYGFHAPTMSFPVSGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGNADVQN  973

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APH P++LM+D W KPYSREYAAFP  WL++AKFWPTTGRVDNVYGDR L+CTLL
Sbjct  974   NVLKGAPHSPAMLMSDTWKKPYSREYAAFPTPWLRSAKFWPTTGRVDNVYGDRKLVCTLL  1033

Query  45    PVSQMVEDEAAASA  4
             P  + V   AA SA
Sbjct  1034  PEEEQV--AAAVSA  1045



>sp|O49850.1|GCSP_FLAAN RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
anomala]
 emb|CAB16911.1| P-protein [Flaveria anomala]
Length=1034

 Score =   341 bits (874),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQG+ +ASKIAILNANYMAKRLE HYP+LFRGVNGTVAHEFI+DLR  K TAGIE EDVA
Sbjct  842   SQGITNASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVA  901

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D NN
Sbjct  902   KRLIDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNVDFNN  961

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NV+K APHPP LLMAD WTKPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  962   NVIKGAPHPPQLLMADKWTKPYSREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQ  1021

Query  45    PVSQMVEDEAAASA  4
             P  Q  E++A A+A
Sbjct  1022  P-PQEYEEKAEATA  1034



>sp|P49362.1|GCSPB_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) B, mitochondrial; 
AltName: Full=Glycine cleavage system P protein B; 
AltName: Full=Glycine decarboxylase B; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) B; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA91000.1| P-protein precursor of glycine cleavage system [Flaveria pringlei]
Length=1034

 Score =   341 bits (874),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             SQG+ +ASKIAILNANYMAKRLE HYP+LFRGVNGTVAHEFI+DLR  K TAGIE EDVA
Sbjct  842   SQGITNASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVA  901

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D NN
Sbjct  902   KRLIDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNVDFNN  961

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NV+K APHPP LLMAD WTKPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL 
Sbjct  962   NVIKGAPHPPQLLMADKWTKPYSREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQ  1021

Query  45    PVSQMVEDEAAASA  4
             P  Q  E++A A+A
Sbjct  1022  P-PQEYEEKAEATA  1034



>ref|XP_010472637.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1046

 Score =   340 bits (873),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 173/193 (90%), Gaps = 3/193 (2%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLE HYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA
Sbjct  854   SGGLTDASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  913

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D +N
Sbjct  914   KRLMDYGFHAPTMSFPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPHN  973

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHP S LMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR+L+CTL 
Sbjct  974   NVLKGAPHPLSSLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRHLVCTLQ  1033

Query  45    PVSQMVEDEAAAS  7
             P +   E++ AA+
Sbjct  1034  PAN---EEQVAAA  1043



>ref|XP_007136824.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
 gb|ESW08818.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
Length=1018

 Score =   339 bits (870),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASK AIL ANYMAKRLE HYPVLFRG NGTVAHEFIIDLRGFKN+ GIE EDVA
Sbjct  837   SKGLTEASKTAILKANYMAKRLETHYPVLFRGANGTVAHEFIIDLRGFKNSTGIEPEDVA  896

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMS+PVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IE GK DINN
Sbjct  897   KRLIDYGFHGPTMSFPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIENGKADINN  956

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSLLM DAWTKPYSREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTL 
Sbjct  957   NVLKGAPHPPSLLMGDAWTKPYSREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLP  1016

Query  45    P  43
             P
Sbjct  1017  P  1017



>ref|XP_006858311.1| hypothetical protein AMTR_s00064p00096040 [Amborella trichopoda]
 gb|ERN19778.1| hypothetical protein AMTR_s00064p00096040 [Amborella trichopoda]
Length=1044

 Score =   339 bits (870),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKI+ILNANYMAKRLE HYPVLFRGVNGT AHEFIIDLRGFK +AGIE EDVA
Sbjct  851   SKGLTEASKISILNANYMAKRLENHYPVLFRGVNGTCAHEFIIDLRGFKGSAGIEPEDVA  910

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESE+KAELDRFCD LISIR+EIAQIE GK D+  
Sbjct  911   KRLMDYGFHAPTMSWPVPGTLMIEPTESETKAELDRFCDALISIRKEIAQIESGKADVLV  970

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHPPSL+MAD W KPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL+CTLL
Sbjct  971   NVLKGAPHPPSLIMADEWKKPYSREYAAFPASWLRGAKFWPSTGRVDNVYGDRNLVCTLL  1030

Query  45    PVSQMV  28
             PV+  V
Sbjct  1031  PVTNGV  1036



>ref|XP_008347532.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Malus domestica]
Length=253

 Score =   316 bits (810),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = -3

Query  552  ILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGP  373
            ILNAN MAKRLE +YP+LFRGVNGTVAHEFI+DL+GFKNTAGIE EDV KRLMDYGFHGP
Sbjct  73   ILNANCMAKRLENYYPILFRGVNGTVAHEFIVDLKGFKNTAGIEPEDVPKRLMDYGFHGP  132

Query  372  TMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPS  193
            TMSWPVPGT MI+PTESESKAELDRFCD LISIREEIAQI+KGK DI NNVLK APHPPS
Sbjct  133  TMSWPVPGTRMIDPTESESKAELDRFCDALISIREEIAQIQKGKADILNNVLKGAPHPPS  192

Query  192  LLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
            LL+  AWTKPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNLICTL P
Sbjct  193  LLIGYAWTKPYSREYAAFPASWLRSSKFWPTTGRVDNVYGDRNLICTLQP  242



>ref|XP_006283054.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
 gb|EOA15952.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
Length=1038

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 168/194 (87%), Gaps = 5/194 (3%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL DASKIAILNANYMAKRLEKHYPVLFRG NGTVAHEFIIDLR FKNTAGIEAEDVA
Sbjct  847   SGGLTDASKIAILNANYMAKRLEKHYPVLFRGANGTVAHEFIIDLRAFKNTAGIEAEDVA  906

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ N
Sbjct  907   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQN  966

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHP S+LMAD W KPYSREYAAFPA WL+++KFWP T RVDNVYGDR L+ TLL
Sbjct  967   NVLKGAPHPQSVLMADTWNKPYSREYAAFPAPWLRSSKFWPITSRVDNVYGDRKLVSTLL  1026

Query  45    PVSQMVEDEAAASA  4
                   E+E  A+A
Sbjct  1027  -----AEEEQVAAA  1035



>ref|XP_006296473.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
 gb|EOA29371.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
Length=1040

 Score =   333 bits (853),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL  ASKIAILNANYMAKRLE HYPVL+RGVNGTVAHEFIIDLRGFKNTAGIEAEDVA
Sbjct  848   SGGLTAASKIAILNANYMAKRLESHYPVLYRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  907

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D +N
Sbjct  908   KRLMDYGFHSPTMSFPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPHN  967

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  49
             NVLK APHP SLLM+D W KPYSREYAAFP  WL+ +KFWP TGRVDNVYGDRNL+CTL
Sbjct  968   NVLKGAPHPLSLLMSDTWKKPYSREYAAFPTPWLRASKFWPVTGRVDNVYGDRNLVCTL  1026



>gb|ACN39938.1| unknown [Picea sitchensis]
Length=780

 Score =   321 bits (822),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 167/193 (87%), Gaps = 0/193 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            SQGL +ASK+AILNANYMAKRLE +YPVLFRG NGT AHEFIIDLR FK +AGIE EDVA
Sbjct  586  SQGLTEASKLAILNANYMAKRLEDYYPVLFRGENGTCAHEFIIDLRHFKVSAGIEPEDVA  645

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFC+ LISIR+EI  IE GK D ++
Sbjct  646  KRLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCNALISIRKEIMAIETGKMDSHH  705

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APHP S++MAD W +PYSRE AAFPA W++ +KFWP+TGRVDNVYGDRNL+CTLL
Sbjct  706  NVLKGAPHPASVVMADEWNRPYSREVAAFPASWVRASKFWPSTGRVDNVYGDRNLVCTLL  765

Query  45   PVSQMVEDEAAAS  7
                +VE++A A+
Sbjct  766  QAGDVVEEQAVAA  778



>gb|KJB54688.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1053

 Score =   325 bits (834),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL DASKIAILNANYMAKRLE +YPVLFRGVNGTVAHEFI+DLRGFKNTAGIE EDVA
Sbjct  857   SKGLTDASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVA  916

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIE GK DI+N
Sbjct  917   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIENGKADIHN  976

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVY  76
             NVLK APHPPSLLM DAWTKPY+REYAAFPA WL+TAKFWPTTG V  +Y
Sbjct  977   NVLKGAPHPPSLLMGDAWTKPYTREYAAFPASWLRTAKFWPTTGDVLTMY  1026



>ref|XP_001755004.1| predicted protein [Physcomitrella patens]
 gb|EDQ80458.1| predicted protein [Physcomitrella patens]
Length=946

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 168/194 (87%), Gaps = 1/194 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL DASK+AILNANYMAKRLE HYPVLFRGVNGT AHEFIIDLR FK TAGIEAEDVA
Sbjct  754  NKGLTDASKLAILNANYMAKRLENHYPVLFRGVNGTCAHEFIIDLRKFKETAGIEAEDVA  813

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYG+H PTMSWPV GTLMIEPTESESKAELDRFCD LISIREEIA IE G+    +
Sbjct  814  KRLMDYGYHAPTMSWPVSGTLMIEPTESESKAELDRFCDALISIREEIAAIENGEASRED  873

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APHP S++MAD WTK YSRE AAFPA W++ +KFWPTT RVDNVYGDRNL+CT  
Sbjct  874  NVLKGAPHPASVVMADDWTKSYSREVAAFPASWVRASKFWPTTSRVDNVYGDRNLMCT-N  932

Query  45   PVSQMVEDEAAASA  4
            P +++++++ AA+A
Sbjct  933  PSAEVIDEKIAAAA  946



>ref|XP_001754864.1| predicted protein [Physcomitrella patens]
 gb|EDQ80318.1| predicted protein [Physcomitrella patens]
Length=1038

 Score =   317 bits (813),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 168/194 (87%), Gaps = 1/194 (1%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             ++GL DASK+AILNANYMAKRLE HYPVLFRGVNGT AHEFIIDLR FK TAGIEAEDVA
Sbjct  846   NKGLTDASKLAILNANYMAKRLENHYPVLFRGVNGTCAHEFIIDLRKFKETAGIEAEDVA  905

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYG+H PTMSWPV GTLMIEPTESESKAELDRFCD LISIREEIA IE G+    +
Sbjct  906   KRLMDYGYHAPTMSWPVSGTLMIEPTESESKAELDRFCDALISIREEIAAIENGEASRED  965

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLK APHP S++MAD WTK YSRE AAFPA W++ +KFWPTT RVDNVYGDRNL+CT  
Sbjct  966   NVLKGAPHPASVVMADDWTKSYSREVAAFPASWVRASKFWPTTSRVDNVYGDRNLMCT-N  1024

Query  45    PVSQMVEDEAAASA  4
             P +++++++ AA+A
Sbjct  1025  PSAEVIDEKIAAAA  1038



>ref|XP_001780310.1| predicted protein [Physcomitrella patens]
 gb|EDQ54869.1| predicted protein [Physcomitrella patens]
Length=995

 Score =   315 bits (808),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 168/194 (87%), Gaps = 1/194 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL DASK+AILNANYMAKRLE HYP+LFRGVNGT AHEFIIDLR FK+TAGIEAEDVA
Sbjct  803  NKGLTDASKLAILNANYMAKRLENHYPILFRGVNGTCAHEFIIDLRKFKDTAGIEAEDVA  862

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYG+H PTMSWPV GTLMIEPTESESKAELDRFCD LISIR EIA IE G+    +
Sbjct  863  KRLMDYGYHAPTMSWPVSGTLMIEPTESESKAELDRFCDALISIRGEIAAIENGEASRED  922

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK +PHP S++MAD WTK YSRE AAFPA W++ +KFWPTT RVDNVYGDRNL+CT  
Sbjct  923  NVLKGSPHPASVVMADNWTKSYSREVAAFPASWVRASKFWPTTSRVDNVYGDRNLVCT-N  981

Query  45   PVSQMVEDEAAASA  4
            P +++VE++ AA+A
Sbjct  982  PPAELVEEKIAAAA  995



>gb|KDO80089.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1050

 Score =   313 bits (803),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASKIAILNANYMAKRLEKHYP+LFRGVNGTVAHEFI+DLRG KNTAGIE EDVA
Sbjct  865   SKGLTEASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVA  924

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFHGPTMSWPVPGTLMIEPTESESK ELDR+CD LISIREEIAQIE GK DI+N
Sbjct  925   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKEELDRYCDALISIREEIAQIENGKADIHN  984

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTG  94
             NVLK APHPPSLLM D WTKPYSREYAA+PA WL+ AKFWP TG
Sbjct  985   NVLKGAPHPPSLLMGDTWTKPYSREYAAYPASWLRFAKFWPATG  1028



>emb|CAA38252.1| P-protein subunit of glycine decarboxylase enzyme complex [Pisum 
sativum]
Length=153

 Score =   287 bits (735),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -3

Query  462  IIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTL  283
            I DLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPV GTLMIEPTESESKAELDRFCD L
Sbjct  1    IYDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVAGTLMIEPTESESKAELDRFCDAL  60

Query  282  ISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWP  103
            ISIR+EIA++EKG  D++NNVLK APHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWP
Sbjct  61   ISIRKEIAEVEKGNADVHNNVLKGAPHPPSLLMADAWTKPYSREYAAFPAAWLRGAKFWP  120

Query  102  TTGRVDNVYGDRNLICTLLPVSQMVEDEAAASA  4
            TTGRVDNVYGDRNL+CTLLP SQ VE++AAA+A
Sbjct  121  TTGRVDNVYGDRNLVCTLLPASQAVEEQAAATA  153



>ref|XP_005850089.1| hypothetical protein CHLNCDRAFT_34381 [Chlorella variabilis]
 gb|EFN57987.1| hypothetical protein CHLNCDRAFT_34381 [Chlorella variabilis]
Length=201

 Score =   287 bits (735),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            SQ L +ASK+AILNANYMAKRLE+HYPVLFRG NGT AHEFI+D+R   +  G+EAED+A
Sbjct  3    SQALTNASKLAILNANYMAKRLEQHYPVLFRGANGTCAHEFILDIRPITDATGVEAEDIA  62

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMSWPV GTLMIEPTESESKAELDRFC+ +ISIR EIA +E GK D  N
Sbjct  63   KRLMDYGFHAPTMSWPVAGTLMIEPTESESKAELDRFCEAMISIRHEIAAVEAGKADPKN  122

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  49
            NVLK+APH P +++AD W +PY+RE AA+PA W++ AKFWPTT RVDNVYGDR+L+  L
Sbjct  123  NVLKHAPHSPDVVLADTWDRPYTRELAAYPAPWVRQAKFWPTTSRVDNVYGDRHLVLRL  181



>ref|XP_006371884.1| hypothetical protein POPTR_0018s05150g [Populus trichocarpa]
 gb|ERP49681.1| hypothetical protein POPTR_0018s05150g [Populus trichocarpa]
Length=804

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 162/194 (84%), Gaps = 17/194 (9%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL DASKIAILNANYM KRLE +YP+LFRGVNGTVAHEFI+DLRGFK           
Sbjct  628  SKGLTDASKIAILNANYMVKRLENYYPILFRGVNGTVAHEFIVDLRGFK-----------  676

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
                  GFH PTMSWPVPGTLMIEPTESESKAELDRFC  LISIREEIA+IEK K DI+N
Sbjct  677  ------GFHAPTMSWPVPGTLMIEPTESESKAELDRFCVALISIREEIAEIEKEKADIHN  730

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APHPPSL+M DAWTKPYSREYAAF A WL+ AKFWP++GRVDNVYGDRNLICTLL
Sbjct  731  NVLKGAPHPPSLVMGDAWTKPYSREYAAFSASWLRVAKFWPSSGRVDNVYGDRNLICTLL  790

Query  45   PVSQMVEDEAAASA  4
              SQ+VE++AAA+A
Sbjct  791  SASQVVEEQAAATA  804



>ref|XP_002979861.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
 gb|EFJ19263.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
Length=946

 Score =   294 bits (753),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL  ASK+AILNANYMAKRLE HY +LFRG NGT AHEFI+DLR FK TA IE EDVA
Sbjct  753  SEGLTSASKLAILNANYMAKRLENHYRILFRGKNGTCAHEFIVDLRAFKATANIEPEDVA  812

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL+DYGFH PTMSWPV GTLMIEPTESESKAELDRFCD +ISIREEI  IE G  +  +
Sbjct  813  KRLIDYGFHAPTMSWPVHGTLMIEPTESESKAELDRFCDAMISIREEIRAIENGTCNAAD  872

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APH  S++++D W KPYSR+ AA+PA W++++KFWP+TGRVDNVYGDRNL+CTL+
Sbjct  873  NVLKGAPHSASMVLSDKWNKPYSRKLAAYPATWVESSKFWPSTGRVDNVYGDRNLVCTLI  932

Query  45   PVSQMVEDEAAASA  4
                   +E  A+A
Sbjct  933  NGDATPAEERVATA  946



>ref|XP_002988429.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
 gb|EFJ10519.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
Length=946

 Score =   294 bits (752),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL  ASK+AILNANYMAKRLE HY +LFRG NGT AHEFI+DLR FK TA IE EDVA
Sbjct  753  SEGLTSASKLAILNANYMAKRLEDHYRILFRGKNGTCAHEFIVDLRAFKATANIEPEDVA  812

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL+DYGFH PTMSWPV GTLMIEPTESESKAELDRFCD +ISIREEI  IE G  +  +
Sbjct  813  KRLIDYGFHAPTMSWPVHGTLMIEPTESESKAELDRFCDAMISIREEIRAIENGTCNAAD  872

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK APH  S++++D W KPYSR+ AA+PA W++++KFWP+TGRVDNVYGDRNL+CTL+
Sbjct  873  NVLKGAPHSASMVLSDKWNKPYSRKLAAYPATWVESSKFWPSTGRVDNVYGDRNLVCTLI  932

Query  45   PVSQMVEDEAAASA  4
                   +E  A+A
Sbjct  933  NGDAAPAEERVATA  946



>ref|XP_001692993.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
 gb|EDP03562.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
Length=1039

 Score =   288 bits (737),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL  ASK+AIL ANYMAKRL  HYPVLF G NGT AHEFI+DLR  K TAGIEAEDVA
Sbjct  848   SAGLTMASKLAILKANYMAKRLAGHYPVLFTGPNGTCAHEFILDLRPLKETAGIEAEDVA  907

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PTMSWPVPGTLMIEPTESESK ELDRFC+ +ISIREEI +IE GK D  N
Sbjct  908   KRLMDYGFHAPTMSWPVPGTLMIEPTESESKEELDRFCEAMISIREEIREIESGKADKAN  967

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLI  58
             N+LK+APH P +++AD W +PYSRE AAFPA W++ AKFWPT  RVDNVYGDR+LI
Sbjct  968   NILKHAPHAPGVVLADKWERPYSRERAAFPAPWVRQAKFWPTVSRVDNVYGDRHLI  1023



>ref|WP_010472943.1| glycine dehydrogenase [Acaryochloris sp. CCMEE 5410]
Length=984

 Score =   284 bits (726),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  A+K+AILNANY+AKRLE +YPVL++G +G VAHE I+DLRG K TAGIE ED+A
Sbjct  797  ARGLTQATKVAILNANYIAKRLEAYYPVLYKGKSGLVAHECILDLRGVKKTAGIEVEDIA  856

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYG+H PT+SWPVPGT+MIEPTESESKAELDRFC+ +I+IR EIA+IE G+ D  N
Sbjct  857  KRLMDYGYHAPTVSWPVPGTIMIEPTESESKAELDRFCEAMIAIRAEIAEIEAGQADAQN  916

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPHP  +++AD+W +PYSRE AA+PA W + +KFWP   R++N YGDRNL+C+  
Sbjct  917  NVLKNAPHPADVVIADSWDRPYSREKAAYPAPWTRESKFWPAVSRINNAYGDRNLVCSCA  976

Query  45   PVSQMVE  25
            P+S   E
Sbjct  977  PLSDYAE  983



>ref|XP_002956892.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
 gb|EFJ42017.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
Length=978

 Score =   283 bits (725),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S GL  ASK+AIL ANYMAKRL  HYPVLF G NGT AHEFI+DLR  K TAGIEAEDVA
Sbjct  787  SGGLTMASKLAILKANYMAKRLAGHYPVLFTGPNGTCAHEFILDLRPLKETAGIEAEDVA  846

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMSWPVPGTLMIEPTESESK ELDRFC+ +ISIREEI +IE+G+ D  N
Sbjct  847  KRLMDYGFHAPTMSWPVPGTLMIEPTESESKDELDRFCEAMISIREEIREIEQGRADREN  906

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLI  58
            NVLK+APH PS+++ D W +PY+RE AA+PA W+  AKFWPT  RVDNVYGDRNL+
Sbjct  907  NVLKHAPHAPSVVLVDTWDRPYTRERAAYPAPWVWQAKFWPTVSRVDNVYGDRNLV  962



>ref|XP_011398598.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25702.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
Length=1211

 Score =   280 bits (717),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 151/179 (84%), Gaps = 0/179 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
              + L +ASK+AILNANYMAKRLEKHY VLF G NGT AHEFI+D+R   +++GIEAED+A
Sbjct  1015  GKALANASKLAILNANYMAKRLEKHYNVLFHGPNGTCAHEFILDIRPLTSSSGIEAEDIA  1074

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFHGPTMSWPV GTLMIEPTESESKAELDRF + +I IREEIA+IE GK D  N
Sbjct  1075  KRLIDYGFHGPTMSWPVSGTLMIEPTESESKAELDRFVEAMIGIREEIAEIESGKADRAN  1134

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  49
             NVLK+APHP  ++MAD W +PYSR+ AA+PA W++ +KFWPTT RVDNVYGDRNL+  +
Sbjct  1135  NVLKHAPHPAHVVMADEWDRPYSRDKAAYPAPWVRQSKFWPTTCRVDNVYGDRNLVVRM  1193



>ref|WP_012166094.1| glycine dehydrogenase [Acaryochloris marina]
 gb|ABW30892.1| glycine dehydrogenase [Acaryochloris marina MBIC11017]
Length=984

 Score =   279 bits (713),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  A+K+AILNANY+AKRLE +YPVL++G +G VAHE I+DLRG K TA IE ED+A
Sbjct  797  AKGLTQATKVAILNANYIAKRLEAYYPVLYKGKSGLVAHECILDLRGVKKTAEIEVEDIA  856

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYG+H PT+SWPVPGT+MIEPTESESKAELDRFC+ +I+IR EIA+IE G+ D  N
Sbjct  857  KRLMDYGYHAPTVSWPVPGTIMIEPTESESKAELDRFCEAMIAIRAEIAEIEAGQADAQN  916

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPHP  +++AD+W +PYSRE AA+PA W +  KFWP   R++N YGDRNL+C+  
Sbjct  917  NVLKNAPHPADVVIADSWDRPYSREKAAYPAPWTREFKFWPAVSRINNAYGDRNLVCSCA  976

Query  45   PVSQMVE  25
            P+S   E
Sbjct  977  PLSDYAE  983



>ref|WP_040765024.1| glycine dehydrogenase, partial [Rhodopirellula maiorica]
Length=347

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  A+++AILNANYMAKRL  HY +L+   +G VAHEFI+D R F+ +AG++ ED+A
Sbjct  162  ASGLKKATQVAILNANYMAKRLSDHYDILYTDSDGFVAHEFIVDCRKFEKSAGVKIEDIA  221

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFHGPTMSWPVPGTLMIEPTESESK ELDRFCD LISIR EI  IE GK D N+
Sbjct  222  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKDELDRFCDALISIRAEIQSIEDGKMDAND  281

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LK+APH    + +D W  PY+RE AA+P  WL+ AKFWPT GR+D+ YGDRNL+C+  
Sbjct  282  NPLKHAPHTMGAIGSDDWQHPYTREQAAWPMAWLRDAKFWPTVGRIDSAYGDRNLVCSCP  341

Query  45   PV  40
            P+
Sbjct  342  PM  343



>gb|EMI20957.1| glycine dehydrogenase [Rhodopirellula maiorica SM1]
Length=345

 Score =   264 bits (674),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  A+++AILNANYMAKRL  HY +L+   +G VAHEFI+D R F+ +AG++ ED+A
Sbjct  160  ASGLKKATQVAILNANYMAKRLSDHYDILYTDSDGFVAHEFIVDCRKFEKSAGVKIEDIA  219

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFHGPTMSWPVPGTLMIEPTESESK ELDRFCD LISIR EI  IE GK D N+
Sbjct  220  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKDELDRFCDALISIRAEIQSIEDGKMDAND  279

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LK+APH    + +D W  PY+RE AA+P  WL+ AKFWPT GR+D+ YGDRNL+C+  
Sbjct  280  NPLKHAPHTMGAIGSDDWQHPYTREQAAWPMAWLRDAKFWPTVGRIDSAYGDRNLVCSCP  339

Query  45   PV  40
            P+
Sbjct  340  PM  341



>ref|XP_003055654.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
 gb|EEH60906.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
Length=1045

 Score =   279 bits (714),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S+GL +ASK AILNANYMAKRLE HYPVLF+G NGT AHEFI+DLR   +++G+  EDVA
Sbjct  856   SKGLTNASKRAILNANYMAKRLEDHYPVLFKGKNGTCAHEFILDLRPLGDSSGVVVEDVA  915

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYG+H PTMSWPV GTLMIEPTESESKAELDRFC+ +I+IREEI  IE G  D  N
Sbjct  916   KRLMDYGYHSPTMSWPVSGTLMIEPTESESKAELDRFCNAMIAIREEIRDIENGAMDREN  975

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             N LK+APH  S++M D W +PYSRE AAFPA W++ +KFWPT  RVDNVYGDRNL+ T  
Sbjct  976   NPLKHAPHTASVVMGDEWDRPYSRETAAFPAPWVRASKFWPTNSRVDNVYGDRNLVTTHA  1035

Query  45    PVSQMVEDEA  16
              V    E+ A
Sbjct  1036  SVEVSAEETA  1045



>ref|WP_039128745.1| glycine dehydrogenase [Flavihumibacter sp. ZG627]
 gb|KIC91589.1| glycine dehydrogenase [Flavihumibacter sp. ZG627]
Length=960

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL  A++ AILNANYM  RL+K Y VL+ G NGT AHEFI+DLR FK +AGIEAEDVA
Sbjct  771  SEGLRMATEYAILNANYMKSRLDKAYSVLYNGRNGTCAHEFIVDLRPFKTSAGIEAEDVA  830

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMS+PVPGT+MIEPTESE KAELDRFCD ++SIREEIA IE G  D  N
Sbjct  831  KRLMDYGFHAPTMSFPVPGTIMIEPTESEDKAELDRFCDAMLSIREEIAAIENGLADKGN  890

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH   L+ AD W KPYSR+ AAFP  ++K  KFWP+  RV+N +GDRNLICT  
Sbjct  891  NALKNAPHTQFLITADQWDKPYSRQKAAFPLPYVKENKFWPSVSRVNNTFGDRNLICTCE  950

Query  45   PVSQMVEDEA  16
            PVS   E+EA
Sbjct  951  PVSSYAEEEA  960



>gb|AAM93931.1| glycine decarboxylase p protein [Griffithsia japonica]
Length=215

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 150/194 (77%), Gaps = 1/194 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL +A++ AILNANYMA RL+  + +LFRG  G  AHEFI+DLR FK + GI   DVA
Sbjct  20   SKGLREATEQAILNANYMATRLKGSFNILFRGSQGRCAHEFILDLRPFKASCGISETDVA  79

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL DYGFH PTMSWPV GTLM+EPTESESKAELDRFCD +I IREEI  +E+G+ D  +
Sbjct  80   KRLQDYGFHAPTMSWPVAGTLMVEPTESESKAELDRFCDAMIMIREEIRAVEEGRMDKED  139

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LK+APH  +++ AD WT+ YSRE  A+PA W++ +KFWPTT RVD+V+GDRNL+CT  
Sbjct  140  NPLKHAPHTAAIVTADEWTRGYSREAGAYPASWVQGSKFWPTTSRVDDVFGDRNLVCTCP  199

Query  45   PVSQMV-EDEAAAS  7
            P+S  + EDE  A+
Sbjct  200  PLSAYLDEDEPKAN  213



>ref|WP_033110978.1| hypothetical protein [Leptospira interrogans]
Length=188

 Score =   255 bits (652),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL +A++ +ILNANY+AKRLEK YPVL++G NG VAHE I+DLR FK +AGIE EDVA
Sbjct  3    SEGLTNATRNSILNANYIAKRLEKVYPVLYKGKNGFVAHECILDLRPFKKSAGIEVEDVA  62

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL+DYGFH PTMS+PVPGTLMIEPTESES  ELDRFC+ ++ I +EI  ++ G  D  +
Sbjct  63   KRLIDYGFHAPTMSFPVPGTLMIEPTESESLEELDRFCEAMLLIYQEILDVQSGTLDKTD  122

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKN+PH  +++ +D W   Y RE AA+PA WLK  KFWP  GRVDNVYGDRNL+C+ L
Sbjct  123  NPLKNSPHTAAMVTSDRWDHLYPRERAAYPASWLKDHKFWPYVGRVDNVYGDRNLVCSCL  182

Query  45   PV  40
            P+
Sbjct  183  PI  184



>ref|WP_018342886.1| glycine dehydrogenase [Cytophaga aurantiaca]
Length=966

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 149/191 (78%), Gaps = 0/191 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL +A+K AILNANY+  RLEKHYP+L+ G NG  AHEFI+D R FK T GIE ED+A
Sbjct  775  SEGLTNATKNAILNANYIKARLEKHYPILYTGTNGHCAHEFILDCRAFKTTIGIEVEDIA  834

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+S+PV GTLMIEPTESES  ELDRFCD +ISIR EIA+IE GK D  +
Sbjct  835  KRLMDYGFHAPTVSFPVAGTLMIEPTESESMHELDRFCDAMISIRAEIAEIENGKADKLD  894

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK+APH  S++ ADAWT+ YSR+ AA+P  +LKT KFWP+  R+D+ YGDRNL C+ +
Sbjct  895  NVLKHAPHTASVITADAWTRSYSRQKAAYPLPYLKTTKFWPSVSRIDSAYGDRNLFCSCI  954

Query  45   PVSQMVEDEAA  13
            P  +  E E A
Sbjct  955  PTEEFAEAEMA  965



>ref|XP_010304606.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like, 
partial [Balearica regulorum gibbericeps]
Length=201

 Score =   253 bits (647),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  AS+IAILNANYMAKRLEKHY +LFRG  G VAHEFI+D R FK +A IEA D+A
Sbjct  4    AKGLKHASEIAILNANYMAKRLEKHYKILFRGARGYVAHEFILDTRPFKKSANIEAVDLA  63

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL DYGFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   
Sbjct  64   KRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQI  123

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTA-KFWPTTGRVDNVYGDRNLICTL  49
            N LK +PH  + + +  W +PYSRE AAFP  ++K   KFWPT  R+D++YGD++L+CT 
Sbjct  124  NPLKMSPHTLNCVTSSKWDRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTC  183

Query  48   LPV  40
             P+
Sbjct  184  PPM  186



>ref|WP_022606719.1| glycine dehydrogenase (decarboxylating) [Rubidibacter lacunae]
 gb|ERN41620.1| glycine dehydrogenase (decarboxylating) [Rubidibacter lacunae 
KORDI 51-2]
Length=978

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  A+K+AIL+ANY+A+RL+ +YPVLFRG  G VAHE ++DLR  K  AGIE +DVA
Sbjct  791  AEGLTQATKVAILSANYVARRLDTYYPVLFRGDKGLVAHECVVDLRPLKKRAGIEVDDVA  850

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMD+G+H PT+SWPVPGT+M+EPTESE+KAELDRFC+ +I+IR+E+  IE G+ D N+
Sbjct  851  KRLMDFGYHAPTVSWPVPGTMMVEPTESETKAELDRFCEAMIAIRKEVEAIENGRADPND  910

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK+APHP ++++ADAW +PY+RE AA+PA+W++  KFWP+ GRVDN YGDRNLIC+ +
Sbjct  911  NVLKHAPHPAAVVVADAWERPYTREQAAYPAEWVRDRKFWPSVGRVDNAYGDRNLICSCI  970

Query  45   PVSQMVED  22
             +    +D
Sbjct  971  GMDAYKDD  978



>ref|WP_016874717.1| glycine dehydrogenase [Chlorogloeopsis fritschii]
Length=987

 Score =   271 bits (693),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL +A+K+AILNANY+AKRLE +YPVL++G NG VAHE I+DLR  K +AGIE +DVAKR
Sbjct  803  GLTEATKVAILNANYIAKRLETYYPVLYKGKNGFVAHECILDLRSLKKSAGIEIDDVAKR  862

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK DI +NV
Sbjct  863  LMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMIAIRQEIAEIESGKADIQDNV  922

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH    L+ D W  PYSR+ AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  923  LKNAPHTAESLIVDEWNHPYSRQQAAYPASWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  982



>ref|XP_007112412.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Physeter catodon]
Length=254

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 143/182 (79%), Gaps = 1/182 (1%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL  A++IAILNANYMAKRLEKHY VLFRG  G VAHEFI+D R FK +A IEA DVAK
Sbjct  58   KGLKQATEIAILNANYMAKRLEKHYRVLFRGARGYVAHEFILDTRPFKKSANIEAVDVAK  117

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RL DYGFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA IE+G+ D   N
Sbjct  118  RLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVN  177

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTA-KFWPTTGRVDNVYGDRNLICTLL  46
             LK +PH  + + +  W +PYSRE AAFP  ++K   KFWPTT R+D++YGD++L+CT  
Sbjct  178  PLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENKFWPTTARIDDIYGDQHLVCTCP  237

Query  45   PV  40
            P+
Sbjct  238  PM  239



>ref|XP_002503477.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
 gb|ACO64735.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
Length=988

 Score =   270 bits (691),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 147/190 (77%), Gaps = 0/190 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL +ASK AILNANYM KRLE H+P+LF G NGT AHEFIIDLR   +  GI  EDVA
Sbjct  799  SEGLTNASKRAILNANYMKKRLEDHFPILFTGKNGTCAHEFIIDLRPMTDKTGIGPEDVA  858

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL DYG+H PTMSWPV GTLMIEPTESESK ELDRFC+ +I+IREEI  IE G  D  N
Sbjct  859  KRLQDYGYHAPTMSWPVSGTLMIEPTESESKQELDRFCNAMIAIREEIRDIENGAIDKEN  918

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LK+APH  +++++D W +PYSRE AAFPA+W++ +KFWPTT R+DNVYGDRNL+ T  
Sbjct  919  NPLKHAPHTAAVVLSDKWDRPYSRETAAFPAEWVRQSKFWPTTSRIDNVYGDRNLVTTHA  978

Query  45   PVSQMVEDEA  16
             V    E+ A
Sbjct  979  QVEVAAEETA  988



>ref|WP_009094772.1| glycine dehydrogenase [Rhodopirellula sp. SWK7]
 gb|EMI46247.1| glycine dehydrogenase [Rhodopirellula sp. SWK7]
Length=990

 Score =   270 bits (691),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  A+++AILNANYMAKRL  HY +L+   NG VAHEFI+D RGF+ +AG++ ED+A
Sbjct  805  ASGLKKATQVAILNANYMAKRLSDHYDILYTDANGYVAHEFIVDCRGFEKSAGVQIEDIA  864

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFHGPTMSWPVPGTLMIEPTESESK ELDRFCD +ISIR EI  I+ G  D  +
Sbjct  865  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKDELDRFCDAMISIRAEIQSIQDGTLDAKD  924

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH    + +D W+ PY+RE AA+P  WL+ AKFWPT GR+DN YGDRNL+C+  
Sbjct  925  NPLKNAPHTVGAIGSDNWSHPYTREQAAWPKAWLRDAKFWPTVGRIDNTYGDRNLVCSCP  984

Query  45   PV  40
            P+
Sbjct  985  PM  986



>ref|WP_041036217.1| glycine dehydrogenase [Tolypothrix campylonemoides]
 gb|KIJ75906.1| glycine dehydrogenase [Tolypothrix campylonemoides VB511288]
Length=990

 Score =   270 bits (691),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL +A+K+AILNANY+AKRLE +YPVL++G NG VAHE I+DLR  K +A IE +DVA
Sbjct  806  ADGLTEATKVAILNANYIAKRLEPYYPVLYKGKNGLVAHECILDLRSLKKSASIEIDDVA  865

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +
Sbjct  866  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMIAIRQEIAEIESGKMDAQD  925

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+   W  PYSRE AA+PA W +  KFWP  GR+DN YGDRN +C+ L
Sbjct  926  NVLKNAPHTAQSLIVGEWNHPYSREQAAYPAPWTREHKFWPVVGRIDNAYGDRNFVCSCL  985

Query  45   PV  40
            P+
Sbjct  986  PM  987



>ref|WP_028981454.1| glycine dehydrogenase [Sporocytophaga myxococcoides]
Length=965

 Score =   270 bits (690),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  +++ AILNANY+  RLEK +P+L+    G  AHEFI+D R FK+T G+E ED+A
Sbjct  773  AEGLKSSTQHAILNANYIKARLEKFFPILYTNTKGRCAHEFILDCREFKHTVGVEVEDIA  832

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+S+PVPGTLMIEPTESESK ELDRFC+ +I IREEI +IE GK D  N
Sbjct  833  KRLMDYGFHAPTVSFPVPGTLMIEPTESESKEELDRFCEAMIQIREEIREIENGKADKAN  892

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK+APH   ++MAD WT+PYSRE AAFP +W++  KFWP+  RVDN YGDRNL+CT L
Sbjct  893  NVLKHAPHTAEVIMADNWTRPYSREKAAFPIEWIRLRKFWPSVSRVDNAYGDRNLVCTCL  952

Query  45   PVSQMVEDE  19
            PV      E
Sbjct  953  PVEDYASHE  961



>gb|EFA86802.1| glycine dehydrogenase [Polysphondylium pallidum PN500]
Length=1014

 Score =   270 bits (691),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = -3

Query  579   GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
             GL  A+++AILNANYMA RL+ HY +L+ G +G VAHEFIIDLR FK T GI+AEDVAKR
Sbjct  831   GLKRATQVAILNANYMASRLKDHYKILYTGSHGLVAHEFIIDLRDFKETTGIQAEDVAKR  890

Query  399   LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
             L DYGFHGPTMSWPVP TLMIEPTESESK ELDR CD LISIR EIA+IE+GK D NNN+
Sbjct  891   LQDYGFHGPTMSWPVPNTLMIEPTESESKYELDRLCDALISIRAEIAEIEQGKADRNNNL  950

Query  219   LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
             L N+PH  +++ AD W +PY+R  AA+P+   + +KFWP+ GRVDNV+GDRNL+C+  P+
Sbjct  951   LVNSPHTEAVITADTWDRPYTRARAAYPSPSTRESKFWPSVGRVDNVFGDRNLVCSCPPL  1010

Query  39    S  37
             +
Sbjct  1011  T  1011



>ref|WP_039142781.1| glycine dehydrogenase [Flavihumibacter solisilvae]
 gb|KIC93072.1| glycine dehydrogenase [Flavihumibacter solisilvae]
Length=956

 Score =   270 bits (689),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  +++ AILNANYM  RLE  YP+L+   NGT AHEFI+DLR FK +AGIEAED+A
Sbjct  767  ASGLKASTEYAILNANYMKARLESAYPILYTSHNGTCAHEFIVDLRPFKTSAGIEAEDIA  826

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMS+PVPGT+MIEPTESE KAELDRFCD L++IREEIA +E G  D  N
Sbjct  827  KRLMDYGFHAPTMSFPVPGTIMIEPTESEDKAELDRFCDALLAIREEIAAVENGTADKTN  886

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH   ++ AD W +PYSR+ AAFP  ++K  KFWP+ GRV+N  GDRNLICT  
Sbjct  887  NVLKNAPHTQFVITADEWQRPYSRQQAAFPLDYVKENKFWPSVGRVNNTVGDRNLICTCE  946

Query  45   PVSQMVE  25
            PVS   E
Sbjct  947  PVSAYEE  953



>ref|WP_023065539.1| glycine dehydrogenase [Lyngbya aestuarii]
 gb|ERT08292.1| glycine dehydrogenase [Lyngbya aestuarii BL J]
Length=992

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 147/188 (78%), Gaps = 0/188 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL +A+K+AILNANYMA RL++ YP+L++G NG +AHE I+DLRG K +A IE +D+A
Sbjct  805  AEGLTEATKVAILNANYMAHRLKESYPILYKGKNGLIAHECILDLRGVKKSANIEVDDIA  864

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPVPGT+M+EPTESESKAELDRFCD +I+IR EI+ IE G  D  N
Sbjct  865  KRLMDYGFHAPTVSWPVPGTVMVEPTESESKAELDRFCDAMIAIRREISAIESGDIDGEN  924

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH    L+   W  PYSRE AA+PA WL+  KFWP+ GR+DN YGDRN +C+ L
Sbjct  925  NPLKNAPHTAESLIVGEWNHPYSREQAAYPAPWLRDHKFWPSVGRIDNAYGDRNFVCSCL  984

Query  45   PVSQMVED  22
            P+    E+
Sbjct  985  PMEAYSEN  992



>ref|WP_017712703.1| glycine dehydrogenase [Prochlorothrix hollandica]
Length=970

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL +A+++AILNANYMA RL  HYP+L++G+ G VAHE I+DLR  K TAGIE EDVAKR
Sbjct  785  GLTEATQLAILNANYMAHRLAPHYPILYKGIGGLVAHECILDLRDLKRTAGIEVEDVAKR  844

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+E+  IE+G+ D  NN 
Sbjct  845  LMDYGFHAPTVSWPVAGTMMVEPTESESKEELDRFCDAMIAIRQEVRAIEQGQIDPLNNP  904

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LK+APH   +L+AD W +PYSRE AA+P  WL+  KFWP  GRVDN YGDRNL+C+  P+
Sbjct  905  LKHAPHTAEVLLADDWDRPYSREQAAYPLPWLRQFKFWPVVGRVDNAYGDRNLVCSCAPM  964



>emb|CCI29698.1| Glycine cleavage system P-protein (glycine dehydrogenase) (fragment) 
[Microcystis aeruginosa PCC 9809]
Length=387

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 139/178 (78%), Gaps = 0/178 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  A+++AILNANYMA RLE  YPVLF+G  GTVAHE +IDLR  K  AGIE EDVA
Sbjct  202  AAGLKKATEVAILNANYMAFRLESAYPVLFKGSAGTVAHECVIDLRPLKKQAGIEVEDVA  261

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMD+GFH PT+SWPV GT+M+EPTESES  ELDRFC+ L++I +E+  I  G  DI++
Sbjct  262  KRLMDFGFHAPTVSWPVAGTMMVEPTESESLGELDRFCEALLTIYQEVQAIANGSMDIHD  321

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  52
            N LKNAPH  ++L AD W++PYSR+ AA+P  WLK  KFWP  GRVDN YGDRNL+C+
Sbjct  322  NPLKNAPHTAAVLTADDWSRPYSRQQAAYPLSWLKDYKFWPVVGRVDNAYGDRNLVCS  379



>ref|WP_012789622.1| glycine dehydrogenase [Chitinophaga pinensis]
 gb|ACU59446.1| glycine dehydrogenase [Chitinophaga pinensis DSM 2588]
Length=956

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL  AS+ AILNANYM  RLEK Y +L+ GVNGT AHEFI+DLR FK +AGIEAEDVAK
Sbjct  768  EGLKKASQFAILNANYMKARLEKAYDILYNGVNGTCAHEFIVDLRPFKASAGIEAEDVAK  827

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMDYGFH PT+S+PV GT+MIEPTESE K ELDRFCD ++SIREEIA +E G  D  NN
Sbjct  828  RLMDYGFHAPTLSFPVAGTIMIEPTESEDKDELDRFCDAMLSIREEIAAVENGAADKLNN  887

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
            VLK+APH   ++ AD WT+PY+R+ AA+P  ++K  KFWP+  RV+N +GDRNLICT  P
Sbjct  888  VLKHAPHTQFVITADDWTRPYTRQQAAYPLDYVKLNKFWPSISRVNNTHGDRNLICTCEP  947

Query  42   VSQMVEDEA  16
            VS   E EA
Sbjct  948  VSSYAEAEA  956



>ref|WP_008684764.1| glycine dehydrogenase [Rhodopirellula sallentina]
 gb|EMI53503.1| glycine dehydrogenase [Rhodopirellula sallentina SM41]
Length=990

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  A+++AILNANYMAKRL +H+ +L+   NG VAHEFI+D RGF+ +AG++ +D+A
Sbjct  805  ASGLKKATQVAILNANYMAKRLSEHFNILYTDSNGYVAHEFIVDCRGFEKSAGVQIDDIA  864

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFHGPTMSWPVPGTLMIEPTESESK ELDRFCD +I+IREEI  I+ GK D  +
Sbjct  865  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKDELDRFCDAMIAIREEIQSIQDGKLDAKD  924

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH    + +D W+ PY+RE AA+P  WL+ AKFWPT GR+DN YGDRNL+C+  
Sbjct  925  NPLKNAPHTVGEIGSDDWSHPYTREQAAWPKAWLRDAKFWPTVGRIDNTYGDRNLVCSCP  984

Query  45   PV  40
            P+
Sbjct  985  PM  986



>ref|WP_044171749.1| glycine dehydrogenase [Oscillatoria sp. PCC 10802]
Length=977

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL +A+K+AILNANY+A+RLE +YPVL++G +G VAHE I+DLRG K +AGIE +D+AKR
Sbjct  792  GLAEATKVAILNANYIARRLEPYYPVLYKGKDGFVAHECILDLRGLKKSAGIEVDDIAKR  851

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EI +IE GK D +NNV
Sbjct  852  LMDYGFHAPTVSWPVAGTVMVEPTESESKQELDRFCDAMIAIRKEIEEIELGKADPSNNV  911

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH    L+A  W +PYSRE AA+PA W + +KFWP  GR+DN YGDR+ +C+ LPV
Sbjct  912  LKNAPHTAESLIAGEWDRPYSRERAAYPAPWTRESKFWPAVGRIDNAYGDRHFVCSCLPV  971



>ref|WP_044197707.1| glycine dehydrogenase [Oscillatoria acuminata]
Length=952

 Score =   269 bits (687),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL  A+++AILNANY+AKRLE +YPVL++G  G VAHE I+DLR  K +AGIE ED+AKR
Sbjct  767  GLTAATQVAILNANYIAKRLEPYYPVLYKGKTGLVAHECILDLRSLKKSAGIEVEDIAKR  826

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IREEI  IE G  D  NN+
Sbjct  827  LMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCEAMIAIREEIRAIEAGTMDGENNL  886

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPHP ++ +A  W +PYSRE A FPA W +  KFWP+ GR+DN YGDRNL+C  LP+
Sbjct  887  LKNAPHPATVAIASEWNRPYSREQAVFPAPWTREHKFWPSVGRIDNAYGDRNLVCACLPM  946



>gb|KIY91355.1| glycine dehydrogenase [Monoraphidium neglectum]
Length=178

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = -3

Query  534  MAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPV  355
            MAKRL  +Y VLF G  GT AHEFI+D+R FK+TAG+EAED+AKRLMDYGFH PTMSWPV
Sbjct  1    MAKRLSPYYKVLFTGRAGTCAHEFILDVRPFKDTAGVEAEDIAKRLMDYGFHAPTMSWPV  60

Query  354  PGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHPPSLLMADA  175
            PGTLMIEPTESE KAELDRF D ++SIR EIA++E GK   +NNVL +APH   +++A++
Sbjct  61   PGTLMIEPTESEPKAELDRFIDAMVSIRHEIAEVEAGKAPRDNNVLVHAPHTAQVVLAES  120

Query  174  WTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  49
            W++PYSRE AAFPA W+K AKFWPTT RVDNVYGDR+LI  L
Sbjct  121  WSRPYSREQAAFPAPWVKGAKFWPTTSRVDNVYGDRHLITRL  162



>ref|WP_006631620.1| glycine dehydrogenase [Microcoleus vaginatus]
 gb|EGK90642.1| Glycine dehydrogenase (decarboxylating) [Microcoleus vaginatus 
FGP-2]
Length=990

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL +A+K+AILNANYMAKRLE +YPVL++G  G VAHE I+DLR  K +A IE ED+AKR
Sbjct  805  GLTEATKVAILNANYMAKRLESYYPVLYKGKAGLVAHECILDLRSLKKSAAIEVEDIAKR  864

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYG+H PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IR EIA+IEKG  D  NNV
Sbjct  865  LMDYGYHAPTVSWPVAGTVMVEPTESESKQELDRFCEAMIAIRSEIAEIEKGNVDAQNNV  924

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH    LM D W +PY+R  AA+PA W +  KFWP  GR+DN +GDRN +C+ LP+
Sbjct  925  LKNAPHTAESLMVDEWNRPYTRAQAAYPAPWTREHKFWPAVGRIDNAFGDRNFVCSCLPM  984



>ref|WP_015209784.1| glycine dehydrogenase, decarboxylating [Cylindrospermum stagnale]
 gb|AFZ26542.1| glycine dehydrogenase, decarboxylating [Cylindrospermum stagnale 
PCC 7417]
Length=966

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL DA+K+AILNANY+AKRLE +YPVL++G NG VAHE I+DLR  K +A IE +DVA
Sbjct  780  ADGLTDATKVAILNANYIAKRLESYYPVLYQGKNGLVAHECILDLRDLKKSASIEIDDVA  839

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL+DYGFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IR+EIA IE GK DI +
Sbjct  840  KRLIDYGFHAPTVSWPVGGTIMVEPTESESKQELDRFCDALIAIRQEIAAIESGKADIQD  899

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N+LKNAPH    L+A  W  PYSRE AA+PA W + +KFWP  GR+D  +GDRN +C+ L
Sbjct  900  NLLKNAPHTAESLIAGEWLHPYSREQAAYPASWTRESKFWPNVGRIDAAFGDRNFVCSCL  959

Query  45   PVS  37
            P++
Sbjct  960  PMA  962



>gb|AFY83915.1| glycine dehydrogenase, decarboxylating [Oscillatoria acuminata 
PCC 6304]
Length=978

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL  A+++AILNANY+AKRLE +YPVL++G  G VAHE I+DLR  K +AGIE ED+AKR
Sbjct  793  GLTAATQVAILNANYIAKRLEPYYPVLYKGKTGLVAHECILDLRSLKKSAGIEVEDIAKR  852

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IREEI  IE G  D  NN+
Sbjct  853  LMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCEAMIAIREEIRAIEAGTMDGENNL  912

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPHP ++ +A  W +PYSRE A FPA W +  KFWP+ GR+DN YGDRNL+C  LP+
Sbjct  913  LKNAPHPATVAIASEWNRPYSREQAVFPAPWTREHKFWPSVGRIDNAYGDRNLVCACLPM  972



>ref|WP_016866657.1| glycine dehydrogenase [Fischerella muscicola]
Length=979

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL DA+K+AILNANY+AKRLE HYP+L++G NG VAHE I+DLR  K +A IE +D+A
Sbjct  794  ATGLTDATKVAILNANYIAKRLEAHYPILYQGKNGYVAHECILDLRSLKKSANIEIDDIA  853

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +ISIR+E+A+IE GK D+ +
Sbjct  854  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMISIRQEVAEIEAGKADVQD  913

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ L
Sbjct  914  NVLKNAPHTAESLIIGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCL  973

Query  45   PV  40
            P+
Sbjct  974  PM  975



>ref|WP_044035200.1| glycine dehydrogenase, partial [Microcystis aeruginosa]
Length=400

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL  A+++AILNANYMA RLE  YPVLF+G  GTVAHE +IDLR  K  AGIE EDVAKR
Sbjct  217  GLKKATEVAILNANYMAFRLESAYPVLFKGSAGTVAHECVIDLRPLKKQAGIEVEDVAKR  276

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMD+GFH PT+SWPV GT+M+EPTESES  ELDRFC+ L++I +E+  I  G  DI++N 
Sbjct  277  LMDFGFHAPTVSWPVAGTMMVEPTESESLGELDRFCEALLTIYQEVQAIANGSMDIHDNP  336

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  52
            LKNAPH  ++L AD W++PYSR+ AA+P  WLK  KFWP  GRVDN YGDRNL+C+
Sbjct  337  LKNAPHTAAVLTADDWSRPYSRQQAAYPLSWLKDYKFWPVVGRVDNAYGDRNLVCS  392



>ref|WP_009457628.1| glycine dehydrogenase [Fischerella sp. JSC-11]
 gb|EHC12211.1| Glycine dehydrogenase (decarboxylating) [Fischerella sp. JSC-11]
Length=965

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL DA+K+AILNANY+AKRLE HYP+L++G NG VAHE I+DLR  K +A IE +D+A
Sbjct  780  ATGLTDATKVAILNANYIAKRLEAHYPILYQGKNGYVAHECILDLRSLKKSANIEIDDIA  839

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +ISIR+E+A+IE GK D+ +
Sbjct  840  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMISIRQEVAEIEAGKADVQD  899

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ L
Sbjct  900  NVLKNAPHTAESLIIGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCL  959

Query  45   PV  40
            P+
Sbjct  960  PM  961



>ref|XP_010074869.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Pterocles gutturalis]
Length=361

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  AS+IAILNANYMAKRLEKHY VLFRG  G VAHEFI+D R FK TA IEA D+A
Sbjct  164  AKGLKHASEIAILNANYMAKRLEKHYKVLFRGARGYVAHEFILDTRPFKKTANIEAVDLA  223

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL DYGFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA +E+G+ D   
Sbjct  224  KRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADVEEGRMDPQI  283

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTL  49
            N LK +PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT 
Sbjct  284  NPLKMSPHTLNCVTSSKWDRPYSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTC  343

Query  48   LPV  40
             PV
Sbjct  344  PPV  346



>ref|WP_016870901.1| glycine dehydrogenase [Fischerella thermalis]
Length=965

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL DA+K+AILNANY+AKRLE HYP+L++G NG VAHE I+DLR  K +A IE +D+A
Sbjct  780  ATGLTDATKVAILNANYIAKRLEAHYPILYQGKNGYVAHECILDLRSLKKSANIEIDDIA  839

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +ISIR+E+A+IE GK D+ +
Sbjct  840  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMISIRQEVAEIEAGKADVQD  899

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ L
Sbjct  900  NVLKNAPHTAESLIIGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCL  959

Query  45   PV  40
            P+
Sbjct  960  PM  961



>ref|XP_010129815.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Buceros rhinoceros silvestris]
Length=405

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  AS+IAILNANYMAKRLEKHY +LFRG  G VAHEFI+D R FK TA IEA D+A
Sbjct  208  AKGLKHASEIAILNANYMAKRLEKHYKILFRGARGYVAHEFILDTRPFKKTANIEAVDLA  267

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL DYGFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   
Sbjct  268  KRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQI  327

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTL  49
            N LK +PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT 
Sbjct  328  NPLKMSPHTLNCVTSSKWDRPYSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTC  387

Query  48   LPV  40
             PV
Sbjct  388  PPV  390



>ref|WP_011140250.1| glycine dehydrogenase [Gloeobacter violaceus]
 ref|NP_923192.1| glycine dehydrogenase [Gloeobacter violaceus PCC 7421]
 dbj|BAC88187.1| glycine cleavage system protein P [Gloeobacter violaceus PCC 
7421]
Length=998

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL +A+K+AILNANY+A RL  HYPVL++G  G VAHE I+DLR  K TAGIE +DVAKR
Sbjct  811  GLTEATKVAILNANYIAHRLAPHYPVLYKGAGGLVAHECILDLRKLKTTAGIEVDDVAKR  870

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+MIEPTESES  ELDRFC+ LI+IR EIA IE+G+ D  +N 
Sbjct  871  LMDYGFHAPTVSWPVAGTIMIEPTESESLEELDRFCEALIAIRHEIAAIERGEADRADNP  930

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH  ++L+AD+W  PYSR  AA+PA WL   KFWP   R+DNVYGDRNLIC+ LP+
Sbjct  931  LKNAPHTAAVLLADSWEHPYSRAQAAYPAPWLYQHKFWPVVSRIDNVYGDRNLICSCLPM  990

Query  39   SQMVED  22
                +D
Sbjct  991  EAYAQD  996



>ref|WP_016546738.1| glycine dehydrogenase [Leptospira wolffii]
 gb|EPG65452.1| glycine dehydrogenase [Leptospira wolffii Serovar Khorat Str. 
Khorat-H2]
Length=962

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL  +++ AILNANY+AKRLE +YPVL++G NG VAHE I+D+R FK  +G+E EDVA
Sbjct  777  SEGLRQSTEAAILNANYIAKRLENYYPVLYKGKNGLVAHECILDVRPFKKASGVEVEDVA  836

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMS+PVPGTLMIEPTESESK ELDRFC+ +I I  EI +IE GK D  +
Sbjct  837  KRLMDYGFHAPTMSFPVPGTLMIEPTESESKEELDRFCEAMIRIHGEIQEIENGKADAKD  896

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKN+PH  ++++ D+W+  YSRE AA+PA W K  KFWP  GR+DNVYGDRNL+C+ L
Sbjct  897  NVLKNSPHTAAMVIGDSWSHAYSREKAAYPAPWTKEHKFWPYVGRIDNVYGDRNLVCSCL  956

Query  45   PVSQ  34
            P+ +
Sbjct  957  PIEE  960



>dbj|GAL84002.1| glycine dehydrogenase [Sporocytophaga myxococcoides]
Length=965

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  +++ AILNANY+  RLEK YP+L+    G  AHEFI+D R FK++ G+E ED+A
Sbjct  773  AEGLKSSTQHAILNANYIKARLEKFYPILYTNTKGRCAHEFILDCREFKHSVGVEVEDIA  832

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+S+PVPGTLMIEPTESESK ELDRFC+ +I IREEI +IE GK D  N
Sbjct  833  KRLMDYGFHAPTVSFPVPGTLMIEPTESESKEELDRFCEAMIQIREEIREIENGKADKVN  892

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK+APH   ++MAD WT+PY+RE AAFP +W++  KFWP+  R+DN YGDRNL+CT L
Sbjct  893  NVLKHAPHTAEVIMADNWTRPYTREKAAFPIEWIRQRKFWPSVSRIDNAYGDRNLVCTCL  952

Query  45   PVSQMVEDE  19
            PV      E
Sbjct  953  PVEDYASHE  961



>ref|XP_009490955.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Pelecanus crispus]
Length=361

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  AS+IAILNANYMAKRLEKHY +LFRG  G VAHEFI+D R FK TA IEA D+A
Sbjct  164  AKGLKHASEIAILNANYMAKRLEKHYKILFRGARGYVAHEFILDTRPFKKTANIEAVDLA  223

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL DYGFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   
Sbjct  224  KRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQI  283

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTL  49
            N LK +PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT 
Sbjct  284  NPLKMSPHTLNCVTSSKWDRPYSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTC  343

Query  48   LPV  40
             P+
Sbjct  344  PPM  346



>ref|WP_035999593.1| glycine dehydrogenase [Leptolyngbya sp. JSC-1]
Length=1011

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = -3

Query  582   QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
             +GL +A+KIAILNANY+AKRLE HYPVL++G NG VAHE I+DLR FK TA IE +D+AK
Sbjct  826   EGLTEATKIAILNANYIAKRLEGHYPVLYKGKNGLVAHECILDLRQFKKTAAIEVDDIAK  885

Query  402   RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
             RL+DYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR EI +IE  + D  NN
Sbjct  886   RLIDYGFHPPTVSWPVAGTIMVEPTESESKQELDRFCDAMIAIRAEIREIEADQVDRQNN  945

Query  222   VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
             +LKNAPH  + L++D W +PYSRE AA+P QW + +KFW    R+DN YGDRNL+C  LP
Sbjct  946   LLKNAPHSAASLLSDQWDRPYSRERAAYPTQWTRDSKFWAAVDRIDNAYGDRNLVCACLP  1005

Query  42    V  40
             +
Sbjct  1006  M  1006



>ref|WP_002155590.1| glycine dehydrogenase-like protein [Leptospira interrogans]
 gb|EMO24999.1| glycine dehydrogenase-like protein [Leptospira interrogans serovar 
Bataviae str. HAI135]
Length=512

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL +A++ +ILNANY+AKRLEK YPVL++G NG VAHE I+DLR FK +AGIE EDVA
Sbjct  327  SEGLTNATRNSILNANYIAKRLEKVYPVLYKGKNGFVAHECILDLRPFKKSAGIEVEDVA  386

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL+DYGFH PTMS+PVPGTLMIEPTESES  ELDRFC+ ++ I +EI  ++ G  D  +
Sbjct  387  KRLIDYGFHAPTMSFPVPGTLMIEPTESESLEELDRFCEAMLLIFQEILDVQNGILDKTD  446

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N+LKN+PH  +++ +D W   YSRE AA+PA WLK  KFWP  GRVDNVYGDRNL+C+ L
Sbjct  447  NLLKNSPHTAAMVTSDRWDHLYSRERAAYPASWLKDHKFWPYVGRVDNVYGDRNLVCSCL  506

Query  45   PV  40
            P+
Sbjct  507  PI  508



>ref|WP_015175278.1| Glycine dehydrogenase (decarboxylating) [Oscillatoria nigro-viridis]
 gb|AFZ05957.1| Glycine dehydrogenase (decarboxylating) [Oscillatoria nigro-viridis 
PCC 7112]
Length=990

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL +A+K+AILNANYMAKRLE +YPVL++G  G VAHE I+DLR  K +A IE ED+AKR
Sbjct  805  GLTEATKVAILNANYMAKRLESYYPVLYKGKAGLVAHECILDLRSLKKSAAIEVEDIAKR  864

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYG+H PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IR EIA+IEKG  D  NNV
Sbjct  865  LMDYGYHAPTVSWPVAGTVMVEPTESESKQELDRFCEAMIAIRGEIAEIEKGNVDAQNNV  924

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH    LM D W +PY+R  AA+PA W +  KFWP  GR+DN +GDRN +C+ LP+
Sbjct  925  LKNAPHTAESLMVDEWNRPYTRAQAAYPAPWTREHKFWPAVGRIDNAFGDRNFVCSCLPM  984



>ref|WP_020531529.1| glycine dehydrogenase [Flexithrix dorotheae]
Length=966

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 147/190 (77%), Gaps = 1/190 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            +QGL +A+K AILNANYM  RLE HYPVLF G NG VAHE IID R FK   GIE ED+A
Sbjct  778  TQGLENATKHAILNANYMKSRLESHYPVLFTGKNGRVAHEMIIDCRAFK-AFGIEVEDIA  836

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+S+PV GTLMIEPTESE+K+ELDRFCD +I+IREE+ ++E G  D   
Sbjct  837  KRLMDYGFHAPTVSFPVAGTLMIEPTESETKSELDRFCDAMIAIREEVNEVENGTADKLE  896

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH  +++M+D W KPYSRE AAFP  +L   KFWP+  R+DN +GDRNLIC+ L
Sbjct  897  NVLKNAPHTANMVMSDNWEKPYSREKAAFPLPYLSQNKFWPSVRRIDNAFGDRNLICSCL  956

Query  45   PVSQMVEDEA  16
            PV   +E+ A
Sbjct  957  PVEDFIEEPA  966



>ref|WP_020769690.1| glycine dehydrogenase [Leptospira sp. B5-022]
 gb|EMJ99913.1| glycine dehydrogenase [Leptospira sp. B5-022]
Length=962

 Score =   268 bits (684),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  A+K AILNANY+AKRLE ++PVL++G NG VAHE I+D+R FK T+G+E ED+A
Sbjct  777  TEGLEQATKAAILNANYIAKRLENYFPVLYKGKNGFVAHECILDVRPFKKTSGVEVEDIA  836

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMS+PVPGTLMIEPTESES+ ELDRFC+ +ISI  EI +IE+GK D+ +
Sbjct  837  KRLMDYGFHAPTMSFPVPGTLMIEPTESESQEELDRFCEAMISIHAEIQEIEQGKADLKD  896

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH  +++++D W   YSRE AA+PA W K  KFWP  GR+DNVYGDRNL+C+ L
Sbjct  897  NPLKNAPHTSAMVISDNWNHAYSREQAAYPAPWTKEHKFWPYVGRIDNVYGDRNLVCSCL  956

Query  45   P  43
            P
Sbjct  957  P  957



>ref|WP_027401604.1| glycine dehydrogenase [Aphanizomenon flos-aquae]
Length=967

 Score =   268 bits (685),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL +A+KIAILNANYMAK+LE +YPVL++G NG VAHE I+DLR  K +A IE +DVA
Sbjct  782  ADGLTEATKIAILNANYMAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVA  841

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IREE+A IE GK DI++
Sbjct  842  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKQELDRFCDALIAIREEVAAIESGKMDIHD  901

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N+LKNAPH    L+   W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ L
Sbjct  902  NLLKNAPHTAESLIVGEWNHPYSREQAAYPAPWNKEYKFWPSVGRIDAAFGDRNFVCSCL  961

Query  45   PV  40
            P+
Sbjct  962  PM  963



>ref|WP_039200768.1| glycine dehydrogenase [Aphanizomenon flos-aquae]
 gb|KHG42226.1| glycine dehydrogenase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=967

 Score =   268 bits (684),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL +A+KIAILNANYMAK+LE +YPVL++G NG VAHE I+DLR  K +A IE +DVA
Sbjct  782  ADGLTEATKIAILNANYMAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVA  841

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IREE+A IE GK DI++
Sbjct  842  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKQELDRFCDALIAIREEVAAIESGKMDIHD  901

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N+LKNAPH    L+   W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ L
Sbjct  902  NLLKNAPHTAESLIVGEWNHPYSREQAAYPAPWNKEYKFWPSVGRIDAAFGDRNFVCSCL  961

Query  45   PV  40
            P+
Sbjct  962  PM  963



>ref|WP_017320159.1| glycine dehydrogenase [cyanobacterium PCC 7702]
Length=970

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  A+K+AILNANY+AKRLE +YPVL+RG NG VAHE I+DLR  K +AGIE +D+A
Sbjct  785  TTGLTQATKVAILNANYIAKRLEAYYPVLYRGKNGFVAHECILDLRSLKKSAGIEVDDIA  844

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IR+EIA+IE GK D+ +
Sbjct  845  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKQELDRFCEAMIAIRQEIAEIESGKADLQD  904

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ L
Sbjct  905  NVLKNAPHTAESLIVGEWNHPYSREQAAYPAPWTREYKFWPAVGRIDAAFGDRNFVCSCL  964

Query  45   PV  40
            P+
Sbjct  965  PM  966



>ref|WP_011584413.1| glycine dehydrogenase [Cytophaga hutchinsonii]
 gb|ABG58298.1| glycine dehydrogenase (decarboxylating) alpha subunit / glycine 
dehydrogenase (decarboxylating) beta subunit [Cytophaga hutchinsonii 
ATCC 33406]
Length=966

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 148/191 (77%), Gaps = 0/191 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL +A+K AILNANY+  RLEK YP+L+ G +G  AHEFI+D R FK T GIE ED+A
Sbjct  775  SEGLTNATKNAILNANYIKSRLEKFYPILYTGTHGHCAHEFILDCRAFKTTIGIEVEDIA  834

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+S+PV GTLMIEPTESESK ELDRFCD +I+IR EIA+IE G  D  +
Sbjct  835  KRLMDYGFHAPTVSFPVAGTLMIEPTESESKHELDRFCDAMIAIRAEIAEIENGTADKLD  894

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLK+APH  S++ ADAWT+ YSR+ AA+P  +LKT KFWP+  R+D+ YGDRNL C+ +
Sbjct  895  NVLKHAPHTASVITADAWTRSYSRQKAAYPLPYLKTTKFWPSVSRIDSAYGDRNLFCSCI  954

Query  45   PVSQMVEDEAA  13
            P  +  E E A
Sbjct  955  PTEEFAEAELA  965



>ref|WP_026721410.1| glycine dehydrogenase [Fischerella sp. PCC 9431]
Length=971

 Score =   268 bits (684),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL DA+K+AILNANY+AKRLE HYP+L++G NG VAHE I+DLR  K +A IE +D+AKR
Sbjct  788  GLTDATKVAILNANYIAKRLEAHYPILYQGKNGYVAHECILDLRSLKKSASIEIDDIAKR  847

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESK ELDRFC+ +ISIR E+A+IE GK D+ +NV
Sbjct  848  LMDYGFHAPTVSWPVAGTIMVEPTESESKQELDRFCEAMISIRREVAEIEAGKADLQDNV  907

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  908  LKNAPHTAESLIIGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPI  967



>ref|XP_009955956.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Leptosomus discolor]
Length=361

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  AS+IAILNANYMAKRLEKHY +LFRG  G VAHEFI+D R FK TA IE  D+A
Sbjct  164  AKGLKHASEIAILNANYMAKRLEKHYKILFRGTRGYVAHEFILDTRPFKKTANIEVVDLA  223

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL DYGFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   
Sbjct  224  KRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQI  283

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTL  49
            N LK +PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT 
Sbjct  284  NPLKMSPHTLNCVTSSKWDRPYSRELAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTC  343

Query  48   LPV  40
             P+
Sbjct  344  PPM  346



>ref|WP_016550019.1| glycine dehydrogenase [Leptospira fainei]
 gb|EPG73540.1| glycine dehydrogenase [Leptospira fainei serovar Hurstbridge 
str. BUT 6]
Length=963

 Score =   267 bits (683),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL  A+K+AILNANY+AKRLE +YPVL++G  G VAHE I+D+R FK T+GIE EDVA
Sbjct  776  SKGLEHATKVAILNANYIAKRLENYYPVLYKGKQGFVAHECILDVRPFKKTSGIEVEDVA  835

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMS+PVPGTLMIEPTESES+ ELDRFC+ +I I +EI +I  GK D  +
Sbjct  836  KRLMDYGFHAPTMSFPVPGTLMIEPTESESQEELDRFCEAMILIHDEIKEIADGKADPKD  895

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH  +++++D+W   Y+RE AA+PA W K  KFWP  GR+DNVYGDRNL+C+ L
Sbjct  896  NPLKNAPHTAAMVISDSWKHAYTREKAAYPASWTKEHKFWPYVGRIDNVYGDRNLVCSCL  955

Query  45   PVSQMVED  22
            P+   +E+
Sbjct  956  PIEDYLEN  963



>ref|WP_017319421.1| glycine dehydrogenase [Mastigocladopsis repens]
Length=981

 Score =   267 bits (683),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL +A+K+AILNANY+AK+LE +YPVL++G NG VAHE I+DLR  K +A IE +DVA
Sbjct  797  ADGLTEATKVAILNANYIAKKLEPYYPVLYKGKNGLVAHECILDLRSLKKSALIEIDDVA  856

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +
Sbjct  857  KRLMDYGFHAPTVSWPVSGTIMVEPTESESKEELDRFCDAMIAIRQEIAEIESGKMDAQD  916

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+   W  PYSRE AA+PA W +  KFWP  GR+DN YGDRN +C+ L
Sbjct  917  NVLKNAPHTAESLIVGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDNAYGDRNFVCSCL  976

Query  45   PV  40
            P+
Sbjct  977  PM  978



>gb|KIJ83529.1| glycine dehydrogenase [Scytonema tolypothrichoides VB-61278]
Length=967

 Score =   267 bits (682),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  A+K+AILNANY+AKRLE +YPVL++G NG VAHE I+DLR  K +A IE +D+A
Sbjct  783  ADGLTQATKVAILNANYIAKRLESYYPVLYKGKNGLVAHECILDLRSLKKSANIEIDDIA  842

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +
Sbjct  843  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMIAIRQEIAEIESGKMDAQD  902

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+   W  PYSRE AA+PA W +  KFWP+ GR+D  YGDRN +C+ L
Sbjct  903  NVLKNAPHTAESLIVGEWNHPYSREQAAYPAPWTREHKFWPSVGRIDAAYGDRNFVCSCL  962

Query  45   PV  40
            P+
Sbjct  963  PM  964



>ref|WP_027255179.1| glycine dehydrogenase [Planktothrix agardhii]
Length=958

 Score =   267 bits (682),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL +A+K+AILNANY+A RL+K+YP+L++G  G VAHE I+DLRG K +AGIE +D+A
Sbjct  773  AKGLTEATKLAILNANYIASRLDKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIA  832

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESKAELDRFCD +I+I +EI++IE G  D  N
Sbjct  833  KRLMDYGFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMIAIYQEISEIESGAMDATN  892

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N+LKNAPH    L+   W  PYSRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ L
Sbjct  893  NMLKNAPHTAISLLCGEWNHPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCL  952

Query  45   PV  40
            P+
Sbjct  953  PM  954



>ref|WP_043938103.1| glycine dehydrogenase [Planktothrix rubescens]
Length=961

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL +A+K+AILNANY+A RL+K+YP+L++G  G VAHE I+DLRG K +AGIE +D+AK
Sbjct  777  KGLTEATKLAILNANYIASRLDKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAK  836

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMDYGFH PT+SWPV GT+M+EPTESESKAELDRFCD +I+I +EI++IE G  D  NN
Sbjct  837  RLMDYGFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMIAIYQEISEIESGAMDATNN  896

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
            +LKNAPH    L+   W  PYSRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP
Sbjct  897  MLKNAPHTAISLLCGEWNHPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLP  956

Query  42   V  40
            +
Sbjct  957  M  957



>ref|WP_026795376.1| MULTISPECIES: glycine dehydrogenase [Planktothrix]
Length=958

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL +A+K+AILNANY+A RL+K+YP+L++G  G VAHE I+DLRG K +AGIE +D+AK
Sbjct  774  KGLTEATKLAILNANYIASRLDKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAK  833

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+I +EI+QIE G  D  NN
Sbjct  834  RLMDYGFHAPTVSWPVAGTMMVEPTESESKPELDRFCDAMIAIYQEISQIESGAMDATNN  893

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
            +LKNAPH    L+   W +PYSRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP
Sbjct  894  MLKNAPHTAISLLCGEWNRPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLP  953

Query  42   V  40
            +
Sbjct  954  M  954



>ref|WP_017309685.1| glycine dehydrogenase [Fischerella sp. PCC 9339]
Length=980

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL DA+K+AILNANY+AKRLE HYP+L++G NG VAHE I+DLR  K +A IE +D+AKR
Sbjct  797  GLTDATKVAILNANYIAKRLEAHYPILYQGKNGYVAHECILDLRSLKKSASIEIDDIAKR  856

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESK ELDRFC+ +ISIR E+A+IE GK D+ +NV
Sbjct  857  LMDYGFHAPTVSWPVAGTIMVEPTESESKQELDRFCEAMISIRHEVAEIEAGKADLQDNV  916

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  917  LKNAPHTAESLIIGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  976



>ref|WP_027846740.1| glycine dehydrogenase [Mastigocoleus testarum]
Length=977

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL  A+K+AILNANY+AK+L++HYPVL++G NG VAHE I+DLR  K +AGIE +D+AKR
Sbjct  793  GLTQATKVAILNANYIAKKLQEHYPVLYKGKNGLVAHECILDLRSLKKSAGIEIDDIAKR  852

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESK E+DRFCD +I+IR+E+A+IE GK D  NNV
Sbjct  853  LMDYGFHAPTVSWPVAGTIMVEPTESESKQEIDRFCDAMIAIRQEVAEIEAGKVDTENNV  912

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH    L+   W  PYSRE AA+PA W K  KFWP+  R+D  +GDRN +C+ LP+
Sbjct  913  LKNAPHTAESLIIGEWNHPYSREQAAYPAPWTKDNKFWPSVSRIDAAFGDRNFVCSCLPM  972



>ref|WP_026796741.1| glycine dehydrogenase [Planktothrix prolifica]
Length=958

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL +A+K+AILNANY+A RL+K+YP+L++G  G VAHE I+DLRG K +AGIE +D+AK
Sbjct  774  KGLTEATKLAILNANYIASRLDKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAK  833

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMDYGFH PT+SWPV GT+M+EPTESESKAELDRFCD +I+I +EI++IE G  D  NN
Sbjct  834  RLMDYGFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMIAIYQEISEIESGAMDATNN  893

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
            +LKNAPH    L+   W  PYSRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP
Sbjct  894  MLKNAPHTAISLLCGEWNHPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLP  953

Query  42   V  40
            +
Sbjct  954  M  954



>ref|WP_012627655.1| glycine dehydrogenase [Cyanothece sp. PCC 7425]
 gb|ACL44578.1| glycine dehydrogenase [Cyanothece sp. PCC 7425]
Length=996

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL +A++IAILNANY+AKRLE  YPVL++G NG VAHE I+DLR  K +AGIE ED+AK
Sbjct  811  EGLTEATRIAILNANYIAKRLEPFYPVLYKGTNGWVAHECILDLRPLKKSAGIEVEDIAK  870

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMDYGFH PT+SWPVPGT+MIEPTESESKAELDRFC+ +I+IR EIAQIE G  D  +N
Sbjct  871  RLMDYGFHAPTVSWPVPGTIMIEPTESESKAELDRFCEAMIAIRAEIAQIETGASDPQDN  930

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
             LK+APH  +++ AD W   YSRE AA+PA W +  KFWP+  R+DN YGDR+L+CT LP
Sbjct  931  PLKHAPHTAAMVTADRWDHAYSREQAAYPAPWTQAFKFWPSVARIDNAYGDRHLVCTCLP  990

Query  42   V  40
            +
Sbjct  991  M  991



>ref|WP_021263190.1| hypothetical protein [Pseudomonas aeruginosa]
 gb|EQL44233.1| hypothetical protein M770_29135 [Pseudomonas aeruginosa VRFPA03]
Length=210

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL  AS++AILNANY+A RLE+HYPVL+ G NG VAHE I+DLR  K+++GI  +DVAK
Sbjct  25   EGLKRASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVAK  84

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMD+GFH PTMS+PV GTLMIEPTESESKAELDRFCD +I IREEI  +E+G+ D  +N
Sbjct  85   RLMDFGFHAPTMSFPVAGTLMIEPTESESKAELDRFCDAMIRIREEIRAVERGELDKEDN  144

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
             LKNAPH  + L+ + W   YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  P
Sbjct  145  PLKNAPHTAAELLGE-WNHAYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCPP  203

Query  42   VSQMVED  22
            +    E+
Sbjct  204  IEAYSEE  210



>ref|WP_042157536.1| glycine dehydrogenase [Planktothrix agardhii]
 gb|KEI67393.1| GcvP [Planktothrix agardhii NIVA-CYA 126/8]
Length=961

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL +A+K+AILNANY+A RL+K+YP+L++G  G VAHE I+DLRG K +AGIE +D+AK
Sbjct  777  KGLTEATKLAILNANYIASRLDKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAK  836

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+I +EI+QIE G  D  NN
Sbjct  837  RLMDYGFHAPTVSWPVAGTMMVEPTESESKPELDRFCDAMIAIYQEISQIESGAMDATNN  896

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
            +LKNAPH    L+   W +PYSRE AA+PA W K  KFWP+ GR+DN +GDRN +C+ LP
Sbjct  897  MLKNAPHTAISLLCGEWNRPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFVCSCLP  956

Query  42   V  40
            +
Sbjct  957  M  957



>ref|WP_026752074.1| glycine dehydrogenase [Sediminibacterium sp. C3]
Length=957

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 147/190 (77%), Gaps = 0/190 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + G+  +++ AILNANYM  RLEKHYP+L+ G NGT AHEFI+DLR FK +AG+EAEDVA
Sbjct  768  ADGIRMSTEYAILNANYMKARLEKHYPILYTGKNGTCAHEFIVDLRPFKQSAGVEAEDVA  827

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL+DYGFH PTMS+PV GT+MIEPTESE KAELDRFCD LI+I  EI  IE GK D  N
Sbjct  828  KRLIDYGFHAPTMSFPVAGTIMIEPTESEDKAELDRFCDALIAIHGEIKDIESGKADKAN  887

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH  +++ AD WT+PY+R+ AAFP  ++   KFWP+  RV+N +GDRNLICT  
Sbjct  888  NPLKNAPHTQAVVCADEWTRPYTRQEAAFPLYYVTLNKFWPSVARVNNTHGDRNLICTCE  947

Query  45   PVSQMVEDEA  16
            PVS   E+ A
Sbjct  948  PVSSYAEENA  957



>ref|WP_041226533.1| glycine dehydrogenase [Crinalium epipsammum]
Length=969

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S GL  A+++AILNANY+AKRLE +YPVL++G NG VAHE I+DLR FK TA IE +D+A
Sbjct  783  SAGLTKATEVAILNANYIAKRLEAYYPVLYQGKNGLVAHECILDLRQFKKTAEIEVDDIA  842

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL+DYGFH PT+SWPVPGT+M+EPTESESK ELDRFCD +I+IREEIA+IE GK +  N
Sbjct  843  KRLIDYGFHPPTVSWPVPGTIMVEPTESESKQELDRFCDAMIAIREEIAEIESGKVERKN  902

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH  + L A  W +PYSRE A +P   ++  KFWP  GR+D  YGDRNL+C+ L
Sbjct  903  NVLKNAPHTAADLTASEWNRPYSREQAVYPVNGVREHKFWPAVGRIDQAYGDRNLVCSCL  962

Query  45   PV  40
            P+
Sbjct  963  PM  964



>gb|AFZ12851.1| Glycine dehydrogenase (decarboxylating) [Crinalium epipsammum 
PCC 9333]
Length=1015

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             S GL  A+++AILNANY+AKRLE +YPVL++G NG VAHE I+DLR FK TA IE +D+A
Sbjct  829   SAGLTKATEVAILNANYIAKRLEAYYPVLYQGKNGLVAHECILDLRQFKKTAEIEVDDIA  888

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRL+DYGFH PT+SWPVPGT+M+EPTESESK ELDRFCD +I+IREEIA+IE GK +  N
Sbjct  889   KRLIDYGFHPPTVSWPVPGTIMVEPTESESKQELDRFCDAMIAIREEIAEIESGKVERKN  948

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLKNAPH  + L A  W +PYSRE A +P   ++  KFWP  GR+D  YGDRNL+C+ L
Sbjct  949   NVLKNAPHTAADLTASEWNRPYSREQAVYPVNGVREHKFWPAVGRIDQAYGDRNLVCSCL  1008

Query  45    PV  40
             P+
Sbjct  1009  PM  1010



>ref|WP_041919296.1| glycine dehydrogenase [Gloeocapsa sp. PCC 7428]
Length=969

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 144/185 (78%), Gaps = 0/185 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL  A+K+AILNANY+A RL  +YPVL+RG +G VAHE I+DLR  K +AGIE +D+AKR
Sbjct  785  GLTQATKVAILNANYIAHRLAPYYPVLYRGKSGLVAHECILDLRFLKKSAGIEVDDIAKR  844

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESKAELDRFC+ +I IR+EIA+IE GK D+++NV
Sbjct  845  LMDYGFHAPTVSWPVAGTMMVEPTESESKAELDRFCEAMIQIRQEIAEIEAGKVDMHDNV  904

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH    L++  W  PYSRE AA+P  W +  KFW T GR+DN YGDRN +C+ LP+
Sbjct  905  LKNAPHTADALISSDWQHPYSREQAAYPTSWTREHKFWTTVGRIDNAYGDRNFVCSCLPM  964

Query  39   SQMVE  25
                E
Sbjct  965  EAYSE  969



>gb|AFZ32122.1| Glycine dehydrogenase (decarboxylating) [Gloeocapsa sp. PCC 7428]
Length=979

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 144/185 (78%), Gaps = 0/185 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL  A+K+AILNANY+A RL  +YPVL+RG +G VAHE I+DLR  K +AGIE +D+AKR
Sbjct  795  GLTQATKVAILNANYIAHRLAPYYPVLYRGKSGLVAHECILDLRFLKKSAGIEVDDIAKR  854

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESKAELDRFC+ +I IR+EIA+IE GK D+++NV
Sbjct  855  LMDYGFHAPTVSWPVAGTMMVEPTESESKAELDRFCEAMIQIRQEIAEIEAGKVDMHDNV  914

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH    L++  W  PYSRE AA+P  W +  KFW T GR+DN YGDRN +C+ LP+
Sbjct  915  LKNAPHTADALISSDWQHPYSREQAAYPTSWTREHKFWTTVGRIDNAYGDRNFVCSCLPM  974

Query  39   SQMVE  25
                E
Sbjct  975  EAYSE  979



>dbj|BAB26854.1| unnamed protein product [Mus musculus]
Length=189

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 137/178 (77%), Gaps = 1/178 (1%)
 Frame = -3

Query  558  IAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFH  379
            IAILNANYMAKRLEKHY VLFRG  G VAHEFI+D R FK +A +EA DVAKRL DYGFH
Sbjct  1    IAILNANYMAKRLEKHYRVLFRGARGYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFH  60

Query  378  GPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVLKNAPHP  199
             PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA IE+G+ D   N LK +PH 
Sbjct  61   APTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHS  120

Query  198  PSLLMADAWTKPYSREYAAFPAQWLKTA-KFWPTTGRVDNVYGDRNLICTLLPVSQMV  28
             + + +  W +PYSRE AAFP  ++K   KFWPT  R+D++YGD++L+CT  P+   V
Sbjct  121  LTCVTSSCWDRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYV  178



>ref|WP_019487125.1| glycine dehydrogenase [Kamptonema formosum]
Length=984

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL +A+K+AILNANY+A+RLE +YPVL++G  G VAHE I+DLR  K +AGIE ED+AK
Sbjct  793  EGLTEATKVAILNANYIARRLESYYPVLYKGKAGLVAHECILDLRSLKKSAGIEVEDIAK  852

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IR+EI +IE GK D  NN
Sbjct  853  RLMDYGFHAPTVSWPVAGTVMVEPTESESKEELDRFCEAMIAIRKEIEEIENGKMDATNN  912

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
            +LKNAPH    LM   W  PYSRE AA+PA W +  KFWP  GR+DN +GDRN +C+ LP
Sbjct  913  LLKNAPHTAESLMVSEWNHPYSREAAAYPAPWTREYKFWPAVGRIDNAFGDRNFVCSCLP  972

Query  42   V  40
            +
Sbjct  973  M  973



>ref|WP_010571257.1| glycine dehydrogenase [Leptospira broomii]
 gb|EQA44571.1| glycine dehydrogenase [Leptospira broomii serovar Hurstbridge 
str. 5399]
Length=963

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            SQGL  A+K AILNANY+AKRLE +YPVL++G +G VAHE I+D+R FK T+GIE EDVA
Sbjct  776  SQGLEHATKAAILNANYIAKRLENYYPVLYKGKHGFVAHECILDVRPFKKTSGIEVEDVA  835

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMS+PVPGTLMIEPTESES+ ELDRFC+ +I I +EI +IE GK D  +
Sbjct  836  KRLMDYGFHAPTMSFPVPGTLMIEPTESESQEELDRFCEAMILIHDEIKEIEGGKADPKD  895

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH   ++ +D+W   Y+RE AA+P  W K  KFWP  GR+DNVYGDRNL+C+ L
Sbjct  896  NPLKNAPHTAQMVTSDSWKHAYTREKAAYPTNWTKEHKFWPYVGRIDNVYGDRNLVCSCL  955

Query  45   PVSQMVED  22
            P+   +++
Sbjct  956  PIEDYLQN  963



>ref|WP_008590214.1| glycine dehydrogenase [Leptospira licerasiae]
 gb|EIE02495.1| glycine dehydrogenase [Leptospira licerasiae serovar Varillal 
str. VAR 010]
 gb|EJZ42800.1| glycine dehydrogenase [Leptospira licerasiae str. MMD4847]
Length=962

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  A+K AILNANY+AKRLE ++PVL++G NG VAHE I+D+R FK T+G+E ED+A
Sbjct  777  TEGLEQATKAAILNANYIAKRLENYFPVLYKGKNGFVAHECILDVRPFKKTSGVEVEDIA  836

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMS+PVPGTLMIEPTESES+ ELDRFC+ +ISI  EI +IE+GK D  +
Sbjct  837  KRLMDYGFHAPTMSFPVPGTLMIEPTESESQEELDRFCEAMISIHSEIQEIEQGKADAKD  896

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH  +++++D W   YSRE AA+P+ W K  KFWP  GR+DNVYGDRNL+C+ L
Sbjct  897  NPLKNAPHTSAMVISDNWDHAYSREKAAYPSAWTKEHKFWPYVGRIDNVYGDRNLVCSCL  956

Query  45   P  43
            P
Sbjct  957  P  957



>ref|WP_026103942.1| glycine dehydrogenase [Anabaena sp. PCC 7108]
Length=974

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL +A+KIAILNANY+AK+LE +YPVL++G NG VAHE I+DLR  K +A IE +DVA
Sbjct  789  ADGLTEATKIAILNANYIAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVA  848

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IREE+A IE GK DI++
Sbjct  849  KRLMDYGFHAPTVSWPVGGTIMVEPTESESKQELDRFCDALIAIREEVAAIESGKMDIHD  908

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N+LKNAPH    L+   W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ L
Sbjct  909  NLLKNAPHTAESLIVGEWNHPYSREQAAYPAPWNKEYKFWPSVGRIDAAFGDRNFVCSCL  968

Query  45   PV  40
            P+
Sbjct  969  PM  970



>ref|XP_009699383.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial, 
partial [Cariama cristata]
Length=451

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  AS+IAILNANYMAKRLEKHY +LFRG  G VAHEFI+D R FK TA IEA D+A
Sbjct  254  AKGLKHASEIAILNANYMAKRLEKHYKILFRGARGYVAHEFILDTRPFKKTANIEAVDLA  313

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL DYGFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   
Sbjct  314  KRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQI  373

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTL  49
            N LK +PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT 
Sbjct  374  NPLKMSPHTLNCVTSSKWDRPYSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTC  433

Query  48   LPV  40
             P+
Sbjct  434  PPM  436



>ref|WP_043507924.1| glycine dehydrogenase, partial [Pseudomonas aeruginosa]
Length=238

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 143/188 (76%), Gaps = 1/188 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             +GL  AS++AILNANY+A RLE+HYPVL+ G NG VAHE I+DLR  K+++GI  +DVA
Sbjct  52   GEGLKRASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVA  111

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMD+GFH PTMS+PV GTLMIEPTESESKAELDRFCD +I IREEI  +E+G+ D  +
Sbjct  112  KRLMDFGFHAPTMSFPVAGTLMIEPTESESKAELDRFCDAMIRIREEIRAVERGELDKED  171

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH  + L+ + W   YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  
Sbjct  172  NPLKNAPHTAAELLGE-WNHAYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCP  230

Query  45   PVSQMVED  22
            PV    E+
Sbjct  231  PVEAYSEE  238



>ref|WP_039743276.1| glycine dehydrogenase [Hassallia byssoidea]
 gb|KIF35727.1| glycine dehydrogenase [Hassallia byssoidea VB512170]
Length=1019

 Score =   266 bits (679),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585   SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
             + GL DA+K+AILNANY+AKRLEK+YPVL++G N  VAHE I+DLR  K +A I+ +D+A
Sbjct  834   ADGLKDATKVAILNANYIAKRLEKYYPVLYKGKNALVAHECILDLRSLKKSANIDIDDIA  893

Query  405   KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
             KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +
Sbjct  894   KRLMDYGFHAPTVSWPVAGTIMVEPTESESKQELDRFCDAMIAIRKEIAEIESGKMDAQD  953

Query  225   NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
             NVLKNAPH    L+   W  PYSRE AA+PA W +  KFW + GR+DN YGDRN +C+ L
Sbjct  954   NVLKNAPHTAESLITGEWHHPYSREQAAYPAPWTREHKFWMSVGRIDNAYGDRNFVCSCL  1013

Query  45    PV  40
             P+
Sbjct  1014  PM  1015



>ref|WP_021833182.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii]
 emb|CCQ56428.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 0005]
 emb|CCQ70812.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 0402]
Length=196

 Score =   246 bits (629),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 137/187 (73%), Gaps = 0/187 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL +A+K+AILNANYMA RL  +YP+LF+G +G VAHE IIDLR  KN A +  +D+AK
Sbjct  10   KGLTEATKVAILNANYMASRLADYYPILFKGASGCVAHECIIDLRPLKNQAEVGVDDIAK  69

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMD+GFH PT+SWPV GT+M+EPTESE  AELDRFCD +I+I +E   I  G  D  NN
Sbjct  70   RLMDFGFHAPTVSWPVGGTMMVEPTESEDLAELDRFCDAMITIHQEAQAIADGTIDPANN  129

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
             LKNAPH   +++   W +PYSRE AA+PA W K  KFWPT GR+DN YGDRNL+C+   
Sbjct  130  PLKNAPHTAEMVICQEWDRPYSREKAAYPASWSKEHKFWPTVGRIDNAYGDRNLVCSCEG  189

Query  42   VSQMVED  22
            +    ED
Sbjct  190  MDAYKED  196



>ref|WP_015081132.1| glycine dehydrogenase [Anabaena sp. 90]
 gb|AFW95989.1| glycine dehydrogenase (decarboxylating) [Anabaena sp. 90]
Length=961

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL +A+KIAILNANYMAK+LE +YPVL++G NG VAHE I+DLR  K +A IE +DVA
Sbjct  776  ADGLTEATKIAILNANYMAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVA  835

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IREE+A IE G  DI++
Sbjct  836  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKQELDRFCDALIAIREEVAAIESGTMDIHD  895

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N+LKNAPH    L+   W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ L
Sbjct  896  NLLKNAPHTAESLIIGEWNHPYSREQAAYPALWNKEYKFWPSVGRIDAAFGDRNFVCSCL  955

Query  45   PV  40
            P+
Sbjct  956  PM  957



>gb|KFF35033.1| hypothetical protein G039_0311865 [Pseudomonas aeruginosa VRFPA01]
Length=210

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 1/187 (1%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL  AS++AILNANY+A RLE+HYPVL+ G NG VAHE I+DLR  K+++GI  +DVAK
Sbjct  25   EGLKRASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVAK  84

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMD+GFH PTMS+PV GTLMIEPTESE KAELDRFCD +I IREEI  +E+G+ D ++N
Sbjct  85   RLMDFGFHAPTMSFPVAGTLMIEPTESEPKAELDRFCDAMIRIREEIRAVERGELDKDDN  144

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
             LKNAPH  + L+ + W+  YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  P
Sbjct  145  PLKNAPHTAAELLGE-WSHAYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCPP  203

Query  42   VSQMVED  22
            +    E+
Sbjct  204  IEAYSEE  210



>ref|WP_039895601.1| glycine dehydrogenase, partial [Lyngbya sp. PCC 8106]
Length=950

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL +A+K+AILNANYMA RL+  YP+L++G NG +AHE I+DLRG K +A IE +D+A
Sbjct  763  AEGLTEATKVAILNANYMAFRLKDAYPILYKGKNGLIAHECILDLRGVKKSANIEVDDIA  822

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMD+GFH PT+SWPVPGT+M+EPTESESKAELDRFC+ +I+IR EI  IE G  D  N
Sbjct  823  KRLMDFGFHAPTVSWPVPGTMMVEPTESESKAELDRFCEAMIAIRREIGAIESGDIDTEN  882

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH    L+   W  PYSRE AA+PA WL+  KFWP+ GR+DN YGDRN +C+ L
Sbjct  883  NPLKNAPHTAESLIVGEWNHPYSREQAAYPAPWLREHKFWPSVGRIDNAYGDRNFVCSCL  942

Query  45   PV  40
            P+
Sbjct  943  PM  944



>gb|EAW38056.1| glycine dehydrogenase [Lyngbya sp. PCC 8106]
Length=992

 Score =   265 bits (677),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL +A+K+AILNANYMA RL+  YP+L++G NG +AHE I+DLRG K +A IE +D+A
Sbjct  805  AEGLTEATKVAILNANYMAFRLKDAYPILYKGKNGLIAHECILDLRGVKKSANIEVDDIA  864

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMD+GFH PT+SWPVPGT+M+EPTESESKAELDRFC+ +I+IR EI  IE G  D  N
Sbjct  865  KRLMDFGFHAPTVSWPVPGTMMVEPTESESKAELDRFCEAMIAIRREIGAIESGDIDTEN  924

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH    L+   W  PYSRE AA+PA WL+  KFWP+ GR+DN YGDRN +C+ L
Sbjct  925  NPLKNAPHTAESLIVGEWNHPYSREQAAYPAPWLREHKFWPSVGRIDNAYGDRNFVCSCL  984

Query  45   PV  40
            P+
Sbjct  985  PM  986



>ref|WP_031770429.1| glycine dehydrogenase, partial [Pseudomonas aeruginosa]
Length=250

 Score =   248 bits (632),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL  AS++AILNANY+A RLE+HYPVL+ G NG VAHE I+DLR  K+++GI  +DVAK
Sbjct  65   EGLKRASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVAK  124

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMD+GFH PTMS+PV GTLMIEPTESESKAELDRFCD +I IREEI  +E+G+ D  +N
Sbjct  125  RLMDFGFHAPTMSFPVAGTLMIEPTESESKAELDRFCDAMIRIREEIRAVERGELDKEDN  184

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
             LKNAPH  + L+ + W   YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  P
Sbjct  185  PLKNAPHTAAELLGE-WNHAYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCPP  243

Query  42   VSQMVED  22
            +    E+
Sbjct  244  IEAYSEE  250



>ref|WP_015182831.1| glycine dehydrogenase, decarboxylating [Microcoleus sp. PCC 7113]
 gb|AFZ18682.1| glycine dehydrogenase, decarboxylating [Microcoleus sp. PCC 7113]
Length=988

 Score =   265 bits (676),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  A+K+AILNANY+A+RLE +YPVL++G +G VAHE I+DLR  K +AGIE +D+A
Sbjct  801  AEGLTAATKVAILNANYIARRLEAYYPVLYKGKSGLVAHECILDLRQLKKSAGIEVDDIA  860

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IR+EI +IE GK D  +
Sbjct  861  KRLMDYGFHAPTVSWPVAGTMMVEPTESESKEELDRFCEAMIAIRKEIEEIETGKVDDQD  920

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    LM+  W  PYSRE AA+PA W +  KFWPT GR+DN +GDRNL+C+ +
Sbjct  921  NVLKNAPHTAEFLMSSEWIHPYSREQAAYPAPWTREHKFWPTVGRIDNAFGDRNLVCSCV  980



>ref|WP_006972317.1| glycine dehydrogenase [Plesiocystis pacifica]
 gb|EDM78597.1| glycine dehydrogenase [Plesiocystis pacifica SIR-1]
Length=980

 Score =   265 bits (676),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 144/188 (77%), Gaps = 1/188 (1%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL  A+++AILNANYMA RL +HYPVL+ G NG VAHEFIIDLR FK +AGIEAEDVAKR
Sbjct  793  GLTRATQVAILNANYMAARLREHYPVLYSGANGRVAHEFIIDLRPFKQSAGIEAEDVAKR  852

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PTMS+PV GTLMIEPTESES AELDRFC+ +I+IREEI Q+E G     +N 
Sbjct  853  LMDYGFHAPTMSFPVAGTLMIEPTESESMAELDRFCEAMIAIREEIRQVEDGALPREDNP  912

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            L NAPH    +  D WT+ Y RE AAFP  W++ +KFWP  GR+DN +GDRNL+CT  P+
Sbjct  913  LVNAPHTAEAVCGDEWTRAYPREQAAFPLSWVRESKFWPAVGRIDNAFGDRNLVCTCPPL  972

Query  39   SQMVEDEA  16
             +  ED A
Sbjct  973  -EAYEDAA  979



>ref|WP_019497275.1| glycine dehydrogenase [Calothrix sp. PCC 7103]
Length=959

 Score =   265 bits (676),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL +A+KIAILNANY+AKRLE HYPVL++G NG VAHE I+DLR  K +A I+ +DVA
Sbjct  773  ASGLTEATKIAILNANYIAKRLENHYPVLYKGSNGYVAHECILDLRALKKSANIDIDDVA  832

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYG+H PT+SWPV GT+M+EPTESESK ELDRFCD LISIR+EIA+IE GK DI +
Sbjct  833  KRLMDYGYHAPTVSWPVAGTIMVEPTESESKEELDRFCDALISIRQEIAEIESGKMDIQD  892

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N+LKNAPH    L+A  W  PY+RE AA+PA W +  KFW +  R+D  +GDRN +C+ L
Sbjct  893  NLLKNAPHTAESLIAGDWKHPYTREQAAYPAPWTRDNKFWVSVSRIDAAFGDRNFVCSCL  952

Query  45   PVSQMVE  25
            P+    E
Sbjct  953  PMEAYSE  959



>gb|KGB84088.1| glycine dehydrogenase, partial [Pseudomonas aeruginosa]
Length=223

 Score =   246 bits (629),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 142/187 (76%), Gaps = 1/187 (1%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL  AS++AILNANY+A RLE+HYPVL+ G NG VAHE I+DLR  K+++GI  +DVAK
Sbjct  38   EGLKRASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVAK  97

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMD+GFH PTMS+PV GTLMIEPTESESKAELDRFCD +I IREEI  +E G+ D  +N
Sbjct  98   RLMDFGFHAPTMSFPVAGTLMIEPTESESKAELDRFCDAMIRIREEIRAVECGELDKEDN  157

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
             LKNAPH  + L+ + W   YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  P
Sbjct  158  PLKNAPHTAAELLGE-WNHAYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCPP  216

Query  42   VSQMVED  22
            +    E+
Sbjct  217  IEAYSEE  223



>ref|WP_033886039.1| glycine dehydrogenase, partial [Pseudomonas aeruginosa]
Length=250

 Score =   248 bits (632),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL  AS++AILNANY+A RLE+HYPVL+ G NG VAHE I+DLR  K+++GI  +DVAK
Sbjct  65   EGLKRASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVAK  124

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMD+GFH PTMS+PV GTLMIEPTESESKAELDRFCD +I IREEI  +E+G+ D  +N
Sbjct  125  RLMDFGFHAPTMSFPVAGTLMIEPTESESKAELDRFCDAMIRIREEIRAVERGELDKEDN  184

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
             LKNAPH  + L+ + W   YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  P
Sbjct  185  PLKNAPHTAAELLGE-WNHTYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCPP  243

Query  42   VSQMVED  22
            +    E+
Sbjct  244  IEAYSEE  250



>ref|WP_026736448.1| glycine dehydrogenase [Fischerella sp. PCC 9605]
Length=973

 Score =   264 bits (675),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL DA+K+AILNANY+AKRLE +YPVL++G NG VAHE I+DLR  K +A IE +DVAKR
Sbjct  789  GLTDATKVAILNANYIAKRLEGYYPVLYQGKNGLVAHECILDLRSLKKSASIEIDDVAKR  848

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IR+EIA IE GK D+ +NV
Sbjct  849  LMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCDALIAIRQEIAAIESGKADLQDNV  908

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAP+    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  909  LKNAPYTAESLIVGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  968



>dbj|GAM17937.1| hypothetical protein SAMD00019534_011120, partial [Acytostelium 
subglobosum LB1]
Length=1024

 Score =   265 bits (676),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -3

Query  579   GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
             GL  A+++AILNANYMA RL+ HY +L+ G +G VAHEFIIDLR FK T GIEAEDVAKR
Sbjct  841   GLKRATQVAILNANYMAARLKDHYKILYTGSHGLVAHEFIIDLRSFKETTGIEAEDVAKR  900

Query  399   LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
             L DYGFHGPTMSWPV  TLMIEPTESESK ELDR CD LISIR EIA+IE GK   +NN+
Sbjct  901   LQDYGFHGPTMSWPVVNTLMIEPTESESKYELDRLCDALISIRGEIAEIESGKASRDNNL  960

Query  219   LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
             L NAPH   ++ +D W +PY+RE AA+P+   + +KFWP+ GRVDNV+GDRNL+C   P+
Sbjct  961   LVNAPHTEHVITSDKWDRPYTRERAAYPSVATRESKFWPSVGRVDNVFGDRNLVCACPPL  1020

Query  39    S  37
             S
Sbjct  1021  S  1021



>ref|WP_027250002.1| glycine dehydrogenase [Planktothrix agardhii]
Length=958

 Score =   264 bits (675),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL +A+K+AILNANY+A RL  +YP+L++G  G VAHE I+DLRG K +AGIE +D+AK
Sbjct  774  KGLTEATKLAILNANYIAHRLNNYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAK  833

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMDYGFH PT+SWPV GT+M+EPTESESKAELDRFCD +I+I +EI++IE G  D  NN
Sbjct  834  RLMDYGFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMIAIYQEISEIESGAMDATNN  893

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
            +LKNAPH    L+   W  PYSRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP
Sbjct  894  MLKNAPHTAISLLCGEWNHPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLP  953

Query  42   V  40
            +
Sbjct  954  M  954



>ref|XP_001420206.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98499.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=976

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 142/190 (75%), Gaps = 0/190 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL +ASK AILNANYM+KRLE +YPVLF G N T AHEFI+D+R  K+  G+E  D+A
Sbjct  787  SEGLANASKRAILNANYMSKRLEDYYPVLFSGKNDTCAHEFILDMRPIKDATGVEVADIA  846

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMSWPV GTLMIEPTESESKAELDRFCD LI+IR EI  IE GK D  N
Sbjct  847  KRLMDYGFHSPTMSWPVAGTLMIEPTESESKAELDRFCDALIAIRGEIRDIEDGKVDREN  906

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH   ++ A  W +PY R+  AFP +W ++ KFWP T R+D+VYGDRNL+ +  
Sbjct  907  NVLKNAPHTAEVVTAKEWNRPYPRDLGAFPVEWTRSHKFWPQTSRIDDVYGDRNLVASRA  966

Query  45   PVSQMVEDEA  16
             V   V   A
Sbjct  967  AVEVAVAQTA  976



>ref|WP_033335677.1| glycine dehydrogenase [Scytonema hofmanni]
Length=983

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL +A+K+AILNANY+A+RLE +YPVL++G N  VAHE I+DLR  K +A IE +D+AKR
Sbjct  801  GLTEATKVAILNANYIARRLESYYPVLYKGKNNLVAHECILDLRSLKKSASIEIDDIAKR  860

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESES+ ELDRFCD LI+IR+EIA+IE GK DI +NV
Sbjct  861  LMDYGFHAPTVSWPVAGTIMVEPTESESQEELDRFCDALIAIRQEIAEIESGKMDIQDNV  920

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH    L+   W  PYSRE AA+PA W +  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  921  LKNAPHTAESLIVGEWKHPYSREQAAYPAPWTREHKFWPSVGRIDAAFGDRNFVCSCLPM  980



>ref|WP_015130859.1| glycine dehydrogenase [Calothrix sp. PCC 7507]
 gb|AFY35062.1| Glycine dehydrogenase (decarboxylating) [Calothrix sp. PCC 7507]
Length=980

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = -3

Query  576  LXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRL  397
            L  A+K+AILNANY+AKRLE +YPVL++G NG VAHE I+DLR  K +A IE +D+AKRL
Sbjct  797  LTQATKVAILNANYIAKRLESYYPVLYKGKNGLVAHECILDLRSLKKSASIEIDDIAKRL  856

Query  396  MDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVL  217
            +DYGFH PT+SWPV GT+M+EPTESESKAELDRFCD LI+IR+EIA+IE GK DI +N+L
Sbjct  857  IDYGFHAPTVSWPVAGTIMVEPTESESKAELDRFCDALIAIRQEIAEIESGKVDIQDNLL  916

Query  216  KNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            KN+PH  + L+   W  PYSRE AA+PA W +  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  917  KNSPHTAASLITGDWQHPYSREQAAYPAPWTREHKFWPSVGRIDAAFGDRNFVCSCLPM  975



>ref|WP_015198875.1| glycine dehydrogenase [Calothrix parietina]
 gb|AFZ02247.1| Glycine dehydrogenase (decarboxylating) [Calothrix sp. PCC 6303]
Length=961

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL +A+KIAILNANY+AKRLE HYPVL++G NG VAHE I+DLR  K +A I+ +DVA
Sbjct  775  ASGLTEATKIAILNANYIAKRLEGHYPVLYKGSNGYVAHECILDLRALKKSANIDIDDVA  834

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESKAELDRFCD LI+IR EIA IE GK DI +
Sbjct  835  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKAELDRFCDALIAIRAEIALIEAGKMDIQD  894

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N+LKNAPH    L++  WT PY+RE AA+PA W +  KFW +  R+D  +GDRN +C+ L
Sbjct  895  NLLKNAPHTAESLISGEWTHPYTREEAAYPAPWTRDNKFWVSVSRIDAAFGDRNFVCSCL  954

Query  45   PVSQMVE  25
            P+    E
Sbjct  955  PMDAYSE  961



>ref|WP_009149788.1| glycine dehydrogenase [Moorea producens]
 gb|EGJ30430.1| glycine dehydrogenase (decarboxylating) alpha subunit [Moorea 
producens 3L]
Length=989

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S GL +A+K+AILNANYMAKRL+ +YPVL++G NG VAHE I+DLR  K +AGIE +D+A
Sbjct  804  SGGLTEATKVAILNANYMAKRLDPYYPVLYKGNNGLVAHECIVDLRSLKKSAGIEVDDIA  863

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EI  IE G+ D  +
Sbjct  864  KRLMDYGFHAPTVSWPVAGTMMVEPTESESKEELDRFCDAMIAIRQEIEAIESGQVDQTD  923

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  52
            N LKNAPH    LM   W+ PY+RE AA+PA WL+  KFWP  GR+DN +GDRNL+C+
Sbjct  924  NQLKNAPHTAEALMVIEWSHPYTREEAAYPAPWLREHKFWPVVGRIDNAFGDRNLVCS  981



>ref|WP_029637128.1| glycine dehydrogenase [[Scytonema hofmanni] UTEX B 1581]
Length=980

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL DA+K+AILNANY+AK+LE+HYPVL++G N  VAHE I+DLR  K +A I+ +DVA
Sbjct  794  ADGLTDATKVAILNANYIAKKLEQHYPVLYKGKNALVAHECILDLRSLKKSANIDIDDVA  853

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +
Sbjct  854  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKQELDRFCDAMIAIRQEIAEIESGKADAQD  913

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+   W  PYSRE AA+PA W +  KFW +  R+DN YGDRN +C+ L
Sbjct  914  NVLKNAPHTAENLITGEWNHPYSREQAAYPAPWTREYKFWVSVNRIDNAYGDRNFVCSCL  973

Query  45   PV  40
            P+
Sbjct  974  PM  975



>ref|WP_016861897.1| glycine dehydrogenase [Fischerella muscicola]
Length=962

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL DA+K+AILNANY+AK LE HYP+L++G NG VAHE I+DLR  K +A IE +D+AKR
Sbjct  779  GLTDATKVAILNANYIAKCLEAHYPILYQGKNGYVAHECILDLRSLKKSASIEIDDIAKR  838

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD +ISIR+EIA+IE GK D+ +NV
Sbjct  839  LMDYGFHAPTVSWPVAGTIMVEPTESESKQELDRFCDAMISIRQEIAEIEAGKADLQDNV  898

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  40
            LKNAPH    L+   W   YSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  899  LKNAPHTAESLIIGEWNHSYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  958



>ref|WP_010415806.1| glycine dehydrogenase [Leptospira inadai]
 gb|EQA34745.1| glycine dehydrogenase [Leptospira inadai serovar Lyme str. 10]
Length=963

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  A+K AILNANY+AKRLE +YPVL++G +G VAHE I+D+R FK T+GIE EDVA
Sbjct  776  NRGLEYATKAAILNANYVAKRLENYYPVLYKGKHGFVAHECILDVRPFKKTSGIEVEDVA  835

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMS+PVPGTLMIEPTESES+ ELDRFC+ +I I +EI +IE GK D  +
Sbjct  836  KRLMDYGFHAPTMSFPVPGTLMIEPTESESQEELDRFCEAMILIHDEIKEIEDGKADPKD  895

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH  +++ +D+W   Y+RE AA+P  W K  KFWP  GR+DNVYGDRNL+C+ L
Sbjct  896  NPLKNAPHTAAMVTSDSWRHAYTREKAAYPTNWTKEHKFWPYVGRIDNVYGDRNLVCSCL  955

Query  45   PVSQMVED  22
            P+   ++D
Sbjct  956  PIEDYLQD  963



>ref|WP_015212883.1| Glycine dehydrogenase (decarboxylating) [Anabaena cylindrica]
 gb|AFZ56230.1| Glycine dehydrogenase (decarboxylating) [Anabaena cylindrica 
PCC 7122]
Length=963

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  A+K+AILNANY+AKRLE +YPVL++G NG VAHE I+DLR  K +A IE +DVA
Sbjct  778  ADGLTQATKVAILNANYIAKRLESYYPVLYQGKNGLVAHECILDLRSLKKSAHIEIDDVA  837

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFC+ LI+IREE+A IE GK DI +
Sbjct  838  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKQELDRFCNALIAIREEVAAIESGKMDIQD  897

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N+LKNAPH    L+   W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ L
Sbjct  898  NLLKNAPHTAESLIIGEWNHPYSREQAAYPAPWNKEYKFWPSVGRIDAAFGDRNFVCSCL  957

Query  45   PV  40
            P+
Sbjct  958  PM  959



>ref|WP_011057442.1| glycine dehydrogenase [Thermosynechococcus elongatus]
 ref|NP_682393.1| glycine dehydrogenase [Thermosynechococcus elongatus BP-1]
 sp|Q8DII3.1|GCSP_THEEB RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Thermosynechococcus elongatus BP-1]
 dbj|BAC09155.1| glycine cleavage system protein P [Thermosynechococcus elongatus 
BP-1]
Length=954

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -3

Query  579  GLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKR  400
            GL  A+ IAILNANY+AKRLE +YPVL++G +G VAHE I+DLR  K +AGIE ED+AKR
Sbjct  772  GLTRATAIAILNANYIAKRLEPYYPVLYKGAHGLVAHECILDLRPLKKSAGIEVEDIAKR  831

Query  399  LMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNV  220
            LMDYGFH PT+SWPVPGTLMIEPTESE+KAELDRFC+ +I+IR EIA+IE G  D   N 
Sbjct  832  LMDYGFHAPTVSWPVPGTLMIEPTESETKAELDRFCEAMIAIRSEIAEIEAGVSDRQQNP  891

Query  219  LKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  52
            LKNAPHP  +L  + W  PYSRE AA+PA WL+  KFWP   R+DN YGDR+L+CT
Sbjct  892  LKNAPHPALMLATEPWPYPYSREVAAYPAPWLREYKFWPAVARIDNAYGDRHLVCT  947



>ref|WP_012410110.1| glycine dehydrogenase [Nostoc punctiforme]
 sp|B2J427.1|GCSP_NOSP7 RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Nostoc punctiforme PCC 73102]
 gb|ACC82139.1| glycine dehydrogenase [Nostoc punctiforme PCC 73102]
Length=979

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 142/182 (78%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  A+K+AILNANY+AK+LE +YPVL++G NG VAHE I+DLR  K +A IE +DVA
Sbjct  793  ADGLTQATKVAILNANYIAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAAIEIDDVA  852

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IR+EIA+IE GK D  +
Sbjct  853  KRLMDYGFHAPTVSWPVGGTIMVEPTESESKQELDRFCDALIAIRQEIAEIEVGKVDAQD  912

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ L
Sbjct  913  NVLKNAPHTAESLITGEWQHPYSREQAAYPAPWTREYKFWPAVGRIDAAFGDRNFVCSCL  972

Query  45   PV  40
            P+
Sbjct  973  PM  974



>ref|WP_011319516.1| glycine dehydrogenase [Anabaena variabilis]
 sp|Q3M9G1.1|GCSP_ANAVT RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Anabaena variabilis ATCC 29413]
 gb|ABA22375.1| glycine dehydrogenase (decarboxylating) alpha subunit [Anabaena 
variabilis ATCC 29413]
Length=974

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  A+K+AILNANY+AKRLE +YPVL++G NG VAHE I+DLR  K +A IE +D+A
Sbjct  789  ADGLTQATKVAILNANYIAKRLETYYPVLYKGQNGLVAHECILDLRALKKSANIEIDDIA  848

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL+DYGFH PT+SWPV GT+M+EPTESES+AELDRFCD LI+IR+EIA IE GK D +N
Sbjct  849  KRLIDYGFHAPTVSWPVTGTIMVEPTESESQAELDRFCDALIAIRQEIAAIEAGKMDTHN  908

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N+LKNAPH    L+   W  PYSRE AA+P  W +  KFWP+ GR+D  +GDRN +C+ L
Sbjct  909  NLLKNAPHTIESLIVGEWLHPYSREQAAYPVSWTREYKFWPSVGRIDAAFGDRNFVCSCL  968

Query  45   PV  40
            P+
Sbjct  969  PM  970



>ref|WP_017289075.1| glycine dehydrogenase [Leptolyngbya boryana]
Length=974

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            QGL +A++IAILNANY+AKRLE HYPVL++G NG VAHE I+DLR FK  A IE +D+AK
Sbjct  790  QGLTEATEIAILNANYIAKRLEGHYPVLYKGKNGWVAHECILDLREFKKNADIEVDDIAK  849

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RL+DYGFH PT+SWPV GT+M+EPTESESKAELDRFCD +I+IREEI  IE G  D  NN
Sbjct  850  RLIDYGFHPPTVSWPVAGTVMVEPTESESKAELDRFCDAMIAIREEIRAIENGNVDRTNN  909

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
            +LKNAPH  + L ++ W +PYSR+ A FP  W K  KF+P  GR+DN +GDRNL+C+ LP
Sbjct  910  LLKNAPHTVADLTSETWDRPYSRQEAIFPTTWTKANKFYPAVGRIDNAFGDRNLVCSCLP  969

Query  42   V  40
            +
Sbjct  970  M  970



>ref|WP_013193021.1| glycine dehydrogenase [Trichormus azollae]
 gb|ADI66011.1| glycine dehydrogenase ['Nostoc azollae' 0708]
Length=964

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL +A+KIAILNANY+AKRLE +YP+L++G NG VAHE I+DLR  K +A IE +DVA
Sbjct  779  ADGLTEATKIAILNANYIAKRLELYYPILYQGKNGLVAHECILDLRSLKKSAHIEIDDVA  838

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IREE+A IE G+ DI +
Sbjct  839  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCDALIAIREEVATIESGEMDIQD  898

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+   W  PYSRE AA+PA W K  K WP+ GR+D  +GDRN +C+ L
Sbjct  899  NVLKNAPHTAESLIVGEWNHPYSREQAAYPAPWNKEYKLWPSVGRIDAAFGDRNFVCSCL  958

Query  45   PV  40
            P+
Sbjct  959  PM  960



>ref|WP_026763335.1| glycine dehydrogenase [Sediminibacterium salmoneum]
Length=957

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 147/190 (77%), Gaps = 0/190 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + G+  +++ AILNANYM  RLEK+YP+L+ G NGT AHEFI+DLR FK +AG+EAED+A
Sbjct  768  ADGIRMSTEYAILNANYMKARLEKYYPILYTGKNGTCAHEFIVDLRPFKQSAGVEAEDIA  827

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL+DYGFH PTMS+PV GT+MIEPTESE KAELDRFCD LI+I  EI  IE GK D  N
Sbjct  828  KRLIDYGFHAPTMSFPVAGTIMIEPTESEDKAELDRFCDALIAIHGEIKDIENGKADKAN  887

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH  +++ AD WT+PY+R+ AAFP  ++   KFWP+  RV+N +GDRNLICT  
Sbjct  888  NPLKNAPHTQAVVCADEWTRPYTRQEAAFPLYYVTLNKFWPSVARVNNTHGDRNLICTCE  947

Query  45   PVSQMVEDEA  16
            PVS   E+ A
Sbjct  948  PVSSYAEENA  957



>ref|WP_019017579.1| glycine dehydrogenase [Halomonas lutea]
Length=964

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL +A+++AILNANY+AKRLE+HYPVL++G+NGTVAHE I+D+R  K T+GI  ED+A
Sbjct  778  AKGLREATELAILNANYIAKRLEQHYPVLYKGINGTVAHECIVDIRPLKATSGISEEDIA  837

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMS+PVPGTLMIEPTESES+ E+DRFCD +I+IREEIA++E G++   +
Sbjct  838  KRLMDYGFHAPTMSFPVPGTLMIEPTESESRYEIDRFCDAMIAIREEIARVESGEWPAED  897

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  52
            N L NAPH  + LM D+W +PY RE AAFP++  K AKFWP   RVDNV+GDR LIC+
Sbjct  898  NPLVNAPHTMADLMDDSWQRPYGREIAAFPSEATKAAKFWPAVNRVDNVHGDRQLICS  955



>ref|XP_008944450.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial, 
partial [Merops nubicus]
Length=451

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  AS++AILNANYMAKRLEKHY +LF+G  G VAHEFI+D R FK TA IEA D+A
Sbjct  254  AKGLKHASEVAILNANYMAKRLEKHYKILFKGAKGYVAHEFILDTRPFKKTANIEAVDLA  313

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL DYGFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA IE+G+ D   
Sbjct  314  KRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRMDPQI  373

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTL  49
            N LK +PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT 
Sbjct  374  NPLKMSPHTLNCVTSSKWDRPYSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTC  433

Query  48   LPV  40
             P+
Sbjct  434  PPM  436



>ref|WP_042991755.1| hypothetical protein [Bordetella holmesii]
Length=225

 Score =   245 bits (626),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++ L  A+++AILNANY+A RL +HYPVL+ G +G VAHE I+D+R  K+++G+ AED+A
Sbjct  40   AESLRRATEVAILNANYVATRLREHYPVLYAGRHGRVAHECILDVRPLKDSSGVSAEDIA  99

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PTMS+PV GTLM+EPTESE  AEL+RF D +++IR EIAQIE+G+ D  +
Sbjct  100  KRLMDYGFHAPTMSFPVAGTLMVEPTESEGLAELERFIDAMVAIRTEIAQIERGERDRED  159

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH   +L+AD W   Y R+ AA+P   L+ AK+WP   RVDN YGDRNL+C  L
Sbjct  160  NVLKNAPHTAQMLLADEWHHDYPRQQAAYPVATLREAKYWPPVARVDNAYGDRNLVCACL  219

Query  45   PV  40
            P+
Sbjct  220  PI  221



>ref|WP_015119530.1| glycine dehydrogenase, decarboxylating [Rivularia sp. PCC 7116]
 gb|AFY55964.1| glycine dehydrogenase, decarboxylating [Rivularia sp. PCC 7116]
Length=961

 Score =   263 bits (671),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 139/178 (78%), Gaps = 0/178 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL +A+K+AILNANYMAKRLEKHYPVL+ G NG VAHE I+DLR  K +A IE +D+A
Sbjct  775  ADGLTEATKVAILNANYMAKRLEKHYPVLYAGKNGLVAHECILDLRSLKKSANIEIDDIA  834

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESES  ELDRFCD ++SIREE+AQIE GK D  +
Sbjct  835  KRLMDYGFHAPTVSWPVAGTVMVEPTESESLEELDRFCDAMVSIREEVAQIEAGKVDAQD  894

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  52
            NVLKNAPH    L+   W  PY+RE AA+PA W +  KFW   GR+D  +GDRNLIC+
Sbjct  895  NVLKNAPHTAQSLIVGEWNHPYTREQAAYPAPWTREHKFWVAVGRIDAAFGDRNLICS  952



>ref|WP_028088591.1| glycine dehydrogenase [Dolichospermum circinale]
Length=956

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL +A+KIAILNANYMAK+LE +YPVL++G NG VAHE I+DLR  K +A IE +DVA
Sbjct  771  ADGLTEATKIAILNANYMAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVA  830

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFC+ LI+IR+EI++IE GK D+ +
Sbjct  831  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCEALIAIRKEISEIESGKMDLQD  890

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+   W   YSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ L
Sbjct  891  NVLKNAPHTAESLIVGEWKHDYSREQAAYPASWSKEYKFWPSVGRIDAAFGDRNFVCSCL  950

Query  45   PV  40
            P+
Sbjct  951  PM  952



>ref|XP_009575710.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial, 
partial [Fulmarus glacialis]
Length=451

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  AS+IAILNANYMAKRLEKHY +LFRG  G VAHEFI+D R FK +A IEA D+A
Sbjct  254  AKGLKHASEIAILNANYMAKRLEKHYKILFRGARGYVAHEFILDTRPFKKSANIEAVDLA  313

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL DYGFH PTMSWPV GTLMIEPTESE KAELDRFCD +I IR+EIA+IE+G+ D   
Sbjct  314  KRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMIGIRQEIAEIEEGRMDPQI  373

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTL  49
            N LK +PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT 
Sbjct  374  NPLKMSPHTLNCVTSSKWDRPYSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTC  433

Query  48   LPV  40
             P+
Sbjct  434  PPM  436



>ref|WP_043391215.1| glycine dehydrogenase [Cystobacter violaceus]
 gb|KFA93774.1| glycine dehydrogenase [Cystobacter violaceus Cb vi76]
Length=965

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  A+K+AILNANY+A+RL++HYPVL+RG  G VAHE I+DLR  K TAG+E EDVA
Sbjct  772  AEGLTKATKLAILNANYIAERLQEHYPVLYRGKRGRVAHECIVDLRHLKKTAGVEVEDVA  831

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+S+PV GTLMIEPTESESKAE+DR CD LISIR EI +IE+GK   +N
Sbjct  832  KRLMDYGFHAPTVSFPVAGTLMIEPTESESKAEIDRLCDALISIRGEIREIEEGKAPRDN  891

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH   ++    W +PYSRE AAFPA W+   KFWP+ GR++NV GDR L+C+  
Sbjct  892  NVLKNAPHTARVMTDPEWNRPYSREQAAFPAPWVAEHKFWPSVGRLNNVLGDRKLVCSCP  951

Query  45   PVSQMVEDEAAASA  4
            P+   +  E + +A
Sbjct  952  PIEDYMSPEPSRAA  965



>ref|WP_015163334.1| glycine dehydrogenase [Pseudanabaena sp. PCC 7367]
 gb|AFY68360.1| Glycine dehydrogenase (decarboxylating) [Pseudanabaena sp. PCC 
7367]
Length=1028

 Score =   263 bits (672),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 138/184 (75%), Gaps = 0/184 (0%)
 Frame = -3

Query  576   LXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRL  397
             L  A++ AILNANY+A RL+ HYPVL+RG NG VAHE IIDLR  K +A IE +D+AKRL
Sbjct  845   LKQATEAAILNANYIAHRLQPHYPVLYRGKNGLVAHECIIDLRQLKTSAAIEVDDIAKRL  904

Query  396   MDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVL  217
             MDYGFH PT+SWPV GT+M+EPTESESKAELDRFCD +I+IREEI  IE G  D  +N L
Sbjct  905   MDYGFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMIAIREEIRAIEAGTMDRTDNPL  964

Query  216   KNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  37
             KNAPH    LMA  W  PYSR  AA+PA WLK  KFWP  GR+DN +GDRN +C+ LP+ 
Sbjct  965   KNAPHTAESLMATEWQHPYSRAQAAYPAAWLKEHKFWPVVGRIDNAFGDRNFVCSCLPLE  1024

Query  36    QMVE  25
                E
Sbjct  1025  AYAE  1028



>ref|XP_008334138.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Cynoglossus semilaevis]
Length=468

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 143/183 (78%), Gaps = 1/183 (1%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL  A+++AILNANYMAKRLE  Y +LFRG NG VAHEFI+D+R FK TA IEA DVA
Sbjct  272  SKGLRHATEVAILNANYMAKRLENSYKILFRGSNGFVAHEFILDVRPFKKTANIEAVDVA  331

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL DYGFH PTMSWPV GTLMIEPTESE KAELDRFCD L+ IR+EIA IE+G+ D   
Sbjct  332  KRLQDYGFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDALLGIRQEIADIEEGRMDTRI  391

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTL  49
            N LK APH  + + +  W +PYSRE+AAFP  +++   KFWP+  R+D++YGD+NL+CT 
Sbjct  392  NPLKMAPHSLACISSSNWDRPYSREFAAFPLPFIRPETKFWPSISRIDDIYGDQNLMCTC  451

Query  48   LPV  40
             P+
Sbjct  452  PPM  454



>ref|WP_015145532.1| glycine dehydrogenase, decarboxylating [Pleurocapsa minor]
 gb|AFY79234.1| glycine dehydrogenase, decarboxylating [Pleurocapsa sp. PCC 7327]
Length=987

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            QGL +A+K+AILNANY+A RL  +YPVLF+G  GTVAHE +IDLR  K  AGI+ EDVAK
Sbjct  801  QGLTEATKVAILNANYIAHRLASYYPVLFKGKEGTVAHECVIDLRPLKKQAGIQVEDVAK  860

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMDYGFH PT+SWPVPGT+M+EPTESESK ELDRFCD +I+I +E+  I +GK D  NN
Sbjct  861  RLMDYGFHAPTVSWPVPGTMMVEPTESESKDELDRFCDAMIAIYQEVEAIAQGKIDPENN  920

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  52
             LKNAPH   +L+A  W  PYSRE AA+PA W K  KFWP  GR+DN YGDRNL+C+
Sbjct  921  PLKNAPHTAEVLIAGEWNCPYSREQAAYPAPWTKEYKFWPPVGRIDNAYGDRNLVCS  977



>ref|WP_010572852.1| glycine dehydrogenase [Leptospira kmetyi]
 gb|EQA52590.1| glycine dehydrogenase [Leptospira kmetyi serovar Malaysia str. 
Bejo-Iso9]
Length=964

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            S+GL +A++I+ILNANY+AKRLEK YPVL++G NG VAHE I+D+R FK TAGIE EDVA
Sbjct  779  SEGLTNATRISILNANYIAKRLEKAYPVLYKGKNGFVAHECILDVRPFKKTAGIEVEDVA  838

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRL+DYGFH PTMS+PVPGTLMIEPTESES  ELDRFC+ ++ I +EI  ++ G  D  +
Sbjct  839  KRLIDYGFHAPTMSFPVPGTLMIEPTESESLEELDRFCEAMLLIHQEILDVQNGTLDKTD  898

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKN+PH  +++ +D W   Y RE AA+PA WLK  KFWP  GRVDNVYGDRNL+C+ L
Sbjct  899  NPLKNSPHTAAMVTSDRWDHLYPRERAAYPASWLKDHKFWPYVGRVDNVYGDRNLVCSCL  958

Query  45   PV  40
            P+
Sbjct  959  PI  960



>gb|AFY75171.1| glycine dehydrogenase, decarboxylating [Synechococcus sp. PCC 
7502]
Length=964

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  A+++AILNANY+AKRLE  YP+L++G N  VAHE I+DLR  K++AGIE +D+A
Sbjct  778  AKGLKLATEVAILNANYIAKRLESSYPILYKGENSLVAHECILDLRSLKSSAGIEVDDIA  837

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESKAELDRFCD +ISIR EI++IE G  D  +
Sbjct  838  KRLMDYGFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMISIRAEISKIESGAMDKLD  897

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH    L+ D WT PYSR  AA+PA W K  KFW T GR+DN +GDRN IC+  
Sbjct  898  NPLKNAPHTAEFLLKDEWTHPYSRSQAAYPAPWTKVHKFWATVGRIDNAFGDRNFICSCQ  957

Query  45   PVSQMVE  25
            P+ +  E
Sbjct  958  PMEEYSE  964



>gb|KIE11464.1| glycine dehydrogenase [Tolypothrix bouteillei VB521301]
Length=982

 Score =   262 bits (670),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            + GL  A+K+AILNANY+A+RLE +YPVL++G N  VAHE I+DLR  K +A IE +D+A
Sbjct  798  TAGLTAATKVAILNANYIARRLEAYYPVLYKGKNNLVAHECILDLRSLKKSASIEIDDIA  857

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IR+EIA+IE GK DI +
Sbjct  858  KRLMDYGFHAPTVSWPVAGTIMVEPTESESKEELDRFCDALIAIRQEIAEIESGKMDIQD  917

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            NVLKNAPH    L+A  W  PYSRE AA+PA W +  KFWP+  R+D  +GDRN +C+ L
Sbjct  918  NVLKNAPHTAESLIAGEWHHPYSREQAAYPAPWTREHKFWPSVSRIDAAFGDRNFVCSCL  977

Query  45   PV  40
            P+
Sbjct  978  PM  979



>ref|WP_041430269.1| glycine dehydrogenase [Synechococcus sp. PCC 7502]
Length=961

 Score =   262 bits (670),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = -3

Query  585  SQGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVA  406
            ++GL  A+++AILNANY+AKRLE  YP+L++G N  VAHE I+DLR  K++AGIE +D+A
Sbjct  775  AKGLKLATEVAILNANYIAKRLESSYPILYKGENSLVAHECILDLRSLKSSAGIEVDDIA  834

Query  405  KRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINN  226
            KRLMDYGFH PT+SWPV GT+M+EPTESESKAELDRFCD +ISIR EI++IE G  D  +
Sbjct  835  KRLMDYGFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMISIRAEISKIESGAMDKLD  894

Query  225  NVLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  46
            N LKNAPH    L+ D WT PYSR  AA+PA W K  KFW T GR+DN +GDRN IC+  
Sbjct  895  NPLKNAPHTAEFLLKDEWTHPYSRSQAAYPAPWTKVHKFWATVGRIDNAFGDRNFICSCQ  954

Query  45   PVSQMVE  25
            P+ +  E
Sbjct  955  PMEEYSE  961



>ref|WP_015349077.1| glycine dehydrogenase [Myxococcus stipitatus]
 ref|YP_007360500.1| glycine dehydrogenase [Myxococcus stipitatus DSM 14675]
 gb|AGC44816.1| glycine dehydrogenase [Myxococcus stipitatus DSM 14675]
Length=968

 Score =   262 bits (669),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 148/188 (79%), Gaps = 0/188 (0%)
 Frame = -3

Query  582  QGLXDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAK  403
            +GL  A+K+AILNANY+A+RL+ HYPVL+RG  G VAHE I+DLR  K T+G+E EDVAK
Sbjct  775  EGLTQATKLAILNANYIAERLQPHYPVLYRGKRGRVAHECIVDLRPLKKTSGVEVEDVAK  834

Query  402  RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  223
            RLMDYGFH PT+S+PV GTLMIEPTESES+AELDRFCD +I+IR+EI ++E+G+   +NN
Sbjct  835  RLMDYGFHAPTVSFPVAGTLMIEPTESESRAELDRFCDAMIAIRQEIREVEEGRMPKDNN  894

Query  222  VLKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  43
            VLKNAPH   ++ A  W +PYSRE A FPA W++  KFWP+ GR++NV GDR L+C+  P
Sbjct  895  VLKNAPHTSRVISAPEWNRPYSREVAVFPAPWVRDNKFWPSVGRLNNVLGDRKLVCSCPP  954

Query  42   VSQMVEDE  19
            +   +  E
Sbjct  955  IEDYMTPE  962



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690