BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF037O18

Length=699
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349290.1|  PREDICTED: uncharacterized protein LOC102579219    318   7e-104   Solanum tuberosum [potatoes]
ref|XP_004230423.1|  PREDICTED: uncharacterized protein LOC101259085    314   3e-102   Solanum lycopersicum
ref|XP_011092268.1|  PREDICTED: uncharacterized protein LOC105172507    314   3e-101   Sesamum indicum [beniseed]
gb|KJB08617.1|  hypothetical protein B456_001G093200                    309   2e-100   Gossypium raimondii
ref|XP_002528868.1|  conserved hypothetical protein                     304   7e-100   
ref|XP_007022850.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    306   2e-99    Theobroma cacao [chocolate]
ref|XP_002268014.1|  PREDICTED: uncharacterized protein LOC100250508    303   2e-98    Vitis vinifera
emb|CBI29648.3|  unnamed protein product                                303   6e-98    Vitis vinifera
gb|KFK43315.1|  hypothetical protein AALP_AA1G108500                    301   4e-97    Arabis alpina [alpine rockcress]
ref|XP_006385195.1|  hypothetical protein POPTR_0003s00960g             300   4e-97    Populus trichocarpa [western balsam poplar]
ref|XP_011047853.1|  PREDICTED: uncharacterized protein LOC105142093    300   5e-97    Populus euphratica
ref|XP_008452226.1|  PREDICTED: uncharacterized protein LOC103493...    300   9e-97    Cucumis melo [Oriental melon]
gb|KDP42488.1|  hypothetical protein JCGZ_00285                         300   9e-97    Jatropha curcas
ref|XP_006417483.1|  hypothetical protein EUTSA_v10007760mg             300   1e-96    Eutrema salsugineum [saltwater cress]
ref|XP_008452225.1|  PREDICTED: uncharacterized protein LOC103493...    299   2e-96    Cucumis melo [Oriental melon]
gb|KHN39690.1|  hypothetical protein glysoja_020768                     295   2e-96    Glycine soja [wild soybean]
ref|NP_172499.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    300   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892557.1|  predicted protein                                  300   2e-96    Arabidopsis lyrata subsp. lyrata
emb|CDY31036.1|  BnaA08g25860D                                          298   2e-96    Brassica napus [oilseed rape]
emb|CDX93443.1|  BnaA06g06050D                                          298   4e-96    
ref|XP_010490870.1|  PREDICTED: uncharacterized protein LOC104768...    299   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010065247.1|  PREDICTED: uncharacterized protein LOC104452469    298   4e-96    Eucalyptus grandis [rose gum]
ref|XP_009144462.1|  PREDICTED: uncharacterized protein LOC103868...    298   5e-96    Brassica rapa
ref|XP_009144461.1|  PREDICTED: uncharacterized protein LOC103868...    298   6e-96    Brassica rapa
emb|CDY20644.1|  BnaC08g14140D                                          297   8e-96    Brassica napus [oilseed rape]
ref|XP_010273586.1|  PREDICTED: uncharacterized protein LOC104609074    298   9e-96    Nelumbo nucifera [Indian lotus]
ref|XP_010475888.1|  PREDICTED: uncharacterized protein LOC104755237    298   9e-96    Camelina sativa [gold-of-pleasure]
ref|XP_004503749.1|  PREDICTED: uncharacterized protein LOC101509...    296   1e-95    Cicer arietinum [garbanzo]
emb|CAN60261.1|  hypothetical protein VITISV_020168                     298   1e-95    Vitis vinifera
ref|XP_010490863.1|  PREDICTED: uncharacterized protein LOC104768...    298   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010458365.1|  PREDICTED: uncharacterized protein LOC104739637    298   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_009148352.1|  PREDICTED: uncharacterized protein LOC103871798    297   1e-95    Brassica rapa
ref|XP_006303228.1|  hypothetical protein CARUB_v10012092mg             297   2e-95    Capsella rubella
ref|XP_007148589.1|  hypothetical protein PHAVU_006G221200g             296   2e-95    Phaseolus vulgaris [French bean]
ref|XP_006598780.1|  PREDICTED: uncharacterized protein LOC100796...    296   3e-95    Glycine max [soybeans]
emb|CDX94911.1|  BnaC05g07600D                                          295   3e-95    
gb|ABE91847.1|  Protein of unknown function DUF266, plant               297   5e-95    Medicago truncatula
ref|XP_004503748.1|  PREDICTED: uncharacterized protein LOC101509...    296   7e-95    Cicer arietinum [garbanzo]
gb|KDO42566.1|  hypothetical protein CISIN_1g039454mg                   288   2e-94    Citrus sinensis [apfelsine]
ref|XP_004134258.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    293   2e-94    
gb|KHN11046.1|  hypothetical protein glysoja_044070                     290   3e-94    Glycine soja [wild soybean]
ref|XP_004163997.1|  PREDICTED: uncharacterized LOC101215808            293   3e-94    
ref|XP_010682059.1|  PREDICTED: uncharacterized protein LOC104896962    294   5e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008218660.1|  PREDICTED: uncharacterized protein LOC103318965    293   6e-94    
ref|XP_009800326.1|  PREDICTED: uncharacterized protein LOC104246...    291   2e-93    Nicotiana sylvestris
ref|XP_009800325.1|  PREDICTED: uncharacterized protein LOC104246...    291   2e-93    Nicotiana sylvestris
ref|XP_003540132.1|  PREDICTED: uncharacterized protein LOC100793763    291   2e-93    
ref|XP_007221893.1|  hypothetical protein PRUPE_ppa016090mg             290   4e-93    Prunus persica
ref|XP_009601484.1|  PREDICTED: uncharacterized protein LOC104096770    291   4e-93    Nicotiana tomentosiformis
ref|XP_006431491.1|  hypothetical protein CICLE_v10001419mg             288   3e-92    Citrus clementina [clementine]
gb|ACU18530.1|  unknown                                                 288   3e-92    Glycine max [soybeans]
ref|XP_009791972.1|  PREDICTED: uncharacterized protein LOC104239130    288   3e-92    Nicotiana sylvestris
ref|XP_010553652.1|  PREDICTED: uncharacterized protein LOC104823674    287   1e-91    Tarenaya hassleriana [spider flower]
ref|XP_011028389.1|  PREDICTED: uncharacterized protein LOC105128426    286   2e-91    Populus euphratica
ref|XP_006385074.1|  hypothetical protein POPTR_0004s23660g             286   2e-91    Populus trichocarpa [western balsam poplar]
ref|XP_009399147.1|  PREDICTED: uncharacterized protein LOC103983624    286   2e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414639.1|  PREDICTED: uncharacterized protein LOC103995706    285   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008357658.1|  PREDICTED: uncharacterized protein LOC103421405    285   5e-91    
ref|XP_009355369.1|  PREDICTED: uncharacterized protein LOC103946396    285   6e-91    Pyrus x bretschneideri [bai li]
ref|XP_010682058.1|  PREDICTED: uncharacterized protein LOC104896961    285   1e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006470991.1|  PREDICTED: uncharacterized protein LOC102625...    283   4e-90    Citrus sinensis [apfelsine]
ref|XP_009410706.1|  PREDICTED: uncharacterized protein LOC103992641    283   4e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927836.1|  PREDICTED: uncharacterized protein LOC105049787    282   7e-90    
ref|XP_006836850.1|  hypothetical protein AMTR_s00099p00078200          282   8e-90    Amborella trichopoda
gb|EPS73540.1|  hypothetical protein M569_01216                         283   2e-89    Genlisea aurea
ref|XP_006470990.1|  PREDICTED: uncharacterized protein LOC102625...    281   3e-89    Citrus sinensis [apfelsine]
ref|XP_008812747.1|  PREDICTED: uncharacterized protein LOC103723571    280   5e-89    
ref|XP_010907977.1|  PREDICTED: uncharacterized protein LOC105034483    279   9e-89    Elaeis guineensis
ref|XP_008775897.1|  PREDICTED: uncharacterized protein LOC103696141    278   2e-88    Phoenix dactylifera
ref|XP_006659748.1|  PREDICTED: uncharacterized protein LOC102714034    278   2e-88    Oryza brachyantha
ref|XP_004301567.1|  PREDICTED: uncharacterized protein LOC101308879    278   4e-88    Fragaria vesca subsp. vesca
gb|EYU33292.1|  hypothetical protein MIMGU_mgv1a007588mg                275   4e-87    Erythranthe guttata [common monkey flower]
emb|CDO97644.1|  unnamed protein product                                274   1e-86    Coffea canephora [robusta coffee]
ref|XP_010099779.1|  hypothetical protein L484_010966                   274   1e-86    Morus notabilis
gb|EAZ41277.1|  hypothetical protein OsJ_25784                          270   1e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009411881.1|  PREDICTED: uncharacterized protein LOC103993515    273   3e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ05353.1|  hypothetical protein OsI_27557                          271   3e-85    Oryza sativa Indica Group [Indian rice]
ref|NP_001060819.1|  Os08g0110400                                       270   3e-85    
gb|EMS61782.1|  hypothetical protein TRIUR3_23279                       265   1e-84    Triticum urartu
ref|XP_002444900.1|  hypothetical protein SORBIDRAFT_07g001090          269   1e-84    Sorghum bicolor [broomcorn]
ref|XP_004972466.1|  PREDICTED: uncharacterized protein LOC101769924    268   3e-84    Setaria italica
ref|XP_003573284.1|  PREDICTED: uncharacterized protein LOC100833185    268   4e-84    Brachypodium distachyon [annual false brome]
ref|NP_001143222.1|  uncharacterized protein LOC100275738               267   8e-84    Zea mays [maize]
ref|NP_001143215.1|  uncharacterized protein LOC100275720               266   1e-83    
ref|NP_001052347.1|  Os04g0272400                                       254   8e-79    
emb|CAH67921.1|  OSIGBa0138E08-OSIGBa0161L23.2                          254   8e-79    Oryza sativa [red rice]
ref|XP_009341368.1|  PREDICTED: uncharacterized protein LOC103933398    250   2e-77    Pyrus x bretschneideri [bai li]
ref|XP_008786440.1|  PREDICTED: uncharacterized protein LOC103704...    246   2e-77    Phoenix dactylifera
ref|XP_009415010.1|  PREDICTED: uncharacterized protein LOC103995962    247   2e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786439.1|  PREDICTED: uncharacterized protein LOC103704...    246   4e-76    Phoenix dactylifera
ref|XP_008786442.1|  PREDICTED: uncharacterized protein LOC103704784    243   8e-76    
ref|XP_003567325.1|  PREDICTED: uncharacterized protein LOC100845991    245   1e-75    Brachypodium distachyon [annual false brome]
ref|XP_010930512.1|  PREDICTED: uncharacterized protein LOC105051676    245   2e-75    
ref|XP_008377912.1|  PREDICTED: uncharacterized protein LOC103440993    239   3e-75    
ref|XP_010916432.1|  PREDICTED: uncharacterized protein LOC105041249    244   3e-75    Elaeis guineensis
ref|XP_006645101.1|  PREDICTED: uncharacterized protein LOC102713419    244   4e-75    Oryza brachyantha
ref|XP_010227722.1|  PREDICTED: uncharacterized protein LOC104581568    241   7e-74    Brachypodium distachyon [annual false brome]
ref|XP_009763004.1|  PREDICTED: uncharacterized protein LOC104214...    235   1e-73    Nicotiana sylvestris
gb|EMS55277.1|  hypothetical protein TRIUR3_33067                       242   1e-73    Triticum urartu
ref|XP_010942042.1|  PREDICTED: uncharacterized protein LOC105060...    237   1e-73    
ref|XP_008795296.1|  PREDICTED: uncharacterized protein LOC103711078    239   2e-73    Phoenix dactylifera
ref|XP_010453221.1|  PREDICTED: uncharacterized protein LOC104735185    239   2e-73    Camelina sativa [gold-of-pleasure]
dbj|BAK04145.1|  predicted protein                                      239   3e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006842358.1|  hypothetical protein AMTR_s00079p00180800          233   3e-73    
ref|XP_008796992.1|  PREDICTED: uncharacterized protein LOC103712290    239   4e-73    Phoenix dactylifera
ref|XP_010942037.1|  PREDICTED: uncharacterized protein LOC105060...    238   5e-73    Elaeis guineensis
ref|XP_006394845.1|  hypothetical protein EUTSA_v10004382mg             238   9e-73    Eutrema salsugineum [saltwater cress]
ref|XP_006286517.1|  hypothetical protein CARUB_v10001158mg             238   1e-72    Capsella rubella
ref|XP_002871492.1|  hypothetical protein ARALYDRAFT_909140             238   1e-72    Arabidopsis lyrata subsp. lyrata
ref|XP_010491917.1|  PREDICTED: uncharacterized protein LOC104769408    238   1e-72    Camelina sativa [gold-of-pleasure]
ref|NP_196734.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    238   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355313.1|  PREDICTED: uncharacterized protein LOC102601627    237   2e-72    Solanum tuberosum [potatoes]
gb|ADE76813.1|  unknown                                                 236   2e-72    Picea sitchensis
ref|XP_009337144.1|  PREDICTED: uncharacterized protein LOC103929645    237   2e-72    
gb|KDP29447.1|  hypothetical protein JCGZ_18368                         236   2e-72    Jatropha curcas
ref|XP_010519868.1|  PREDICTED: uncharacterized protein LOC104799181    237   2e-72    Tarenaya hassleriana [spider flower]
ref|XP_004141306.1|  PREDICTED: uncharacterized protein LOC101205668    237   2e-72    Cucumis sativus [cucumbers]
ref|XP_007217120.1|  hypothetical protein PRUPE_ppa015089m1g            231   3e-72    
ref|XP_006426464.1|  hypothetical protein CICLE_v100272021mg            231   3e-72    
ref|XP_009601239.1|  PREDICTED: uncharacterized protein LOC104096562    236   4e-72    Nicotiana tomentosiformis
ref|XP_006399687.1|  hypothetical protein EUTSA_v10013787mg             236   4e-72    Eutrema salsugineum [saltwater cress]
ref|XP_008452696.1|  PREDICTED: uncharacterized protein LOC103493641    236   4e-72    Cucumis melo [Oriental melon]
ref|XP_006485819.1|  PREDICTED: uncharacterized protein LOC102611796    237   5e-72    Citrus sinensis [apfelsine]
ref|XP_010912680.1|  PREDICTED: uncharacterized protein LOC105038537    236   5e-72    Elaeis guineensis
ref|XP_010108861.1|  hypothetical protein L484_027054                   236   5e-72    Morus notabilis
ref|XP_006842356.1|  hypothetical protein AMTR_s00079p00179880          236   6e-72    
ref|XP_006853920.1|  hypothetical protein AMTR_s00036p00191120          234   6e-72    
ref|XP_010419754.1|  PREDICTED: uncharacterized protein LOC104705440    236   7e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010648315.1|  PREDICTED: uncharacterized protein LOC100249300    235   7e-72    Vitis vinifera
ref|XP_004165595.1|  PREDICTED: uncharacterized protein LOC101231487    235   8e-72    
dbj|BAD82090.1|  unknown protein                                        235   8e-72    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044966.1|  Os01g0875800                                       235   8e-72    
ref|XP_002872192.1|  hypothetical protein ARALYDRAFT_910666             235   9e-72    Arabidopsis lyrata subsp. lyrata
ref|XP_002872191.1|  hypothetical protein ARALYDRAFT_351610             235   1e-71    Arabidopsis lyrata subsp. lyrata
ref|XP_010265065.1|  PREDICTED: uncharacterized protein LOC104602904    236   1e-71    Nelumbo nucifera [Indian lotus]
ref|XP_008243270.1|  PREDICTED: uncharacterized protein LOC103341513    235   1e-71    Prunus mume [ume]
ref|XP_007222675.1|  hypothetical protein PRUPE_ppa008602mg             233   1e-71    
gb|EAY76682.1|  hypothetical protein OsI_04637                          234   2e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_004959909.1|  PREDICTED: uncharacterized protein LOC101775358    235   2e-71    Setaria italica
ref|XP_007222895.1|  hypothetical protein PRUPE_ppa006723mg             235   2e-71    Prunus persica
ref|XP_008339646.1|  PREDICTED: uncharacterized protein LOC103402673    235   2e-71    
ref|XP_009357077.1|  PREDICTED: uncharacterized protein LOC103947833    235   2e-71    Pyrus x bretschneideri [bai li]
emb|CBI26990.3|  unnamed protein product                                231   2e-71    Vitis vinifera
gb|KFK25431.1|  hypothetical protein AALP_AA8G114400                    234   2e-71    Arabis alpina [alpine rockcress]
emb|CAN70606.1|  hypothetical protein VITISV_040196                     234   3e-71    Vitis vinifera
ref|NP_001173628.1|  Os03g0731050                                       229   3e-71    
ref|XP_008806040.1|  PREDICTED: uncharacterized protein LOC103718829    234   3e-71    Phoenix dactylifera
emb|CBI33634.3|  unnamed protein product                                231   4e-71    Vitis vinifera
ref|XP_010099264.1|  hypothetical protein L484_015454                   235   4e-71    Morus notabilis
ref|XP_010318628.1|  PREDICTED: uncharacterized protein LOC101267...    230   4e-71    
ref|XP_009763003.1|  PREDICTED: uncharacterized protein LOC104214...    234   4e-71    Nicotiana sylvestris
ref|XP_010941940.1|  PREDICTED: uncharacterized protein LOC105060052    233   4e-71    Elaeis guineensis
ref|XP_009131226.1|  PREDICTED: uncharacterized protein LOC103855927    233   4e-71    Brassica rapa
ref|XP_004245124.1|  PREDICTED: uncharacterized protein LOC101267146    233   5e-71    Solanum lycopersicum
ref|XP_006442617.1|  hypothetical protein CICLE_v10020320mg             234   6e-71    Citrus clementina [clementine]
dbj|BAB86235.1|  P0648C09.24                                            236   6e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010097098.1|  hypothetical protein L484_019537                   233   6e-71    Morus notabilis
emb|CDM85189.1|  unnamed protein product                                233   9e-71    Triticum aestivum [Canadian hard winter wheat]
gb|KJB18563.1|  hypothetical protein B456_003G060300                    233   9e-71    Gossypium raimondii
ref|XP_009624653.1|  PREDICTED: uncharacterized protein LOC104115679    233   1e-70    Nicotiana tomentosiformis
ref|XP_004291015.1|  PREDICTED: uncharacterized protein LOC101301742    233   1e-70    Fragaria vesca subsp. vesca
ref|XP_009361651.1|  PREDICTED: uncharacterized protein LOC103951891    233   1e-70    
ref|XP_011081713.1|  PREDICTED: uncharacterized protein LOC105164695    232   1e-70    Sesamum indicum [beniseed]
ref|XP_008812373.1|  PREDICTED: uncharacterized protein LOC103723273    233   1e-70    Phoenix dactylifera
ref|XP_009772023.1|  PREDICTED: uncharacterized protein LOC104222493    232   1e-70    Nicotiana sylvestris
ref|XP_008220437.1|  PREDICTED: uncharacterized protein LOC103320525    232   2e-70    Prunus mume [ume]
ref|XP_004981886.1|  PREDICTED: uncharacterized protein LOC101780921    232   2e-70    Setaria italica
ref|XP_002280674.1|  PREDICTED: uncharacterized protein LOC100244641    232   3e-70    Vitis vinifera
ref|XP_008393663.1|  PREDICTED: uncharacterized protein LOC103455...    231   3e-70    
ref|XP_011019540.1|  PREDICTED: uncharacterized protein LOC105122240    231   3e-70    Populus euphratica
gb|ABK28713.1|  unknown                                                 231   3e-70    Arabidopsis thaliana [mouse-ear cress]
ref|NP_197969.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    231   3e-70    Arabidopsis thaliana [mouse-ear cress]
gb|EYU20381.1|  hypothetical protein MIMGU_mgv1a0226482mg               226   3e-70    Erythranthe guttata [common monkey flower]
ref|XP_008393665.1|  PREDICTED: uncharacterized protein LOC103455...    231   3e-70    
ref|XP_010049161.1|  PREDICTED: uncharacterized protein LOC104437817    231   3e-70    Eucalyptus grandis [rose gum]
ref|XP_002279551.2|  PREDICTED: uncharacterized protein LOC100250702    232   4e-70    Vitis vinifera
gb|AFW60050.1|  hypothetical protein ZEAMMB73_108408                    233   4e-70    
emb|CDX69735.1|  BnaA10g20840D                                          231   5e-70    
ref|XP_008663766.1|  PREDICTED: uncharacterized protein LOC103642231    232   5e-70    
ref|XP_009778079.1|  PREDICTED: uncharacterized protein LOC104227520    231   5e-70    Nicotiana sylvestris
gb|KJB70318.1|  hypothetical protein B456_011G068900                    231   6e-70    Gossypium raimondii
gb|KHG10617.1|  Putative non-structural 4                               231   6e-70    Gossypium arboreum [tree cotton]
ref|XP_007024391.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    231   6e-70    
ref|XP_008244554.1|  PREDICTED: uncharacterized protein LOC103342693    229   8e-70    Prunus mume [ume]
ref|XP_011007501.1|  PREDICTED: uncharacterized protein LOC105113...    231   8e-70    Populus euphratica
gb|KCW83891.1|  hypothetical protein EUGRSUZ_B00742                     228   8e-70    Eucalyptus grandis [rose gum]
ref|XP_010033803.1|  PREDICTED: uncharacterized protein LOC104423043    230   8e-70    Eucalyptus grandis [rose gum]
ref|XP_004236422.2|  PREDICTED: uncharacterized protein LOC101267...    231   8e-70    Solanum lycopersicum
ref|XP_007044267.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    231   9e-70    
gb|AAD40142.1|AF149413_23  contains similarity to several Arabido...    231   9e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010926004.1|  PREDICTED: uncharacterized protein LOC105048408    231   1e-69    Elaeis guineensis
ref|XP_002466519.1|  hypothetical protein SORBIDRAFT_01g009210          231   1e-69    Sorghum bicolor [broomcorn]
ref|XP_011007493.1|  PREDICTED: uncharacterized protein LOC105113...    231   1e-69    Populus euphratica
ref|XP_009403975.1|  PREDICTED: uncharacterized protein LOC103987406    230   1e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002315929.2|  hypothetical protein POPTR_0010s13160g             230   1e-69    
ref|XP_009344746.1|  PREDICTED: uncharacterized protein LOC103936628    234   2e-69    
ref|XP_006466159.1|  PREDICTED: uncharacterized protein LOC102619633    229   2e-69    
gb|AFO66494.1|  hypothetical protein                                    229   2e-69    Brassica napus [oilseed rape]
ref|XP_010264609.1|  PREDICTED: uncharacterized protein LOC104602574    230   2e-69    Nelumbo nucifera [Indian lotus]
gb|ACF84653.1|  unknown                                                 227   2e-69    Zea mays [maize]
ref|XP_006353820.1|  PREDICTED: uncharacterized protein LOC102581987    227   2e-69    Solanum tuberosum [potatoes]
ref|XP_006651782.1|  PREDICTED: uncharacterized protein LOC102702183    228   2e-69    
gb|KDP29448.1|  hypothetical protein JCGZ_18369                         225   2e-69    Jatropha curcas
gb|EEE59868.1|  hypothetical protein OsJ_12453                          229   2e-69    Oryza sativa Japonica Group [Japonica rice]
emb|CDX97141.1|  BnaC09g44840D                                          229   3e-69    
emb|CDX97139.1|  BnaC09g44860D                                          229   3e-69    
gb|KDO58674.1|  hypothetical protein CISIN_1g040146mg                   229   3e-69    Citrus sinensis [apfelsine]
ref|XP_002516477.1|  conserved hypothetical protein                     228   3e-69    
gb|AAT77886.1|  expressed protein                                       229   3e-69    Oryza sativa Japonica Group [Japonica rice]
gb|KDP34129.1|  hypothetical protein JCGZ_07700                         229   3e-69    Jatropha curcas
tpg|DAA51165.1|  TPA: hypothetical protein ZEAMMB73_778026              223   3e-69    
ref|XP_009345696.1|  PREDICTED: uncharacterized protein LOC103937474    229   4e-69    Pyrus x bretschneideri [bai li]
gb|KJB54739.1|  hypothetical protein B456_009G047200                    228   4e-69    Gossypium raimondii
ref|NP_001169393.1|  uncharacterized protein LOC100383262               229   5e-69    Zea mays [maize]
ref|XP_010244357.1|  PREDICTED: uncharacterized protein LOC104588211    228   6e-69    
gb|KHG11266.1|  Insulin-degrading enzyme                                227   6e-69    Gossypium arboreum [tree cotton]
ref|XP_002309520.1|  hypothetical protein POPTR_0006s24970g             228   6e-69    Populus trichocarpa [western balsam poplar]
ref|XP_009151114.1|  PREDICTED: uncharacterized protein LOC103874440    228   6e-69    Brassica rapa
gb|KJB65609.1|  hypothetical protein B456_010G103300                    228   7e-69    Gossypium raimondii
emb|CDX70416.1|  BnaC03g05000D                                          229   9e-69    
gb|EMT03400.1|  hypothetical protein F775_00930                         224   9e-69    
ref|XP_007044265.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    228   1e-68    Theobroma cacao [chocolate]
ref|XP_009356238.1|  PREDICTED: uncharacterized protein LOC103947108    228   1e-68    Pyrus x bretschneideri [bai li]
gb|EMT12183.1|  hypothetical protein F775_15181                         224   1e-68    
gb|KHN20747.1|  hypothetical protein glysoja_019064                     225   1e-68    Glycine soja [wild soybean]
gb|EEC76122.1|  hypothetical protein OsI_13390                          241   1e-68    Oryza sativa Indica Group [Indian rice]
ref|XP_006344151.1|  PREDICTED: uncharacterized protein LOC102582712    224   1e-68    
emb|CDX78439.1|  BnaA03g03510D                                          227   2e-68    
gb|KHG05757.1|  hypothetical protein F383_31190                         227   2e-68    Gossypium arboreum [tree cotton]
ref|XP_010230469.1|  PREDICTED: uncharacterized protein LOC100843610    227   2e-68    
ref|XP_010999299.1|  PREDICTED: uncharacterized protein LOC105107168    226   2e-68    Populus euphratica
emb|CDP08214.1|  unnamed protein product                                224   2e-68    Coffea canephora [robusta coffee]
ref|XP_004986256.1|  PREDICTED: uncharacterized protein LOC101760830    227   2e-68    
ref|XP_002515894.1|  conserved hypothetical protein                     226   2e-68    Ricinus communis
emb|CBI15481.3|  unnamed protein product                                226   2e-68    Vitis vinifera
ref|XP_010936142.1|  PREDICTED: uncharacterized protein LOC105055840    226   3e-68    Elaeis guineensis
ref|XP_003524367.1|  PREDICTED: uncharacterized protein LOC100815747    226   3e-68    Glycine max [soybeans]
gb|EMS51218.1|  hypothetical protein TRIUR3_07068                       225   3e-68    Triticum urartu
gb|KJB31441.1|  hypothetical protein B456_005G192100                    227   3e-68    Gossypium raimondii
gb|KDP40817.1|  hypothetical protein JCGZ_24816                         226   3e-68    Jatropha curcas
gb|KHN21596.1|  hypothetical protein glysoja_023448                     226   3e-68    Glycine soja [wild soybean]
ref|XP_004252429.1|  PREDICTED: uncharacterized protein LOC101255566    224   3e-68    
ref|XP_010267069.1|  PREDICTED: uncharacterized protein LOC104604...    226   3e-68    Nelumbo nucifera [Indian lotus]
ref|XP_004300973.1|  PREDICTED: uncharacterized protein LOC101293399    226   4e-68    Fragaria vesca subsp. vesca
ref|XP_004238913.2|  PREDICTED: uncharacterized protein LOC101249916    225   4e-68    Solanum lycopersicum
ref|XP_002447391.1|  hypothetical protein SORBIDRAFT_06g034240          228   4e-68    Sorghum bicolor [broomcorn]
ref|XP_010265068.1|  PREDICTED: uncharacterized protein LOC104602905    226   5e-68    Nelumbo nucifera [Indian lotus]
ref|XP_002276828.1|  PREDICTED: uncharacterized protein LOC100247520    226   5e-68    
ref|XP_011469419.1|  PREDICTED: uncharacterized protein LOC105352951    226   5e-68    Fragaria vesca subsp. vesca
ref|XP_010045650.1|  PREDICTED: uncharacterized protein LOC104434412    226   6e-68    Eucalyptus grandis [rose gum]
ref|XP_010094729.1|  hypothetical protein L484_019938                   227   7e-68    Morus notabilis
ref|XP_006450782.1|  hypothetical protein CICLE_v10008613mg             225   7e-68    
gb|ACL54529.1|  unknown                                                 226   8e-68    Zea mays [maize]
ref|XP_009625225.1|  PREDICTED: uncharacterized protein LOC104116132    225   8e-68    Nicotiana tomentosiformis
gb|KEH44200.1|  core-2/I-branching enzyme                               226   8e-68    Medicago truncatula
ref|NP_001143735.1|  uncharacterized protein LOC100276489               226   9e-68    
ref|XP_008672591.1|  PREDICTED: uncharacterized protein LOC100276...    226   9e-68    
ref|XP_006369242.1|  hypothetical protein POPTR_0001s20050g             225   9e-68    Populus trichocarpa [western balsam poplar]
gb|KDO59065.1|  hypothetical protein CISIN_1g042794mg                   223   1e-67    Citrus sinensis [apfelsine]
gb|KEH39949.1|  core-2/I-branching enzyme                               224   1e-67    Medicago truncatula
gb|KHN37013.1|  hypothetical protein glysoja_009041                     223   1e-67    Glycine soja [wild soybean]
ref|XP_011072929.1|  PREDICTED: uncharacterized protein LOC105158025    226   1e-67    Sesamum indicum [beniseed]
ref|XP_006430742.1|  hypothetical protein CICLE_v10013811mg             223   1e-67    Citrus clementina [clementine]
ref|XP_006341708.1|  PREDICTED: uncharacterized protein LOC102599552    226   1e-67    Solanum tuberosum [potatoes]
ref|XP_002524909.1|  conserved hypothetical protein                     225   1e-67    Ricinus communis
ref|XP_006482399.1|  PREDICTED: uncharacterized protein LOC102630459    223   1e-67    
ref|XP_009768969.1|  PREDICTED: uncharacterized protein LOC104219898    225   1e-67    Nicotiana sylvestris
ref|XP_007012231.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    224   1e-67    
ref|XP_002516755.1|  conserved hypothetical protein                     224   1e-67    
ref|XP_002466518.1|  hypothetical protein SORBIDRAFT_01g009200          224   2e-67    
ref|XP_010536211.1|  PREDICTED: uncharacterized protein LOC104811254    224   2e-67    Tarenaya hassleriana [spider flower]
ref|XP_010062561.1|  PREDICTED: uncharacterized protein LOC104449935    224   2e-67    
ref|XP_009589451.1|  PREDICTED: uncharacterized protein LOC104086812    225   2e-67    Nicotiana tomentosiformis
gb|EMS50058.1|  hypothetical protein TRIUR3_05627                       220   2e-67    Triticum urartu
ref|XP_002535241.1|  conserved hypothetical protein                     221   2e-67    
ref|XP_002466520.1|  hypothetical protein SORBIDRAFT_01g009220          224   2e-67    Sorghum bicolor [broomcorn]
ref|XP_011007454.1|  PREDICTED: uncharacterized protein LOC105113...    224   2e-67    Populus euphratica
ref|XP_010479681.1|  PREDICTED: uncharacterized protein LOC104758496    224   2e-67    Camelina sativa [gold-of-pleasure]
ref|XP_003530022.2|  PREDICTED: uncharacterized protein LOC100791882    224   2e-67    
ref|XP_011007447.1|  PREDICTED: uncharacterized protein LOC105113...    224   2e-67    
ref|XP_003550286.1|  PREDICTED: uncharacterized protein LOC100785919    224   2e-67    
gb|AFO66521.1|  putative clathrin binding protein                       233   2e-67    
ref|XP_004137544.1|  PREDICTED: uncharacterized protein LOC101209845    221   2e-67    
ref|XP_006357367.1|  PREDICTED: uncharacterized protein LOC102582902    224   2e-67    
gb|AAM63616.1|  unknown                                                 223   3e-67    
ref|XP_010678016.1|  PREDICTED: uncharacterized protein LOC104893585    224   3e-67    
ref|XP_011081610.1|  PREDICTED: uncharacterized protein LOC105164614    224   3e-67    
ref|XP_008790242.1|  PREDICTED: uncharacterized protein LOC103707505    223   3e-67    
emb|CBI15480.3|  unnamed protein product                                221   3e-67    
ref|NP_566682.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    223   3e-67    
ref|XP_011022393.1|  PREDICTED: uncharacterized protein LOC105124187    224   3e-67    
tpg|DAA51164.1|  TPA: hypothetical protein ZEAMMB73_778026              223   4e-67    
ref|XP_009367505.1|  PREDICTED: uncharacterized protein LOC103957137    223   4e-67    
ref|XP_009122883.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin int...    233   4e-67    
dbj|BAK05476.1|  predicted protein                                      223   4e-67    
ref|XP_011076478.1|  PREDICTED: uncharacterized protein LOC105160693    223   4e-67    
ref|XP_002458851.1|  hypothetical protein SORBIDRAFT_03g041470          223   4e-67    
ref|XP_007226202.1|  hypothetical protein PRUPE_ppa016185mg             224   5e-67    
ref|XP_002891661.1|  hypothetical protein ARALYDRAFT_337332             223   5e-67    
ref|XP_006468735.1|  PREDICTED: uncharacterized protein LOC102627900    223   5e-67    
emb|CDY56916.1|  BnaCnng31370D                                          223   5e-67    
ref|XP_006299117.1|  hypothetical protein CARUB_v10015258mg             223   6e-67    
ref|XP_002305172.2|  hypothetical protein POPTR_0004s09690g             222   6e-67    
ref|XP_008244747.1|  PREDICTED: uncharacterized protein LOC103342870    223   6e-67    
ref|XP_007215514.1|  hypothetical protein PRUPE_ppa007018mg             223   6e-67    
ref|XP_002883297.1|  hypothetical protein ARALYDRAFT_479651             223   6e-67    
ref|XP_010500763.1|  PREDICTED: uncharacterized protein LOC104778093    223   7e-67    
ref|XP_009402165.1|  PREDICTED: uncharacterized protein LOC103986...    223   7e-67    
ref|NP_001143764.1|  uncharacterized protein LOC100276526               223   7e-67    
ref|XP_007033224.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    223   8e-67    
ref|XP_002311468.2|  hypothetical protein POPTR_0008s12260g             223   9e-67    
emb|CDX97140.1|  BnaC09g44850D                                          223   9e-67    
ref|XP_004972519.1|  PREDICTED: uncharacterized protein LOC101756391    224   9e-67    
ref|XP_011014143.1|  PREDICTED: uncharacterized protein LOC105118003    222   9e-67    
gb|AAG50880.1|AC025294_18  hypothetical protein                         223   1e-66    
ref|XP_010669159.1|  PREDICTED: uncharacterized protein LOC104886401    222   1e-66    
ref|XP_007208909.1|  hypothetical protein PRUPE_ppa027107mg             219   1e-66    
ref|NP_175588.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    223   1e-66    
ref|XP_008374777.1|  PREDICTED: uncharacterized protein LOC103438016    223   1e-66    
ref|XP_002324745.2|  hypothetical protein POPTR_0018s04680g             222   1e-66    
ref|XP_009348209.1|  PREDICTED: uncharacterized protein LOC103939820    223   1e-66    
ref|XP_008812111.1|  PREDICTED: uncharacterized protein LOC103723082    222   1e-66    
ref|XP_010106109.1|  hypothetical protein L484_003112                   222   1e-66    
ref|XP_007044266.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    222   2e-66    
ref|NP_001130080.1|  uncharacterized protein LOC100191173               221   2e-66    
ref|XP_011011841.1|  PREDICTED: uncharacterized protein LOC105116265    221   2e-66    
ref|XP_002321482.2|  hypothetical protein POPTR_0015s03840g             222   2e-66    
ref|XP_008453432.1|  PREDICTED: uncharacterized protein LOC103494140    219   2e-66    
gb|ACF85887.1|  unknown                                                 221   2e-66    
ref|XP_011035090.1|  PREDICTED: uncharacterized protein LOC105133011    221   2e-66    
ref|XP_006417407.1|  hypothetical protein EUTSA_v10009677mg             221   2e-66    
ref|XP_010466367.1|  PREDICTED: uncharacterized protein LOC104746558    221   2e-66    
ref|XP_009630467.1|  PREDICTED: uncharacterized protein LOC104120416    221   2e-66    
ref|XP_004498923.1|  PREDICTED: uncharacterized protein LOC101515236    221   2e-66    
ref|XP_006647208.1|  PREDICTED: uncharacterized protein LOC102715175    223   2e-66    
ref|XP_004160451.1|  PREDICTED: uncharacterized protein LOC101227205    221   3e-66    
ref|XP_008240316.1|  PREDICTED: uncharacterized protein LOC103338837    222   3e-66    
ref|XP_010663889.1|  PREDICTED: uncharacterized protein LOC100252627    221   3e-66    
ref|XP_010493855.1|  PREDICTED: uncharacterized protein LOC104771079    221   3e-66    
ref|XP_004241946.1|  PREDICTED: uncharacterized protein LOC101261829    221   3e-66    
gb|KCW86302.1|  hypothetical protein EUGRSUZ_B02994                     218   3e-66    
ref|XP_003545368.1|  PREDICTED: uncharacterized protein LOC100819890    221   3e-66    
emb|CDY51451.1|  BnaA05g36680D                                          221   3e-66    
ref|XP_004301820.1|  PREDICTED: uncharacterized protein LOC101311102    222   4e-66    
ref|XP_007142937.1|  hypothetical protein PHAVU_007G029800g             221   4e-66    
gb|KHN06677.1|  hypothetical protein glysoja_021223                     221   4e-66    
ref|XP_002276490.2|  PREDICTED: uncharacterized protein LOC100266878    221   4e-66    
ref|XP_008380827.1|  PREDICTED: uncharacterized protein LOC103443716    220   5e-66    
gb|EYU30001.1|  hypothetical protein MIMGU_mgv1a007596mg                221   5e-66    
emb|CDP00652.1|  unnamed protein product                                218   5e-66    
ref|XP_010488146.1|  PREDICTED: uncharacterized protein LOC104766030    220   6e-66    
ref|XP_002315928.1|  hypothetical protein POPTR_0010s13150g             220   6e-66    
ref|XP_009145490.1|  PREDICTED: uncharacterized protein LOC103869...    219   6e-66    
ref|XP_006286838.1|  hypothetical protein CARUB_v10003837mg             220   7e-66    
ref|XP_007160978.1|  hypothetical protein PHAVU_001G033200g             219   1e-65    
ref|XP_010421452.1|  PREDICTED: uncharacterized protein LOC104706914    219   1e-65    
ref|XP_009338135.1|  PREDICTED: uncharacterized protein LOC103930517    219   1e-65    
ref|XP_003536674.1|  PREDICTED: uncharacterized protein LOC100810724    220   1e-65    
ref|XP_011100115.1|  PREDICTED: uncharacterized protein LOC105178347    220   1e-65    
ref|XP_009767015.1|  PREDICTED: uncharacterized protein LOC104218...    217   1e-65    
ref|XP_009145487.1|  PREDICTED: uncharacterized protein LOC103869...    219   1e-65    
ref|XP_006448426.1|  hypothetical protein CICLE_v10015505mg             219   2e-65    
ref|XP_003532515.1|  PREDICTED: uncharacterized protein LOC100782511    219   2e-65    
ref|XP_002321483.2|  hypothetical protein POPTR_0015s03850g             219   2e-65    
emb|CDO98418.1|  unnamed protein product                                216   2e-65    
ref|XP_007160392.1|  hypothetical protein PHAVU_002G318000g             219   2e-65    
gb|KHN16548.1|  hypothetical protein glysoja_002645                     218   2e-65    
ref|XP_010046585.1|  PREDICTED: uncharacterized protein LOC104435558    219   3e-65    
ref|XP_010066702.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    220   3e-65    
gb|KJB08436.1|  hypothetical protein B456_001G081500                    218   3e-65    
gb|EPS59287.1|  hypothetical protein M569_15522                         218   3e-65    
ref|XP_003533360.1|  PREDICTED: uncharacterized protein LOC100803748    220   3e-65    
ref|XP_009615448.1|  PREDICTED: uncharacterized protein LOC104108166    219   3e-65    
ref|XP_009360137.1|  PREDICTED: uncharacterized protein LOC103950632    219   4e-65    
ref|XP_004299046.1|  PREDICTED: uncharacterized protein LOC101307491    218   4e-65    
gb|KHF98579.1|  hypothetical protein F383_37748                         214   5e-65    
ref|XP_009415632.1|  PREDICTED: uncharacterized protein LOC103996435    216   5e-65    
ref|XP_008391294.1|  PREDICTED: uncharacterized protein LOC103453537    218   5e-65    
gb|EYU45841.1|  hypothetical protein MIMGU_mgv1a018710mg                218   5e-65    
ref|XP_002977635.1|  hypothetical protein SELMODRAFT_107168             216   5e-65    
ref|XP_004238911.1|  PREDICTED: uncharacterized protein LOC101249358    218   5e-65    
ref|XP_008812383.1|  PREDICTED: uncharacterized protein LOC103723284    218   6e-65    
ref|XP_004154808.1|  PREDICTED: uncharacterized protein LOC101228236    218   7e-65    
ref|XP_004146835.1|  PREDICTED: uncharacterized protein LOC101208492    218   7e-65    
ref|NP_001170302.1|  uncharacterized protein LOC100384266               218   7e-65    
ref|XP_003555913.1|  PREDICTED: uncharacterized protein LOC100779041    218   7e-65    
tpg|DAA47679.1|  TPA: hypothetical protein ZEAMMB73_259148              218   8e-65    
ref|XP_007036566.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    219   8e-65    
ref|XP_009131527.1|  PREDICTED: uncharacterized protein LOC103856...    216   8e-65    
gb|KFK35824.1|  hypothetical protein AALP_AA4G041900                    218   8e-65    
ref|XP_003614560.1|  hypothetical protein MTR_5g055480                  217   8e-65    
ref|XP_002871706.1|  hypothetical protein ARALYDRAFT_326063             218   9e-65    
ref|XP_009767014.1|  PREDICTED: uncharacterized protein LOC104218...    218   9e-65    
dbj|BAJ98037.1|  predicted protein                                      219   9e-65    
ref|XP_006344154.1|  PREDICTED: uncharacterized protein LOC102583596    217   1e-64    
emb|CDX78674.1|  BnaA03g05860D                                          218   1e-64    
ref|XP_010916430.1|  PREDICTED: uncharacterized protein LOC105041248    218   1e-64    
ref|XP_010415458.1|  PREDICTED: uncharacterized protein LOC104701464    218   1e-64    
emb|CDP02764.1|  unnamed protein product                                214   1e-64    
ref|XP_010694626.1|  PREDICTED: uncharacterized protein LOC104907403    216   1e-64    
ref|XP_010690090.1|  PREDICTED: uncharacterized protein LOC104903696    217   1e-64    
ref|XP_009131528.1|  PREDICTED: uncharacterized protein LOC103856...    215   1e-64    
ref|XP_010693288.1|  PREDICTED: uncharacterized protein LOC104906249    217   1e-64    
ref|XP_006344302.1|  PREDICTED: uncharacterized protein LOC102604936    216   1e-64    
ref|XP_008393326.1|  PREDICTED: uncharacterized protein LOC103455513    218   1e-64    
ref|XP_009786387.1|  PREDICTED: uncharacterized protein LOC104234513    216   2e-64    
emb|CAC01858.1|  putative protein                                       214   2e-64    
ref|XP_010094730.1|  hypothetical protein L484_019940                   216   2e-64    
ref|XP_008447582.1|  PREDICTED: uncharacterized protein LOC103489998    216   2e-64    
gb|EYU40777.1|  hypothetical protein MIMGU_mgv1a007709mg                216   2e-64    
gb|ACU18543.1|  unknown                                                 217   3e-64    
emb|CDY59035.1|  BnaCnng34190D                                          217   3e-64    
ref|XP_004297621.1|  PREDICTED: uncharacterized protein LOC101304278    216   3e-64    
emb|CDY19328.1|  BnaC05g08370D                                          216   3e-64    
ref|XP_009413609.1|  PREDICTED: uncharacterized protein LOC103994882    216   3e-64    
ref|XP_006469090.1|  PREDICTED: uncharacterized protein LOC102627718    215   3e-64    
emb|CDO98417.1|  unnamed protein product                                216   4e-64    
ref|XP_006287845.1|  hypothetical protein CARUB_v10001069mg             216   4e-64    
ref|XP_008645560.1|  PREDICTED: uncharacterized protein LOC103626979    218   4e-64    
ref|XP_011070777.1|  PREDICTED: uncharacterized protein LOC105156363    216   4e-64    
ref|XP_006392995.1|  hypothetical protein EUTSA_v10012322mg             216   4e-64    
gb|KHG14930.1|  Putative DNA helicase ino80                             215   5e-64    
gb|KDO76927.1|  hypothetical protein CISIN_1g046575mg                   216   5e-64    
ref|XP_011008309.1|  PREDICTED: uncharacterized protein LOC105113714    216   5e-64    
emb|CDX70676.1|  BnaC03g07600D                                          216   5e-64    
ref|XP_011097225.1|  PREDICTED: uncharacterized protein LOC105176192    213   5e-64    
gb|KEH27363.1|  core-2/I-branching enzyme                               215   6e-64    
dbj|BAJ98929.1|  predicted protein                                      217   6e-64    
ref|XP_009601960.1|  PREDICTED: uncharacterized protein LOC104097139    215   7e-64    
dbj|BAF00442.1|  hypothetical protein                                   215   7e-64    
ref|XP_010510112.1|  PREDICTED: uncharacterized protein LOC104786396    215   7e-64    
ref|XP_009131526.1|  PREDICTED: uncharacterized protein LOC103856...    216   7e-64    
ref|XP_010513660.1|  PREDICTED: uncharacterized protein LOC104789704    215   7e-64    
ref|XP_002442608.1|  hypothetical protein SORBIDRAFT_08g022900          215   7e-64    
gb|KJB61248.1|  hypothetical protein B456_009G347900                    215   8e-64    
ref|NP_197121.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    215   8e-64    
ref|XP_010524350.1|  PREDICTED: uncharacterized protein LOC104802437    214   8e-64    
gb|EYU41282.1|  hypothetical protein MIMGU_mgv1a010939mg                212   9e-64    
ref|XP_004497066.1|  PREDICTED: uncharacterized protein LOC101490811    215   9e-64    
ref|XP_009767018.1|  PREDICTED: uncharacterized protein LOC104218270    215   9e-64    
ref|XP_010453774.1|  PREDICTED: uncharacterized protein LOC104735642    215   1e-63    
ref|XP_006391143.1|  hypothetical protein EUTSA_v10019817mg             215   1e-63    
ref|XP_009615449.1|  PREDICTED: uncharacterized protein LOC104108167    215   1e-63    
ref|XP_009780294.1|  PREDICTED: uncharacterized protein LOC104229...    213   1e-63    
ref|XP_009357886.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    217   1e-63    
gb|KJB08433.1|  hypothetical protein B456_001G081300                    214   1e-63    
gb|EPS62381.1|  hypothetical protein M569_12413                         214   1e-63    
ref|XP_008459241.1|  PREDICTED: uncharacterized protein LOC103498396    214   1e-63    
gb|EPS68648.1|  hypothetical protein M569_06120                         213   1e-63    
ref|XP_002975225.1|  hypothetical protein SELMODRAFT_102845             213   1e-63    
ref|XP_006406285.1|  hypothetical protein EUTSA_v10021956mg             214   2e-63    
ref|XP_010537457.1|  PREDICTED: uncharacterized protein LOC104812147    214   2e-63    
ref|XP_011095814.1|  PREDICTED: uncharacterized protein LOC105175...    213   2e-63    
ref|XP_006343019.1|  PREDICTED: uncharacterized protein LOC102599337    214   2e-63    
ref|XP_011072465.1|  PREDICTED: uncharacterized protein LOC105157713    214   2e-63    
ref|XP_010420299.1|  PREDICTED: uncharacterized protein LOC104705...    214   3e-63    
ref|XP_007224741.1|  hypothetical protein PRUPE_ppa024535mg             214   3e-63    
ref|XP_010470788.1|  PREDICTED: uncharacterized protein LOC104750...    214   3e-63    
ref|XP_009780287.1|  PREDICTED: uncharacterized protein LOC104229...    213   3e-63    
ref|XP_004236394.1|  PREDICTED: uncharacterized protein LOC101257059    213   3e-63    
ref|XP_006302341.1|  hypothetical protein CARUB_v10020398mg             214   3e-63    
ref|XP_008351921.1|  PREDICTED: uncharacterized protein LOC103415361    210   4e-63    
ref|XP_004516650.1|  PREDICTED: uncharacterized protein LOC101496316    213   4e-63    
emb|CDO97949.1|  unnamed protein product                                213   4e-63    
ref|XP_006448428.1|  hypothetical protein CICLE_v10017943mg             213   5e-63    
ref|XP_011095742.1|  PREDICTED: uncharacterized protein LOC105175...    213   5e-63    
ref|XP_010470787.1|  PREDICTED: uncharacterized protein LOC104750...    215   5e-63    
emb|CDX87842.1|  BnaC06g09040D                                          213   5e-63    
emb|CDX69465.1|  BnaA10g18140D                                          213   5e-63    
ref|XP_003620433.1|  hypothetical protein MTR_6g083830                  213   5e-63    
ref|XP_009121508.1|  PREDICTED: uncharacterized protein LOC103846350    213   5e-63    
gb|AES76651.2|  core-2/I-branching enzyme                               213   5e-63    
ref|XP_002887179.1|  hypothetical protein ARALYDRAFT_475958             213   7e-63    
ref|XP_007152746.1|  hypothetical protein PHAVU_004G156000g             214   7e-63    
ref|XP_011097027.1|  PREDICTED: uncharacterized protein LOC105176048    213   7e-63    
ref|XP_006400149.1|  hypothetical protein EUTSA_v10013684mg             213   8e-63    
gb|EYU44620.1|  hypothetical protein MIMGU_mgv1a022082mg                209   8e-63    
ref|XP_004299045.1|  PREDICTED: uncharacterized protein LOC101307203    213   9e-63    
ref|XP_009105384.1|  PREDICTED: uncharacterized protein LOC103831252    213   9e-63    
gb|KJB77167.1|  hypothetical protein B456_012G124200                    206   1e-62    
ref|XP_009144879.1|  PREDICTED: uncharacterized protein LOC103868547    212   1e-62    
ref|XP_004161852.1|  PREDICTED: uncharacterized LOC101207320            211   1e-62    
ref|NP_001067359.2|  Os12g0635500                                       206   1e-62    
dbj|BAJ90641.1|  predicted protein                                      212   1e-62    
gb|KFK41255.1|  hypothetical protein AALP_AA2G105500                    212   1e-62    
emb|CDX81507.1|  BnaC02g18110D                                          212   1e-62    
gb|EYU21409.1|  hypothetical protein MIMGU_mgv1a007990mg                211   3e-62    
ref|XP_009393005.1|  PREDICTED: uncharacterized protein LOC103978798    211   3e-62    
ref|XP_008467193.1|  PREDICTED: uncharacterized protein LOC103504601    210   4e-62    
ref|XP_004510336.1|  PREDICTED: uncharacterized protein LOC101496152    210   4e-62    
gb|EYU44621.1|  hypothetical protein MIMGU_mgv1a022423mg                207   6e-62    
gb|KJB34325.1|  hypothetical protein B456_006G060000                    211   8e-62    
ref|XP_007208880.1|  hypothetical protein PRUPE_ppa026447mg             211   8e-62    
ref|XP_003571226.1|  PREDICTED: uncharacterized protein LOC100832462    211   8e-62    
ref|XP_004301821.1|  PREDICTED: uncharacterized protein LOC101311681    210   1e-61    
emb|CBI15479.3|  unnamed protein product                                206   1e-61    
ref|XP_003579091.1|  PREDICTED: uncharacterized protein LOC100825359    210   1e-61    
ref|NP_177006.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    210   1e-61    
ref|XP_008240317.1|  PREDICTED: uncharacterized protein LOC103338839    209   1e-61    
ref|XP_009127627.1|  PREDICTED: uncharacterized protein LOC103852476    209   1e-61    



>ref|XP_006349290.1| PREDICTED: uncharacterized protein LOC102579219 [Solanum tuberosum]
Length=397

 Score =   318 bits (815),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVYKYL  S HSF+ESYDDP+RYGRGRYN  MKPDIKL +W
Sbjct  209  SNERFVLLSESCIPVYNFPTVYKYLIGSIHSFVESYDDPSRYGRGRYNRHMKPDIKLPDW  268

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEMNR LA+ +VS+TK+Y +F+++C+P+CYPDEHYIPT+++L HG +NANR+VT
Sbjct  269  RKGSQWFEMNRTLAVRVVSDTKYYDIFRRFCKPACYPDEHYIPTFIRLFHGPLNANRTVT  328

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            YVDWSLGGPHPA+++A NITEGF+Q IR+NGT+C+YN  KT +CYLFARKF PSALEPL 
Sbjct  329  YVDWSLGGPHPAAFSAVNITEGFLQLIRNNGTACAYNSEKTHVCYLFARKFNPSALEPLL  388

Query  158  KLSLKVMGF  132
             LS KVM F
Sbjct  389  NLSSKVMEF  397



>ref|XP_004230423.1| PREDICTED: uncharacterized protein LOC101259085 [Solanum lycopersicum]
Length=406

 Score =   314 bits (804),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVYKYL  S HSF+ESYDDP+RYGRGRYN  M+PDIKL +W
Sbjct  218  SNERFVLLSESCIPVYNFPTVYKYLIGSIHSFVESYDDPSRYGRGRYNRHMRPDIKLPDW  277

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEMNR LA+ +VS+TK+Y +F+++C+P+CYPDEHYIPT ++L HG +NANR+VT
Sbjct  278  RKGSQWFEMNRTLAVRVVSDTKYYDLFERFCKPACYPDEHYIPTLIRLFHGPLNANRTVT  337

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            YVDWSLGGPHPA+++A NITEGF+Q IR+NGT+C+YN  KT +CYLFARKF PSALEPL 
Sbjct  338  YVDWSLGGPHPAAFSAVNITEGFLQLIRNNGTACAYNSEKTHVCYLFARKFNPSALEPLL  397

Query  158  KLSLKVMGF  132
             LS KVM +
Sbjct  398  NLSSKVMEY  406



>ref|XP_011092268.1| PREDICTED: uncharacterized protein LOC105172507 [Sesamum indicum]
Length=477

 Score =   314 bits (804),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/189 (76%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVYKYL ES HSF+ESYDDPTRYGRGRY+  MKPDI L EW
Sbjct  290  SNERFVLLSESCIPIYNFPTVYKYLVESAHSFVESYDDPTRYGRGRYSRWMKPDITLSEW  349

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R LA+ IV++TK+Y +F+KYC+PSCYPDEHYIPTYL+  HG +N+NR+VT
Sbjct  350  RKGSQWFEMHRTLAVKIVADTKYYMLFRKYCKPSCYPDEHYIPTYLRKFHGALNSNRTVT  409

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            YVDWS   PHPAS+TAAN+TEGFIQS+R+NGT CSYN GKT ICYLFARKF PSALEPL 
Sbjct  410  YVDWSEMAPHPASFTAANVTEGFIQSLRNNGT-CSYNSGKTPICYLFARKFDPSALEPLL  468

Query  158  KLSLKVMGF  132
              + +VMGF
Sbjct  469  SFASQVMGF  477



>gb|KJB08617.1| hypothetical protein B456_001G093200 [Gossypium raimondii]
Length=394

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESCIPVY+FPTVYKYL  ST+SF+ESYDDPTRYGRGRYN +M P IKL++W
Sbjct  206  SNERFILLSESCIPVYNFPTVYKYLIGSTYSFVESYDDPTRYGRGRYNRKMLPHIKLYQW  265

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM R++A  IVS+TK+Y +FKKYC+P+CYPDEHYIPTYL + HG +NANR++T
Sbjct  266  RKGSQWFEMQRSVATYIVSDTKYYNLFKKYCKPACYPDEHYIPTYLNMFHGSLNANRTIT  325

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA Y   N+TEGFIQSIR+NGT CSYN   T +CYLFARKF PSALEPL 
Sbjct  326  WVDWSMGGPHPAKYEGVNVTEGFIQSIRNNGTLCSYNDELTSVCYLFARKFAPSALEPLL  385

Query  158  KLSLKVMGF  132
             LS  VM F
Sbjct  386  NLSSTVMNF  394



>ref|XP_002528868.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33542.1| conserved hypothetical protein [Ricinus communis]
Length=282

 Score =   304 bits (778),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVY+YL  S +SF+ESYDDPTRYGRGRYN +M PDI+L++W
Sbjct  91   SNERFVLLSESCIPVYNFPTVYRYLIHSEYSFVESYDDPTRYGRGRYNRKMLPDIRLYQW  150

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ RALA+ +VS+TK+Y++FK+YCRP+CYPDEHYIPTYL + HG +NANR+VT
Sbjct  151  RKGSQWFEIQRALAVYMVSDTKYYSIFKRYCRPACYPDEHYIPTYLNMFHGSLNANRTVT  210

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA+Y   N+TE FIQSIR+N T CSYN   T +CYLFARKF PSALEPL 
Sbjct  211  WVDWSFGGPHPATYMGINVTESFIQSIRNNKTQCSYNSEMTSVCYLFARKFHPSALEPLL  270

Query  158  KLSLKVMGF  132
             L+  V G 
Sbjct  271  NLTSTVPGI  279



>ref|XP_007022850.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY25472.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=390

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVYKYL  ST+SF+ESYDDP+RYGRGRY+ +M PDIKL++W
Sbjct  202  SNERFVLLSESCIPVYNFPTVYKYLIGSTYSFVESYDDPSRYGRGRYSRKMLPDIKLYQW  261

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R +AI I+S+TK+Y +F+KYCRP+CYPDEHYIPT+L + HG +NANRSVT
Sbjct  262  RKGSQWFEMHRLVAIYIISDTKYYTLFRKYCRPACYPDEHYIPTFLNMFHGSLNANRSVT  321

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA +  ANITEGFIQ+IR NGT CSYN  +T  CYLFARKF PSALE L 
Sbjct  322  WVDWSMGGPHPAMHGGANITEGFIQAIRKNGTLCSYNEEQTSACYLFARKFAPSALESLL  381

Query  158  KLSLKVMGF  132
             LS  VM F
Sbjct  382  NLSSTVMEF  390



>ref|XP_002268014.1| PREDICTED: uncharacterized protein LOC100250508 [Vitis vinifera]
Length=379

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FP VYKYL  S +SF+ESYDDP+RYGRGRY+  M P+IKL++W
Sbjct  188  SNERFVLLSESCIPIYNFPIVYKYLINSDYSFVESYDDPSRYGRGRYSRNMLPNIKLYQW  247

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ IV++TK+Y +FKKYC+PSCYPDEHYI T+L + +G +NANRSVT
Sbjct  248  RKGSQWFELSRELAVNIVADTKYYTLFKKYCKPSCYPDEHYIQTFLNMFYGSLNANRSVT  307

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+  AANITEGFIQ++R+NGT C YN  KT +CYLFARKF PSALEPL 
Sbjct  308  WVDWSMGGPHPATLGAANITEGFIQALRNNGTVCPYNSEKTSVCYLFARKFAPSALEPLL  367

Query  158  KLSLKVMGF  132
             L+ KVMGF
Sbjct  368  NLTSKVMGF  376



>emb|CBI29648.3| unnamed protein product [Vitis vinifera]
Length=409

 Score =   303 bits (776),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FP VYKYL  S +SF+ESYDDP+RYGRGRY+  M P+IKL++W
Sbjct  218  SNERFVLLSESCIPIYNFPIVYKYLINSDYSFVESYDDPSRYGRGRYSRNMLPNIKLYQW  277

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ IV++TK+Y +FKKYC+PSCYPDEHYI T+L + +G +NANRSVT
Sbjct  278  RKGSQWFELSRELAVNIVADTKYYTLFKKYCKPSCYPDEHYIQTFLNMFYGSLNANRSVT  337

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+  AANITEGFIQ++R+NGT C YN  KT +CYLFARKF PSALEPL 
Sbjct  338  WVDWSMGGPHPATLGAANITEGFIQALRNNGTVCPYNSEKTSVCYLFARKFAPSALEPLL  397

Query  158  KLSLKVMGF  132
             L+ KVMGF
Sbjct  398  NLTSKVMGF  406



>gb|KFK43315.1| hypothetical protein AALP_AA1G108500 [Arabis alpina]
Length=409

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  221  SNERFVLLSESCVPVYNFSTVYTYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  280

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT
Sbjct  281  RKGSQWFEVNRKLAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVT  340

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y AANITEGF+QSIR+N T C YN   T +C+LFARKF PSAL PL 
Sbjct  341  WVDWSIGGPHPATYAAANITEGFLQSIRNNETDCLYNEEPTSLCFLFARKFSPSALAPLM  400

Query  158  KLSLKVMGF  132
             LS  V+GF
Sbjct  401  NLSSTVLGF  409



>ref|XP_006385195.1| hypothetical protein POPTR_0003s00960g [Populus trichocarpa]
 gb|ERP62992.1| hypothetical protein POPTR_0003s00960g [Populus trichocarpa]
Length=392

 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVYKYL  S +SF+ESYD+PTRYGRGRY+ +M PDI L++W
Sbjct  204  SNERFVLLSESCIPIYNFPTVYKYLIRSEYSFVESYDEPTRYGRGRYSRKMLPDIHLYQW  263

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ R LA+ IVS+TK+Y +FKKYCRP+CYPDEHYIPTYL + HG +N+NRSVT
Sbjct  264  RKGSQWFEIQRDLAVYIVSDTKYYTIFKKYCRPACYPDEHYIPTYLNMFHGSLNSNRSVT  323

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA Y   NITE FIQSIR+NGT CSYN   T +CYLFARKF PSAL PL 
Sbjct  324  WVDWSIGGPHPARYGGGNITEDFIQSIRNNGTQCSYNSEMTSVCYLFARKFAPSALVPLL  383

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  384  SLTSTVMEF  392



>ref|XP_011047853.1| PREDICTED: uncharacterized protein LOC105142093 [Populus euphratica]
 ref|XP_011003712.1| PREDICTED: uncharacterized protein LOC105110387 [Populus euphratica]
Length=392

 Score =   300 bits (769),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVYKYL  S +SF+ESYD+PTRYGRGRY+ +M PDI L++W
Sbjct  204  SNERFVLLSESCIPIYNFPTVYKYLIRSEYSFVESYDEPTRYGRGRYSRKMLPDIHLYQW  263

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ R LA+ IVS+TK+Y +FKKYCRP CYPDEHYIPTYL + HG +N+NRSVT
Sbjct  264  RKGSQWFEIQRDLAVYIVSDTKYYTIFKKYCRPVCYPDEHYIPTYLNMFHGSLNSNRSVT  323

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y   NITE FIQSIR+NGT CSYN   T +CYLFARKF PSAL PL 
Sbjct  324  WVDWSIGGPHPATYGGGNITEDFIQSIRNNGTQCSYNSEMTSVCYLFARKFAPSALVPLL  383

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  384  SLTSTVMEF  392



>ref|XP_008452226.1| PREDICTED: uncharacterized protein LOC103493307 isoform X2 [Cucumis 
melo]
Length=389

 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+F TVY YLT S HSF+ESYD+PTRYGRGRY+ +M PDIKL  W
Sbjct  201  SNERFVLLSESCIPVYNFQTVYDYLTNSAHSFVESYDEPTRYGRGRYSRQMLPDIKLQHW  260

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++RALAI IV++TK+Y +FKK+C+P+CYPDEHYIPTYL + HG +N+NR+VT
Sbjct  261  RKGSQWFELSRALAIYIVADTKYYTLFKKFCKPACYPDEHYIPTYLNMFHGSLNSNRTVT  320

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA Y  ANITE FI+SIR+NGT C YN   T +CYLFARKF PS LEPL 
Sbjct  321  WVDWSMGGPHPAMYGPANITESFIESIRNNGTECLYNSEITSVCYLFARKFAPSTLEPLL  380

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  381  NLTSSVMKF  389



>gb|KDP42488.1| hypothetical protein JCGZ_00285 [Jatropha curcas]
Length=392

 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVYKYL  S HSF+ESYD+PTRYGRGRYN  M PDI+L++W
Sbjct  204  SNERFVLLSESCIPIYNFPTVYKYLIGSEHSFVESYDEPTRYGRGRYNRNMFPDIQLYQW  263

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ RALA+ ++++TK+Y++FKKYC+P+CYPDEHYIPTYL + HG +N+NR+VT
Sbjct  264  RKGSQWFEIQRALAVYVLADTKYYSIFKKYCKPACYPDEHYIPTYLNMFHGPLNSNRTVT  323

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y   N+TE FIQSIR+N T CSYN   T +CYLFARKF PSALEPL 
Sbjct  324  WVDWSVGGPHPATYWGINVTESFIQSIRNNETQCSYNSEMTSVCYLFARKFHPSALEPLL  383

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  384  NLTSTVMEF  392



>ref|XP_006417483.1| hypothetical protein EUTSA_v10007760mg [Eutrema salsugineum]
 gb|ESQ35836.1| hypothetical protein EUTSA_v10007760mg [Eutrema salsugineum]
Length=413

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  225  SNERFILLSESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  284

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S+TK+Y++FK++CRP+CYPDEHYIPT+L + HG +NANRSVT
Sbjct  285  RKGSQWFEVNRKIAIYIISDTKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSVNANRSVT  344

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y AANITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  345  WVDWSIGGPHPATYDAANITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFSPSALAPLM  404

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  405  NLSSTVMGF  413



>ref|XP_008452225.1| PREDICTED: uncharacterized protein LOC103493307 isoform X1 [Cucumis 
melo]
Length=394

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+F TVY YLT S HSF+ESYD+PTRYGRGRY+ +M PDIKL  W
Sbjct  206  SNERFVLLSESCIPVYNFQTVYDYLTNSAHSFVESYDEPTRYGRGRYSRQMLPDIKLQHW  265

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++RALAI IV++TK+Y +FKK+C+P+CYPDEHYIPTYL + HG +N+NR+VT
Sbjct  266  RKGSQWFELSRALAIYIVADTKYYTLFKKFCKPACYPDEHYIPTYLNMFHGSLNSNRTVT  325

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA Y  ANITE FI+SIR+NGT C YN   T +CYLFARKF PS LEPL 
Sbjct  326  WVDWSMGGPHPAMYGPANITESFIESIRNNGTECLYNSEITSVCYLFARKFAPSTLEPLL  385

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  386  NLTSSVMKF  394



>gb|KHN39690.1| hypothetical protein glysoja_020768 [Glycine soja]
Length=266

 Score =   295 bits (754),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVY+YLT S+ SF+ESYD+PTRYGRGRY+  M P I+L  W
Sbjct  78   SNERFVLLSESCIPVYNFPTVYRYLTNSSLSFVESYDEPTRYGRGRYSRNMLPHIQLRHW  137

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NRALA+ IVS+T +Y++F+KYC+P+CYPDEHYIPT+L + HG +N+NR+VT
Sbjct  138  RKGSQWFELNRALAVYIVSDTNYYSLFRKYCKPACYPDEHYIPTFLNMFHGSLNSNRTVT  197

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+ GPHPA+Y  ANIT GFIQSIR+NG+ C YN   T ICYLFARKF PSALEPL 
Sbjct  198  WVDWSMLGPHPATYGRANITAGFIQSIRNNGSLCRYNSEITSICYLFARKFDPSALEPLL  257

Query  158  KLSLKVMGF  132
             LS +VM F
Sbjct  258  NLSSEVMNF  266



>ref|NP_172499.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AAD32878.1|AC005489_16 F14N23.16 [Arabidopsis thaliana]
 gb|ABK32109.1| At1g10280 [Arabidopsis thaliana]
 gb|AEE28561.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38956.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=412

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  224  SNERFVLLSESCVPVYNFSTVYTYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  283

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT
Sbjct  284  RKGSQWFEVNRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVT  343

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y AANITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  344  WVDWSIGGPHPATYAAANITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFSPSALAPLM  403

Query  158  KLSLKVMGF  132
             LS  V+GF
Sbjct  404  NLSSTVLGF  412



>ref|XP_002892557.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68816.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  224  SNERFVLLSESCVPVYNFSTVYTYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  283

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT
Sbjct  284  RKGSQWFEVNRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVT  343

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y AANITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  344  WVDWSIGGPHPATYAAANITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFSPSALAPLM  403

Query  158  KLSLKVMGF  132
             LS  V+GF
Sbjct  404  NLSSTVLGF  412



>emb|CDY31036.1| BnaA08g25860D [Brassica napus]
Length=377

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  189  SNERFVLLSESCVPVYNFTTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  248

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S++K+Y++FKK+CRP+CYPDEHYIPT L + HG +NANRSVT
Sbjct  249  RKGSQWFEVNRKIAIYIISDSKYYSLFKKFCRPACYPDEHYIPTLLNMFHGSVNANRSVT  308

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  309  WVDWSIGGPHPATYGADNITEGFLQSIRKNDTDCLYNEEPTSLCFLFARKFAPSALAPLM  368

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  369  NLSSTVMGF  377



>emb|CDX93443.1| BnaA06g06050D [Brassica napus]
Length=384

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  196  SNERFILLSESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  255

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG +NANRSVT
Sbjct  256  RKGSQWFEVNRKLAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSVNANRSVT  315

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  316  WVDWSIGGPHPATYGADNITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFAPSALAPLM  375

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  376  NLSSTVMGF  384



>ref|XP_010490870.1| PREDICTED: uncharacterized protein LOC104768553 isoform X2 [Camelina 
sativa]
 ref|XP_010490885.1| PREDICTED: uncharacterized protein LOC104768578 [Camelina sativa]
Length=415

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  227  SNERFVLLSESCVPVYNFSTVYNYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  286

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT
Sbjct  287  RKGSQWFEVNRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVT  346

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y AANITE F+QSIR N T C YN   T +C+LFARKF PSAL+PL 
Sbjct  347  WVDWSIGGPHPATYAAANITEEFLQSIRKNETDCLYNDEPTSLCFLFARKFSPSALDPLM  406

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  407  NLSSTVMGF  415



>ref|XP_010065247.1| PREDICTED: uncharacterized protein LOC104452469 [Eucalyptus grandis]
 gb|KCW62594.1| hypothetical protein EUGRSUZ_G00083 [Eucalyptus grandis]
Length=391

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVYKYLT S HSF+ESYDDP+RYGRGRY+  M P I+LH+W
Sbjct  203  SNERFVLLSESCIPVYNFPTVYKYLTGSDHSFVESYDDPSRYGRGRYSRSMLPYIRLHQW  262

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM R LA  IVS+TK+Y++F+KYC+P+CYPDEHYIPTYL + HG  N+NRSVT
Sbjct  263  RKGSQWFEMTRNLAAYIVSDTKYYSLFEKYCKPACYPDEHYIPTYLNMFHGSKNSNRSVT  322

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWSLGGPHPA++  +NITE FI++IR+N T C YN GKT +CYLFARKF PSAL PL 
Sbjct  323  WVDWSLGGPHPATFRKSNITEDFIRAIRNNATRCWYNSGKTSLCYLFARKFDPSALVPLL  382

Query  158  KLSLKVMGF  132
             LS  VM F
Sbjct  383  NLSSIVMEF  391



>ref|XP_009144462.1| PREDICTED: uncharacterized protein LOC103868108 isoform X2 [Brassica 
rapa]
Length=404

 Score =   298 bits (764),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  216  SNERFVLLSESCVPVYNFTTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  275

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S++K+Y++FKK+CRP+CYPDEHYIPT L + HG +NANRSVT
Sbjct  276  RKGSQWFEVNRKIAIYIISDSKYYSLFKKFCRPACYPDEHYIPTLLNMFHGSVNANRSVT  335

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  336  WVDWSIGGPHPATYGADNITEGFLQSIRKNDTDCLYNEEPTSLCFLFARKFAPSALAPLM  395

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  396  NLSSTVMGF  404



>ref|XP_009144461.1| PREDICTED: uncharacterized protein LOC103868108 isoform X1 [Brassica 
rapa]
Length=413

 Score =   298 bits (764),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  225  SNERFVLLSESCVPVYNFTTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  284

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S++K+Y++FKK+CRP+CYPDEHYIPT L + HG +NANRSVT
Sbjct  285  RKGSQWFEVNRKIAIYIISDSKYYSLFKKFCRPACYPDEHYIPTLLNMFHGSVNANRSVT  344

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  345  WVDWSIGGPHPATYGADNITEGFLQSIRKNDTDCLYNEEPTSLCFLFARKFAPSALAPLM  404

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  405  NLSSTVMGF  413



>emb|CDY20644.1| BnaC08g14140D [Brassica napus]
Length=390

 Score =   297 bits (761),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  202  SNERFVLLSESCVPVYNFTTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHNW  261

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S++K+Y++FK+YCRP+CYPDEHYIPT L + HG +NANRSVT
Sbjct  262  RKGSQWFEVNRKIAIYIISDSKYYSLFKQYCRPACYPDEHYIPTLLNMFHGSVNANRSVT  321

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  322  WVDWSIGGPHPATYGADNITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFAPSALAPLM  381

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  382  NLSSTVMGF  390



>ref|XP_010273586.1| PREDICTED: uncharacterized protein LOC104609074 [Nelumbo nucifera]
 ref|XP_010273587.1| PREDICTED: uncharacterized protein LOC104609074 [Nelumbo nucifera]
Length=405

 Score =   298 bits (762),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVYDF TVYKYL  S +SF++SYDDP+RYGRGRY+ +M PDIKL +W
Sbjct  217  SNERFVLLSESCIPVYDFLTVYKYLINSAYSFVDSYDDPSRYGRGRYSRKMLPDIKLFQW  276

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV++ K+Y++F+KYC+PSCYPDEHY+PT+L + +G MNANRSVT
Sbjct  277  RKGSQWFELNRTLAVNIVADDKYYSLFRKYCKPSCYPDEHYLPTFLNMFYGSMNANRSVT  336

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++   +ITEGFIQSI++NGT+CSYN  +T +CYLFARKF PSALEPL 
Sbjct  337  WVDWSRGGPHPATFGKEDITEGFIQSIKNNGTTCSYNSEQTLVCYLFARKFAPSALEPLL  396

Query  158  KLSLKVMGF  132
             L+  V+ F
Sbjct  397  NLTSTVLRF  405



>ref|XP_010475888.1| PREDICTED: uncharacterized protein LOC104755237 [Camelina sativa]
Length=407

 Score =   298 bits (762),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  219  SNERFVLLSESCVPVYNFSTVYNYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  278

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT
Sbjct  279  RKGSQWFEVNRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVT  338

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y AANITE F+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  339  WVDWSIGGPHPATYAAANITEEFLQSIRKNETDCLYNDEPTSLCFLFARKFSPSALAPLM  398

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  399  NLSSTVMGF  407



>ref|XP_004503749.1| PREDICTED: uncharacterized protein LOC101509636 isoform X2 [Cicer 
arietinum]
Length=350

 Score =   296 bits (757),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVYKYLT S HSF+ESYDDP+RYGRGRY+  M PDI+L  W
Sbjct  162  SNERFVLLSESCIPVYNFPTVYKYLTNSAHSFVESYDDPSRYGRGRYSRSMLPDIQLKHW  221

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ RALA+ IVS+T++Y++F+KYC+P+CYPDEHYIPT+L + H  +N+NR+VT
Sbjct  222  RKGSQWFELKRALAVYIVSDTRYYSLFRKYCKPACYPDEHYIPTFLNMFHASLNSNRTVT  281

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+ GPHPA+Y   NIT GFIQ+IR+NG+ C YN   T +CYLFARKF P+ALEPL 
Sbjct  282  WVDWSMLGPHPATYGRDNITVGFIQAIRNNGSLCGYNSDTTSLCYLFARKFDPTALEPLL  341

Query  158  KLSLKVMGF  132
             LS +VM F
Sbjct  342  NLSSEVMNF  350



>emb|CAN60261.1| hypothetical protein VITISV_020168 [Vitis vinifera]
Length=430

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FP VYKYL  S +SF+ESYDDP+RYGRGRY+  M PDIKL++W
Sbjct  219  SNERFVLLSESCIPIYNFPIVYKYLINSDYSFVESYDDPSRYGRGRYSRNMLPDIKLYQW  278

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ IV++TK+Y +FKKYC+PSCYPDEHYI T+L + +G +NANRSVT
Sbjct  279  RKGSQWFELSRELAVNIVADTKYYTLFKKYCKPSCYPDEHYIQTFLNMFYGSLNANRSVT  338

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+  AANITEGFIQ++R+NGT C YN  KT +CYLFARKF PSALEPL 
Sbjct  339  WVDWSMGGPHPATLGAANITEGFIQALRNNGTVCPYNSEKTSVCYLFARKFAPSALEPLL  398

Query  158  KLSLKVM  138
             L+ K++
Sbjct  399  NLTSKML  405



>ref|XP_010490863.1| PREDICTED: uncharacterized protein LOC104768553 isoform X1 [Camelina 
sativa]
Length=415

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  227  SNERFVLLSESCVPVYNFSTVYNYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  286

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT
Sbjct  287  RKGSQWFEVNRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVT  346

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y AANITE F+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  347  WVDWSIGGPHPATYAAANITEEFLQSIRKNETDCLYNDEPTSLCFLFARKFSPSALAPLM  406

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  407  NLSSTVMGF  415



>ref|XP_010458365.1| PREDICTED: uncharacterized protein LOC104739637 [Camelina sativa]
Length=419

 Score =   298 bits (762),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  231  SNERFVLLSESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  290

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT
Sbjct  291  RKGSQWFEVNRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVT  350

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y AANITE F+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  351  WVDWSIGGPHPATYAAANITEEFLQSIRKNETDCLYNDEPTSLCFLFARKFSPSALAPLM  410

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  411  NLSSTVMGF  419



>ref|XP_009148352.1| PREDICTED: uncharacterized protein LOC103871798 [Brassica rapa]
Length=414

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  226  SNERFILLSESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  285

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG +NANRSVT
Sbjct  286  RKGSQWFEVNRKLAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSVNANRSVT  345

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  346  WVDWSIGGPHPATYGADNITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFAPSALAPLM  405

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  406  NLSSTVMGF  414



>ref|XP_006303228.1| hypothetical protein CARUB_v10012092mg [Capsella rubella]
 gb|EOA36126.1| hypothetical protein CARUB_v10012092mg [Capsella rubella]
Length=411

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  223  SNERFVLLSESCVPVYNFSTVYTYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  282

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT
Sbjct  283  RKGSQWFEVNRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVT  342

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y AANITEGF+ SIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  343  WVDWSIGGPHPATYAAANITEGFLLSIRKNETDCLYNEEPTSLCFLFARKFSPSALAPLM  402

Query  158  KLSLKVMGF  132
             LS  V+GF
Sbjct  403  NLSSTVLGF  411



>ref|XP_007148589.1| hypothetical protein PHAVU_006G221200g [Phaseolus vulgaris]
 gb|ESW20583.1| hypothetical protein PHAVU_006G221200g [Phaseolus vulgaris]
Length=392

 Score =   296 bits (758),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVY+YLT+S HSF+ESYDDPTRYGRGRY+  M P I+L  W
Sbjct  204  SNERFVLLSESCIPIYNFPTVYRYLTDSAHSFVESYDDPTRYGRGRYSRSMLPHIQLRHW  263

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR+LA+ I+S+TK+Y +F+KYC+P+CYPDEHYIPT+L + HG +N+NR+VT
Sbjct  264  RKGSQWFELNRSLAVYIISDTKYYTLFRKYCKPACYPDEHYIPTFLNMFHGPLNSNRTVT  323

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+ GPHPAS+  ANIT  FIQ+IR+NG+ C YN   T ICYLFARKF PSALEPL 
Sbjct  324  WVDWSMLGPHPASFGRANITAHFIQAIRNNGSLCRYNSEMTSICYLFARKFDPSALEPLL  383

Query  158  KLSLKVMGF  132
             LS +VM F
Sbjct  384  NLSSQVMNF  392



>ref|XP_006598780.1| PREDICTED: uncharacterized protein LOC100796634 isoform X1 [Glycine 
max]
 ref|XP_006598781.1| PREDICTED: uncharacterized protein LOC100796634 isoform X2 [Glycine 
max]
 ref|XP_006598782.1| PREDICTED: uncharacterized protein LOC100796634 isoform X3 [Glycine 
max]
 ref|XP_006598783.1| PREDICTED: uncharacterized protein LOC100796634 isoform X4 [Glycine 
max]
 ref|XP_006598784.1| PREDICTED: uncharacterized protein LOC100796634 isoform X5 [Glycine 
max]
 ref|XP_006598785.1| PREDICTED: uncharacterized protein LOC100796634 isoform X6 [Glycine 
max]
Length=394

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVY+YLT S+ SF+ESYD+PTRYGRGRY+  M P I+L  W
Sbjct  206  SNERFVLLSESCIPVYNFPTVYRYLTNSSLSFVESYDEPTRYGRGRYSRNMLPHIQLRHW  265

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NRALA+ IVS+T +Y++F+KYC+P+CYPDEHYIPT+L + HG +N+NR+VT
Sbjct  266  RKGSQWFELNRALAVYIVSDTNYYSLFRKYCKPACYPDEHYIPTFLNMFHGSLNSNRTVT  325

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+ GPHPA+Y  ANIT GFIQSIR+NG+ C YN   T ICYLFARKF PSALEPL 
Sbjct  326  WVDWSMLGPHPATYGRANITAGFIQSIRNNGSLCRYNSEITSICYLFARKFDPSALEPLL  385

Query  158  KLSLKVMGF  132
             LS +VM F
Sbjct  386  NLSSEVMNF  394



>emb|CDX94911.1| BnaC05g07600D [Brassica napus]
Length=385

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH W
Sbjct  197  SNERFILLSESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHW  256

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI I+S++K+Y +FK +CRP+CYPDEHYIPT+L + HG +NANRSVT
Sbjct  257  RKGSQWFEVNRKLAIYIISDSKYYLLFKLFCRPACYPDEHYIPTFLNMFHGSVNANRSVT  316

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL 
Sbjct  317  WVDWSIGGPHPATYGADNITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFAPSALAPLM  376

Query  158  KLSLKVMGF  132
             LS  VMGF
Sbjct  377  NLSSTVMGF  385



>gb|ABE91847.1| Protein of unknown function DUF266, plant [Medicago truncatula]
 gb|ABE91963.1| Protein of unknown function DUF266, plant [Medicago truncatula]
 gb|KEH36410.1| core-2/I-branching enzyme [Medicago truncatula]
Length=438

 Score =   297 bits (760),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVY+YL +S HSF+ESYDDP+RYGRGRY+  M PDI+L  W
Sbjct  250  SNERFVLLSESCIPVYNFPTVYRYLIDSAHSFVESYDDPSRYGRGRYSRNMLPDIQLKHW  309

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NRALA+ IVS+T+++++F+KYC+P+CYPDEHY+PT+L + HG +N+NR+VT
Sbjct  310  RKGSQWFELNRALAVYIVSDTQYFSLFRKYCKPACYPDEHYLPTFLNMFHGSLNSNRTVT  369

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+ GPHPA+Y   NIT GFIQ+IR+NG+ C YN   T ICYLFARKF PSALEPL 
Sbjct  370  WVDWSMLGPHPATYGRDNITVGFIQAIRNNGSLCPYNSDMTSICYLFARKFDPSALEPLL  429

Query  158  KLSLKVMGF  132
             LS +VM F
Sbjct  430  DLSSEVMNF  438



>ref|XP_004503748.1| PREDICTED: uncharacterized protein LOC101509636 isoform X1 [Cicer 
arietinum]
Length=420

 Score =   296 bits (757),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVYKYLT S HSF+ESYDDP+RYGRGRY+  M PDI+L  W
Sbjct  232  SNERFVLLSESCIPVYNFPTVYKYLTNSAHSFVESYDDPSRYGRGRYSRSMLPDIQLKHW  291

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ RALA+ IVS+T++Y++F+KYC+P+CYPDEHYIPT+L + H  +N+NR+VT
Sbjct  292  RKGSQWFELKRALAVYIVSDTRYYSLFRKYCKPACYPDEHYIPTFLNMFHASLNSNRTVT  351

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+ GPHPA+Y   NIT GFIQ+IR+NG+ C YN   T +CYLFARKF P+ALEPL 
Sbjct  352  WVDWSMLGPHPATYGRDNITVGFIQAIRNNGSLCGYNSDTTSLCYLFARKFDPTALEPLL  411

Query  158  KLSLKVMGF  132
             LS +VM F
Sbjct  412  NLSSEVMNF  420



>gb|KDO42566.1| hypothetical protein CISIN_1g039454mg, partial [Citrus sinensis]
Length=214

 Score =   288 bits (736),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVYKYLT S +SF+ESYDDP+RYGRGRY+  M+PDIK+++W
Sbjct  25   SNERFVLLSESCIPIYNFPTVYKYLTGSPYSFVESYDDPSRYGRGRYSRWMRPDIKIYQW  84

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM R +AI I+S+TK+  +F+KYC+PSCYPDEHYIPTYL + HG + ANRSVT
Sbjct  85   RKGSQWFEMQRKVAIYIISDTKYLTLFRKYCKPSCYPDEHYIPTYLNIFHGSLMANRSVT  144

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIR-SNGTSCSYNRGKTQICYLFARKFFPSALEPL  162
            +VDWS+ GPHPA Y   NITE FIQS+R SNG+ C YN  +T  CYLFARKF P+ LEPL
Sbjct  145  WVDWSMLGPHPAMYKKENITEEFIQSLRNSNGSLCLYNEQRTSRCYLFARKFAPNTLEPL  204

Query  161  EKLSLKVMGF  132
             K+S KVM F
Sbjct  205  LKISSKVMEF  214



>ref|XP_004134258.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101215808 
[Cucumis sativus]
Length=394

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIPVY+F TVY+YL  S HSF+ESYD+PTRYGRGRY+ +M PDIKL  W
Sbjct  206  SNDRFVLLSESCIPVYNFQTVYEYLINSAHSFVESYDEPTRYGRGRYSRQMLPDIKLQHW  265

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++RALA+ IV++ K+Y +FKK+C+P+CYPDEHYIPTYL + HG +N+NR+VT
Sbjct  266  RKGSQWFELSRALAVYIVADIKYYTLFKKFCKPACYPDEHYIPTYLNMFHGSLNSNRTVT  325

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA Y  ANITE FI+SIR+NGT C YN   T +CYLFARKF PS LEPL 
Sbjct  326  WVDWSMGGPHPAMYGPANITESFIESIRNNGTECLYNSEITYVCYLFARKFAPSTLEPLL  385

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  386  NLTSSVMKF  394



>gb|KHN11046.1| hypothetical protein glysoja_044070, partial [Glycine soja]
Length=308

 Score =   290 bits (743),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSE+CIPVYDFPTVY+YLT S+ SF+ESYD+PTRYGRGRY+  M P I L  W
Sbjct  120  SNERFLLLSETCIPVYDFPTVYRYLTHSSLSFVESYDEPTRYGRGRYSRHMLPHIHLRHW  179

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR+LA+ IVS+TK+Y++F+KYC+P+CYPDEHYIPT+L + HG +N+NR+VT
Sbjct  180  RKGSQWFELNRSLAVYIVSDTKYYSLFRKYCKPACYPDEHYIPTFLHMFHGSLNSNRTVT  239

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+ GPHPA++  ANIT  F+QSIR+NG+ C YN   T ICYLFARKF PSALEPL 
Sbjct  240  WVDWSMLGPHPATFGRANITAAFLQSIRNNGSLCPYNSEMTSICYLFARKFDPSALEPLL  299

Query  158  KLSLKVMGF  132
             LS +VM F
Sbjct  300  NLSSEVMNF  308



>ref|XP_004163997.1| PREDICTED: uncharacterized LOC101215808 [Cucumis sativus]
 gb|KGN56275.1| hypothetical protein Csa_3G110720 [Cucumis sativus]
Length=394

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIPVY+F TVY+YL  S HSF+ESYD+PTRYGRGRY+ +M PDIKL  W
Sbjct  206  SNDRFVLLSESCIPVYNFQTVYEYLINSAHSFVESYDEPTRYGRGRYSRQMLPDIKLQHW  265

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++RALA+ IV++ K+Y +FKK+C+P+CYPDEHYIPTYL + HG +N+NR+VT
Sbjct  266  RKGSQWFELSRALAVYIVADIKYYTLFKKFCKPACYPDEHYIPTYLNMFHGSLNSNRTVT  325

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA Y  ANITE FI+SIR+NGT C YN   T +CYLFARKF PS LEPL 
Sbjct  326  WVDWSMGGPHPAMYGPANITESFIESIRNNGTECLYNSEITYVCYLFARKFAPSTLEPLL  385

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  386  NLTSSVMKF  394



>ref|XP_010682059.1| PREDICTED: uncharacterized protein LOC104896962 [Beta vulgaris 
subsp. vulgaris]
Length=421

 Score =   294 bits (752),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+F TVYKYLTESTH+F+ESYDDPTR+GRGRY+  M+P I + +W
Sbjct  233  SNERFVLLSESCIPIYNFQTVYKYLTESTHTFVESYDDPTRFGRGRYDRHMRPSIMIDQW  292

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFE+NRAL I I+S+ K+Y +F+KYC P C+PDEHYIPTYL + H   N+NR++T
Sbjct  293  RKGAQWFEINRALGIEIISDYKYYDLFRKYCHPPCFPDEHYIPTYLNIFHAPFNSNRTLT  352

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
             VDWSLGGPHP ++   NITEGFIQ+IR+N   C YN   T +CYLFARKF PSALEPL 
Sbjct  353  KVDWSLGGPHPTTFVRDNITEGFIQNIRNNKKKCLYNSKSTTVCYLFARKFAPSALEPLL  412

Query  158  KLSLKVMGF  132
             LSLKVMGF
Sbjct  413  DLSLKVMGF  421



>ref|XP_008218660.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
 ref|XP_008218661.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
 ref|XP_008218662.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
Length=393

 Score =   293 bits (749),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIPVY+FPTVYKYL  S HSF+ESYDDP RYGRGRY+ +M P+I+L++W
Sbjct  205  SNQRFVLLSESCIPVYNFPTVYKYLIGSNHSFVESYDDPGRYGRGRYSRKMLPEIELYQW  264

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI IVSETK+Y +F +YC P+CYPDEHY+PTY  + HG +N+NR+VT
Sbjct  265  RKGSQWFELSRTLAIYIVSETKYYTLFSRYCMPACYPDEHYMPTYFNMFHGSLNSNRTVT  324

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWSLGGPHPA+Y   NITE F++SIR+NG  C YN   T ICYLFARKF PSALEPL 
Sbjct  325  WVDWSLGGPHPATYGGDNITEDFVRSIRNNGALCQYNSEMTSICYLFARKFAPSALEPLL  384

Query  158  KLSLKVMGF  132
            +L+  VM F
Sbjct  385  ELASSVMEF  393



>ref|XP_009800326.1| PREDICTED: uncharacterized protein LOC104246253 isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGR--YNTRMKPDIKLH  525
            SNERFVLLS+SCIP+Y FPTVYKYL  S HSF+ESYDDP+ YGRGR  YN  M+PDIKL 
Sbjct  201  SNERFVLLSDSCIPLYSFPTVYKYLIGSIHSFVESYDDPSSYGRGRGRYNHHMQPDIKLS  260

Query  524  EWRKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRS  345
            +WRKGSQWFEMNR LA+ IV +TK+Y +F+KYC P+CYPDEHYIPTY++L +G  NANR+
Sbjct  261  DWRKGSQWFEMNRKLAVRIVLDTKYYNIFRKYCTPTCYPDEHYIPTYIRLFYGPSNANRT  320

Query  344  VTYVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEP  165
            VTYVDWSLG  HPA+++A NITEGFI+S+R+NG +CSYN  K  ICYLFAR F PSAL+P
Sbjct  321  VTYVDWSLGASHPATFSAVNITEGFIESLRNNGAACSYNSEKAHICYLFARMFDPSALKP  380

Query  164  LEKLSLKVMGF  132
            L  LS KV+ F
Sbjct  381  LLNLSSKVLKF  391



>ref|XP_009800325.1| PREDICTED: uncharacterized protein LOC104246253 isoform X1 [Nicotiana 
sylvestris]
Length=392

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGR--YNTRMKPDIKLH  525
            SNERFVLLS+SCIP+Y FPTVYKYL  S HSF+ESYDDP+ YGRGR  YN  M+PDIKL 
Sbjct  202  SNERFVLLSDSCIPLYSFPTVYKYLIGSIHSFVESYDDPSSYGRGRGRYNHHMQPDIKLS  261

Query  524  EWRKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRS  345
            +WRKGSQWFEMNR LA+ IV +TK+Y +F+KYC P+CYPDEHYIPTY++L +G  NANR+
Sbjct  262  DWRKGSQWFEMNRKLAVRIVLDTKYYNIFRKYCTPTCYPDEHYIPTYIRLFYGPSNANRT  321

Query  344  VTYVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEP  165
            VTYVDWSLG  HPA+++A NITEGFI+S+R+NG +CSYN  K  ICYLFAR F PSAL+P
Sbjct  322  VTYVDWSLGASHPATFSAVNITEGFIESLRNNGAACSYNSEKAHICYLFARMFDPSALKP  381

Query  164  LEKLSLKVMGF  132
            L  LS KV+ F
Sbjct  382  LLNLSSKVLKF  392



>ref|XP_003540132.1| PREDICTED: uncharacterized protein LOC100793763 [Glycine max]
Length=383

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSE+CIPVYDFPTVY+YLT S+ SF+ESYD+PTRYGRGRY+  M P I L  W
Sbjct  195  SNERFLLLSETCIPVYDFPTVYRYLTHSSLSFVESYDEPTRYGRGRYSRHMLPHIHLRHW  254

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR+LA+ IVS+TK+Y++F+KYC+P+CYPDEHYIPT+L + HG +N+NR+VT
Sbjct  255  RKGSQWFELNRSLAVYIVSDTKYYSLFRKYCKPACYPDEHYIPTFLHMFHGSLNSNRTVT  314

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+ GPHPA++  ANIT  F+QSIR+NG+ C YN   T ICYLFARKF PSALEPL 
Sbjct  315  WVDWSMLGPHPATFGRANITAAFLQSIRNNGSLCPYNSEMTSICYLFARKFDPSALEPLL  374

Query  158  KLSLKVMGF  132
             LS +VM F
Sbjct  375  NLSSEVMNF  383



>ref|XP_007221893.1| hypothetical protein PRUPE_ppa016090mg [Prunus persica]
 gb|EMJ23092.1| hypothetical protein PRUPE_ppa016090mg [Prunus persica]
Length=393

 Score =   290 bits (743),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIPVY+FPTVYKYL  S HSF+ESYDDP RYGRGRY+ +M P+I+L++W
Sbjct  205  SNQRFVLLSESCIPVYNFPTVYKYLIGSNHSFVESYDDPGRYGRGRYSRKMLPEIELYQW  264

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI IVSETK+Y +F +YC P+CYPDEHY+PTY  + HG +N+NR+VT
Sbjct  265  RKGSQWFELSRTLAIYIVSETKYYTLFSRYCLPACYPDEHYMPTYFNMFHGSLNSNRTVT  324

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWSLGGPHPA+Y   NITE F++SIR++G  C YN   T ICYLFARKF PSALEPL 
Sbjct  325  WVDWSLGGPHPATYGGDNITEDFVRSIRNSGALCQYNSEMTSICYLFARKFAPSALEPLL  384

Query  158  KLSLKVMGF  132
            +L+  VM F
Sbjct  385  ELASSVMEF  393



>ref|XP_009601484.1| PREDICTED: uncharacterized protein LOC104096770 [Nicotiana tomentosiformis]
Length=402

 Score =   291 bits (744),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 166/189 (88%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVYKYL  S HSF+ESYDDP+RYGRGRYN RMKPDIKL +W
Sbjct  214  SNERFVLLSESCIPVYNFPTVYKYLIGSIHSFVESYDDPSRYGRGRYNRRMKPDIKLSDW  273

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEMNR LA+ +VS+TK+Y MF++ C P+CYPDEHYIPT+++L +G +NANR+VT
Sbjct  274  RKGSQWFEMNRTLAVRVVSDTKYYDMFRRLCTPACYPDEHYIPTFIRLFYGPLNANRTVT  333

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            YVDWS+GGPHPA++ A NITEGF+QSIR+NGT+CSYN  K+ ICYLFARKF PSALEPL 
Sbjct  334  YVDWSVGGPHPATFGAVNITEGFLQSIRNNGTACSYNSEKSHICYLFARKFEPSALEPLL  393

Query  158  KLSLKVMGF  132
             LS  V+ F
Sbjct  394  NLSSSVLEF  402



>ref|XP_006431491.1| hypothetical protein CICLE_v10001419mg [Citrus clementina]
 gb|ESR44731.1| hypothetical protein CICLE_v10001419mg [Citrus clementina]
Length=393

 Score =   288 bits (738),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVYKYLT S +SF+ESYDDP+RYGRGRY+  M+PDIK+++W
Sbjct  204  SNERFVLLSESCIPIYNFPTVYKYLTGSPYSFVESYDDPSRYGRGRYSRWMRPDIKIYQW  263

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM R +AI I+S+TK+ ++F+KYC+PSCYPDEHYIPTYL + HG + ANRSVT
Sbjct  264  RKGSQWFEMQRKVAIYIISDTKYLSLFRKYCKPSCYPDEHYIPTYLNIFHGSLMANRSVT  323

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIR-SNGTSCSYNRGKTQICYLFARKFFPSALEPL  162
            +VDWS+ GPHPA Y   NITE FIQS+R SNG+ C YN  +T  CYLFARKF P+ LEPL
Sbjct  324  WVDWSMLGPHPAMYKKENITEEFIQSLRNSNGSLCLYNEQRTSRCYLFARKFAPNTLEPL  383

Query  161  EKLSLKVMGF  132
             K+S KVM F
Sbjct  384  LKISSKVMEF  393



>gb|ACU18530.1| unknown [Glycine max]
Length=383

 Score =   288 bits (737),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSE+CIPVYDFPTVY+YLT S+ SF+ESYD+PTRYGRGRY+  M P I L  W
Sbjct  195  SNERFLLLSETCIPVYDFPTVYRYLTHSSLSFVESYDEPTRYGRGRYSRHMLPHIHLRHW  254

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR+LA+ IVS+TK+Y++F+KYC+P+CYPDEHYIPT+L + HG +N+NR+ T
Sbjct  255  RKGSQWFELNRSLAVYIVSDTKYYSLFRKYCKPACYPDEHYIPTFLHMFHGSLNSNRTDT  314

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+ GPHPA++  ANIT  F+QSIR+NG+ C YN   T ICYLFARKF PSALEPL 
Sbjct  315  WVDWSMLGPHPATFGRANITAAFLQSIRNNGSLCPYNSEMTSICYLFARKFDPSALEPLL  374

Query  158  KLSLKVMGF  132
             LS +VM F
Sbjct  375  NLSSEVMNF  383



>ref|XP_009791972.1| PREDICTED: uncharacterized protein LOC104239130 [Nicotiana sylvestris]
Length=403

 Score =   288 bits (738),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVYKYL  S HSF+ESYDDP+RYGRGRYN RMKPDIKL +W
Sbjct  215  SNERFVLLSESCIPVYNFPTVYKYLIGSIHSFVESYDDPSRYGRGRYNRRMKPDIKLSDW  274

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEMNR LA+ +VS+TK+Y +F++ C P+CYPDEHYIPT+++L +G +NANR+VT
Sbjct  275  RKGSQWFEMNRTLAVRVVSDTKYYDIFRRLCTPACYPDEHYIPTFIRLFYGPLNANRTVT  334

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            YVDWSLGGPHPA+++A NITEGF++SIR+NGT+CSYN  KT +C+LFARKF PSALEPL 
Sbjct  335  YVDWSLGGPHPATFSAVNITEGFLKSIRNNGTACSYNYEKTHVCHLFARKFEPSALEPLL  394

Query  158  KLSLKVMGF  132
             LS  V+ F
Sbjct  395  NLSSNVLEF  403



>ref|XP_010553652.1| PREDICTED: uncharacterized protein LOC104823674 [Tarenaya hassleriana]
Length=402

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESCIP+++FPTVY+YL  S +SF+ESYD+PTRYGRGRY+ +M P IKLH+W
Sbjct  215  SNERFLLLSESCIPIHNFPTVYRYLIGSNYSFVESYDEPTRYGRGRYSRKMLPHIKLHQW  274

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE NR +A  I+S+TK+Y++FKKYCRP+CYPDEHYIPT+L + HG  NANR+VT
Sbjct  275  RKGSQWFEANRKIATYIISDTKYYSLFKKYCRPACYPDEHYIPTFLNMFHGSDNANRTVT  334

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA Y A NITE FIQ IRSNG SC YN   T +CYLFARKF P+AL PL 
Sbjct  335  WVDWSFGGPHPARYNAENITESFIQQIRSNG-SCLYNGEVTSLCYLFARKFAPNALAPLM  393

Query  158  KLSLKVMGF  132
             LS  VM F
Sbjct  394  NLSSTVMEF  402



>ref|XP_011028389.1| PREDICTED: uncharacterized protein LOC105128426 [Populus euphratica]
Length=392

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y F  VYKYL  S HSF+ESYD PTRY RGRYN +M PDI L++W
Sbjct  204  SNERFVLLSESCIPIYKFSIVYKYLIRSKHSFVESYDAPTRYARGRYNQKMLPDIHLYQW  263

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ R LA+ +VS+TK++ +FKKYCRP+CYPDEHYIPTYL + HG +NANR+VT
Sbjct  264  RKGSQWFEIQRELAVYLVSDTKYHTIFKKYCRPACYPDEHYIPTYLNMFHGSLNANRTVT  323

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+  PHP +Y   +ITEGFIQSIR+ G  CSYN   T +CYLFARKF PSAL PL 
Sbjct  324  WVDWSIVAPHPPTYDGIDITEGFIQSIRNKGNHCSYNSEMTSVCYLFARKFAPSALVPLL  383

Query  158  KLSLKVMGF  132
             L+  VMGF
Sbjct  384  NLTSTVMGF  392



>ref|XP_006385074.1| hypothetical protein POPTR_0004s23660g [Populus trichocarpa]
 gb|ERP62871.1| hypothetical protein POPTR_0004s23660g [Populus trichocarpa]
Length=392

 Score =   286 bits (732),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y F  VYKYL  S HSF+ESYD PTRY RGRYN +M PDI L++W
Sbjct  204  SNERFVLLSESCIPIYKFSIVYKYLIRSKHSFVESYDAPTRYARGRYNQKMLPDIHLYQW  263

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ R LA+ +VS+TK++ +FKKYCRP+CYPDEHYIPTYL + HG +NANR+VT
Sbjct  264  RKGSQWFEIQRDLAVYLVSDTKYHTIFKKYCRPACYPDEHYIPTYLNMFHGSLNANRTVT  323

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+  PHP +Y   ++TEGFIQSIR+ G  CSYN   T +CYLFARKF PSAL PL 
Sbjct  324  WVDWSIVAPHPPTYDGIDVTEGFIQSIRNKGNQCSYNSEMTSVCYLFARKFAPSALVPLL  383

Query  158  KLSLKVMGF  132
             L+  VMGF
Sbjct  384  NLTSTVMGF  392



>ref|XP_009399147.1| PREDICTED: uncharacterized protein LOC103983624 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY FPTVY+YL  S HSF++SYD   +  RGRYN RM P IKL +W
Sbjct  199  SNERFVLLSESCIPVYSFPTVYEYLVNSAHSFVDSYDKDIQQARGRYNWRMSPKIKLSQW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LAI IV+E  +Y++F+KYC+PSCYPDEHYIPTYL + HG +NANRSVT
Sbjct  259  RKGSEWFELNRGLAIDIVAEHTYYSLFRKYCKPSCYPDEHYIPTYLNMFHGSLNANRSVT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA Y AANIT  FIQSIR+NGTSC YN   T +C+LFARKF PSAL PL 
Sbjct  319  WVDWSRGGSHPARYGAANITVEFIQSIRNNGTSCMYNSRSTSVCFLFARKFAPSALAPLL  378

Query  158  KLSLKVMGF  132
             +S  VMGF
Sbjct  379  NVSSTVMGF  387



>ref|XP_009414639.1| PREDICTED: uncharacterized protein LOC103995706 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414640.1| PREDICTED: uncharacterized protein LOC103995706 [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   285 bits (730),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESCIPVY+FPTVY+YL  S HSF+ESYD+ ++ GRGRY+  M P IKLH+W
Sbjct  198  SNERFILLSESCIPVYNFPTVYEYLINSAHSFVESYDENSQQGRGRYSRHMFPTIKLHQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ +V++ K+Y++F KYC+PSCYPDEHYIPT+L + HG +NANR++T
Sbjct  258  RKGSEWFELNRELAVNVVADYKYYSIFSKYCKPSCYPDEHYIPTFLNMFHGSLNANRTIT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA+Y A NIT  FIQSIR+NGTSC YN   T +C+LFARKF PS+L+PL 
Sbjct  318  WVDWSRGGPHPATYGAPNITPDFIQSIRNNGTSCMYNSRPTSVCFLFARKFAPSSLDPLL  377

Query  158  KLSLKVMGF  132
             L+  VMGF
Sbjct  378  NLTSTVMGF  386



>ref|XP_008357658.1| PREDICTED: uncharacterized protein LOC103421405 [Malus domestica]
 ref|XP_008357660.1| PREDICTED: uncharacterized protein LOC103421405 [Malus domestica]
 ref|XP_008357661.1| PREDICTED: uncharacterized protein LOC103421405 [Malus domestica]
 ref|XP_008357662.1| PREDICTED: uncharacterized protein LOC103421406 [Malus domestica]
 ref|XP_008357663.1| PREDICTED: uncharacterized protein LOC103421406 [Malus domestica]
 ref|XP_008357664.1| PREDICTED: uncharacterized protein LOC103421406 [Malus domestica]
Length=390

 Score =   285 bits (729),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVYKYL  S HS++ESYD+P RYGRGRY+  M PDI+L++W
Sbjct  202  SNERFVLLSESCIPIYNFPTVYKYLIGSNHSYVESYDNPGRYGRGRYSREMFPDIQLYQW  261

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++RAL++  VSETK+Y +F KYC P+CYPDEHY+PTY  + HG++N+NR+VT
Sbjct  262  RKGSQWFELSRALSVYJVSETKYYTIFSKYCLPACYPDEHYLPTYFNMFHGWLNSNRTVT  321

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWSLGGPHPA+Y   NITE F++SIR+NG  C YN   T ICYLFARKF P+AL PL 
Sbjct  322  WVDWSLGGPHPATYGGDNITEDFVRSIRNNGALCQYNAEMTSICYLFARKFAPTALGPLL  381

Query  158  KLSLKVMGF  132
            + +  VM +
Sbjct  382  EFAASVMEY  390



>ref|XP_009355369.1| PREDICTED: uncharacterized protein LOC103946396 [Pyrus x bretschneideri]
 ref|XP_009355370.1| PREDICTED: uncharacterized protein LOC103946396 [Pyrus x bretschneideri]
Length=390

 Score =   285 bits (728),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVYKYL  S HS++ESYD+P RYGRGRY+  M PDI+L++W
Sbjct  202  SNERFVLLSESCIPIYNFPTVYKYLIGSNHSYVESYDNPGRYGRGRYSREMFPDIQLYQW  261

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++RAL++ IVSET++Y +F KYC P+CYPDEHY+PTY  + HG++N+NR+VT
Sbjct  262  RKGSQWFELSRALSVYIVSETRYYTIFSKYCLPACYPDEHYLPTYFNMFHGWLNSNRTVT  321

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWSLGGPHPA+Y   NITE F++SIR+NG  C YN   T ICYLFARKF P+AL PL 
Sbjct  322  WVDWSLGGPHPATYGGDNITEDFVRSIRNNGALCQYNAEMTSICYLFARKFAPTALGPLL  381

Query  158  KLSLKVMGF  132
            + +  VM +
Sbjct  382  EFAASVMEY  390



>ref|XP_010682058.1| PREDICTED: uncharacterized protein LOC104896961 [Beta vulgaris 
subsp. vulgaris]
Length=425

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVL+SESCIPVY+F TVYKY+TES HSF+ESYDDP+RYGRGRY+ RM PDIKL +W
Sbjct  237  SNERFVLISESCIPVYNFQTVYKYITESVHSFVESYDDPSRYGRGRYSRRMGPDIKLRQW  296

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ R+LAI I+S+ K+Y +F+KYC PSCYPDEHYIPTYLQ+ H  +N+NR+VT
Sbjct  297  RKGSQWFEITRSLAIEIISDYKYYDLFRKYCHPSCYPDEHYIPTYLQIFHPLLNSNRTVT  356

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWSLGGPHPAS+   NITEGFIQ+IR+NGT C YN  +T ICYLFARKF PSALEPL 
Sbjct  357  WVDWSLGGPHPASFGRENITEGFIQNIRNNGTECWYNFQRTPICYLFARKFDPSALEPLL  416

Query  158  KLSLKVMGF  132
             +S KVMGF
Sbjct  417  NISSKVMGF  425



>ref|XP_006470991.1| PREDICTED: uncharacterized protein LOC102625510 isoform X2 [Citrus 
sinensis]
Length=392

 Score =   283 bits (723),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 156/187 (83%), Gaps = 1/187 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVYKYLT S +SF+ESYDDP+RYGRGRY+  M+PDIK+++W
Sbjct  204  SNERFVLLSESCIPIYNFPTVYKYLTGSPYSFVESYDDPSRYGRGRYSRWMRPDIKIYQW  263

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM R +AI I+S+TK+  +F+KYC+PSCYPDEHYIPTYL + HG + ANRSVT
Sbjct  264  RKGSQWFEMQRKVAIYIISDTKYLTLFRKYCKPSCYPDEHYIPTYLNIFHGSLMANRSVT  323

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIR-SNGTSCSYNRGKTQICYLFARKFFPSALEPL  162
            +VDWS+ GPHP  Y   NITE FIQS+R SNG+ C YN  +T  CYLFARKF P+ LEPL
Sbjct  324  WVDWSMLGPHPVMYKKENITEQFIQSLRNSNGSLCLYNEQRTSRCYLFARKFAPNTLEPL  383

Query  161  EKLSLKV  141
             K+S KV
Sbjct  384  LKISSKV  390



>ref|XP_009410706.1| PREDICTED: uncharacterized protein LOC103992641 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   283 bits (723),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVY+YL  S HSF+ESYD+ TR GRGRY+ RM P I L++W
Sbjct  203  SNERFVLLSESCIPVYNFPTVYEYLINSAHSFVESYDENTRQGRGRYSWRMAPKIMLYQW  262

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA  IV+E K+Y +F+KYC+PSCYPDEHYIPTYL + HG +NANRS+T
Sbjct  263  RKGSEWFELNRELATNIVAEHKYYPLFRKYCKPSCYPDEHYIPTYLNMFHGALNANRSLT  322

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA Y A NIT  FIQSIR+NGT C YN   T IC+LFARKF PSAL PL 
Sbjct  323  WVDWSRGGSHPARYGAPNITVEFIQSIRNNGTFCLYNSVPTSICFLFARKFAPSALAPLL  382

Query  158  KLSLKVMGF  132
             L+  VMGF
Sbjct  383  NLTSTVMGF  391



>ref|XP_010927836.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
 ref|XP_010927837.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
 ref|XP_010927838.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
Length=388

 Score =   282 bits (721),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVY+YL  S HSF+ESYD+ +  GRGRYN  M P IKL++W
Sbjct  200  SNERFVLLSESCIPVYNFPTVYEYLINSEHSFVESYDEDSPQGRGRYNRYMAPHIKLYQW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ +V++ K+YA+F+KYC+PSCYPDEHYIPTYL + HG +NANRS+T
Sbjct  260  RKGSEWFELNRELAVTMVADYKYYALFRKYCKPSCYPDEHYIPTYLNMFHGSLNANRSLT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA+Y A +IT GFIQ+IR+NGT C YN   T IC+LFARKF P+ALE L 
Sbjct  320  WVDWSRGGPHPATYGAPSITAGFIQAIRNNGTFCMYNSRPTSICFLFARKFAPNALESLL  379

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  380  NLTSTVMDF  388



>ref|XP_006836850.1| hypothetical protein AMTR_s00099p00078200 [Amborella trichopoda]
 gb|ERM99703.1| hypothetical protein AMTR_s00099p00078200 [Amborella trichopoda]
Length=401

 Score =   282 bits (722),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 156/189 (83%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVY YL  S  SF++SYDDP+RYGRGRY+  M PDIKLH+W
Sbjct  213  SNERFVLLSESCIPMYNFPTVYNYLITSKESFVDSYDDPSRYGRGRYSRNMAPDIKLHQW  272

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE +R +A+ IVS++K+Y +FKKYC+PSCYPDEHYIPTYL + +G +N+NRSVT
Sbjct  273  RKGSQWFEAHRDVAVNIVSDSKYYTIFKKYCKPSCYPDEHYIPTYLNMFYGSLNSNRSVT  332

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++   +ITE FI +IR+NGT+C +N   T +CYLFARKF PSAL PL 
Sbjct  333  WVDWSRGGPHPATFGGPDITEDFIFAIRNNGTTCFHNSEPTSLCYLFARKFAPSALGPLL  392

Query  158  KLSLKVMGF  132
             LS  VM F
Sbjct  393  NLSSTVMEF  401



>gb|EPS73540.1| hypothetical protein M569_01216 [Genlisea aurea]
Length=466

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVL+SESCIP+YDF TVY+YL  S  SFI+SYDDP+R GRGRY++ MKP ++L EW
Sbjct  277  SNERFVLVSESCIPIYDFKTVYRYLVGSKQSFIQSYDDPSRQGRGRYSSWMKPYVRLSEW  336

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFEM+R LA+ IVSETK+Y++F++YC+PSCYPDEHYIPTY+   +G +NANRSVT
Sbjct  337  RKGSEWFEMHRDLAVRIVSETKYYSVFRRYCKPSCYPDEHYIPTYVAKFYGILNANRSVT  396

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGT-SCSYNRGKTQICYLFARKFFPSALEPL  162
            YVDWSL GPHPA++TAAN+T GFI+S+RSN T  CSYN G T +C+LFARKF   AL+PL
Sbjct  397  YVDWSLMGPHPATFTAANVTRGFIESLRSNATRRCSYNAGTTPVCFLFARKFDSGALQPL  456

Query  161  EKLSLKVMGF  132
              ++   MGF
Sbjct  457  LDVASGTMGF  466



>ref|XP_006470990.1| PREDICTED: uncharacterized protein LOC102625510 isoform X1 [Citrus 
sinensis]
Length=404

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FPTVYKYLT S +SF+ESYDDP+RYGRGRY+  M+PDIK+++W
Sbjct  204  SNERFVLLSESCIPIYNFPTVYKYLTGSPYSFVESYDDPSRYGRGRYSRWMRPDIKIYQW  263

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM R +AI I+S+TK+  +F+KYC+PSCYPDEHYIPTYL + HG + ANRSVT
Sbjct  264  RKGSQWFEMQRKVAIYIISDTKYLTLFRKYCKPSCYPDEHYIPTYLNIFHGSLMANRSVT  323

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIR-SNGTSCSYNRGKTQICYLFARKFFPSALEPL  162
            +VDWS+ GPHP  Y   NITE FIQS+R SNG+ C YN  +T  CYLFARKF P+ LEPL
Sbjct  324  WVDWSMLGPHPVMYKKENITEQFIQSLRNSNGSLCLYNEQRTSRCYLFARKFAPNTLEPL  383

Query  161  EKLSLK  144
             K+S K
Sbjct  384  LKISSK  389



>ref|XP_008812747.1| PREDICTED: uncharacterized protein LOC103723571 [Phoenix dactylifera]
 ref|XP_008812748.1| PREDICTED: uncharacterized protein LOC103723571 [Phoenix dactylifera]
Length=388

 Score =   280 bits (715),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FPTVY+YL  S HSF+ESYD+ +  GRGRY+  M P IKL++W
Sbjct  200  SNERFVLLSESCIPVYNFPTVYEYLINSEHSFVESYDEDSPQGRGRYSRYMAPHIKLYQW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ +V++ K+Y +F+KYCRPSCYPDEHYIPTYL + HG +NANRSVT
Sbjct  260  RKGSEWFELNRELAVTVVADYKYYTLFRKYCRPSCYPDEHYIPTYLNMFHGSLNANRSVT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA Y A  IT  FIQ+IR+NGT C YN   T IC+LFARKF P+ALE L 
Sbjct  320  WVDWSRGGPHPARYGAPTITAEFIQAIRNNGTFCMYNSRPTSICFLFARKFAPNALESLL  379

Query  158  KLSLKVMGF  132
             L+  VMGF
Sbjct  380  NLTSSVMGF  388



>ref|XP_010907977.1| PREDICTED: uncharacterized protein LOC105034483 [Elaeis guineensis]
Length=388

 Score =   279 bits (714),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+FP VY+YL  S HSF+ESYD+ +  GRGRY   M P IKL++W
Sbjct  200  SNERFVLLSESCIPIYNFPAVYEYLINSHHSFVESYDEDSLQGRGRYRRGMSPHIKLYQW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ IV++ K+YA+F+K+C+PSCYPDEHYIPTYL + HG +NANRS+T
Sbjct  260  RKGSEWFELNRELAVTIVADYKYYAIFRKHCKPSCYPDEHYIPTYLNMFHGSLNANRSLT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA Y A+N+T  FIQ++R+NGT C YN   T IC+LFARKF P+ALEPL 
Sbjct  320  WVDWSRGGPHPARYGASNVTPEFIQALRNNGTFCMYNSRPTSICFLFARKFAPNALEPLL  379

Query  158  KLSLKVMGF  132
             L+  VMGF
Sbjct  380  NLTSTVMGF  388



>ref|XP_008775897.1| PREDICTED: uncharacterized protein LOC103696141 [Phoenix dactylifera]
Length=391

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FP VY+YL  S HSF+ESYDD +  GRGRY+  M P IKL++W
Sbjct  204  SNERFVLLSESCIPVHNFPAVYEYLINSEHSFVESYDDDSSQGRGRYSRYMAPHIKLYQW  263

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ IV++ ++YA+F+KYC+PSCYPDEHYIPTYL + HG +NANRS+T
Sbjct  264  RKGSEWFELNRDLAVTIVADYRYYAIFRKYCKPSCYPDEHYIPTYLNMFHGSLNANRSLT  323

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA Y A NIT  FIQ+IR+NGT C YN   T +C+LFARKF P+ALEPL 
Sbjct  324  WVDWSRGGPHPARYGAPNITAEFIQAIRNNGTFCMYNSRPTSVCFLFARKFAPNALEPLL  383

Query  158  KLSLKVMGF  132
             L+  VMGF
Sbjct  384  NLT-SVMGF  391



>ref|XP_006659748.1| PREDICTED: uncharacterized protein LOC102714034 [Oryza brachyantha]
Length=372

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVY+YL  S HSF+ESY+  T    GRYN RM P I   +W
Sbjct  184  SNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHILPSQW  243

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ IV++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR+VT
Sbjct  244  RKGSEWFELNRELAVQIVADNKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTVT  303

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA Y AANITE FIQ+IR+NGTSC+YN   T +CYLFARKF PSAL PL 
Sbjct  304  WVDWSRGGPHPARYGAANITEEFIQAIRNNGTSCTYNSKPTSLCYLFARKFAPSALGPLM  363

Query  158  KLSLKVMGF  132
             L+  V+ F
Sbjct  364  NLTSTVLDF  372



>ref|XP_004301567.1| PREDICTED: uncharacterized protein LOC101308879 [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESCIPVY+FPTVYKYLT S +SF+ESYDD  R+GRGRY+ RM PDI+L++W
Sbjct  219  SNERFILLSESCIPVYNFPTVYKYLTGSKYSFVESYDDAGRFGRGRYSRRMLPDIQLYQW  278

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA IIV++ ++Y +F KYC P+CYPDEHY+ TY  + HG +N+NR+VT
Sbjct  279  RKGSQWFELSRTLAAIIVADVRYYTVFSKYCLPACYPDEHYMATYFNMFHGSLNSNRTVT  338

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS+GGPHPA Y   N+TE F++SIR+NG  C YN   T IC LFARKF P+ALEPL 
Sbjct  339  WVDWSVGGPHPAMYGGENVTEDFVRSIRNNGALCQYNSEMTSICNLFARKFAPTALEPLL  398

Query  158  KLSLKVMGF  132
            +L+  VM F
Sbjct  399  ELASSVMEF  407



>gb|EYU33292.1| hypothetical protein MIMGU_mgv1a007588mg [Erythranthe guttata]
Length=402

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSE CIP+Y+F TV+KYLTES HSFI+SYDDP+RYGRGRYN RM+PDI+L EW
Sbjct  214  SNERFVLLSERCIPIYNFATVHKYLTESLHSFIDSYDDPSRYGRGRYNRRMQPDIRLAEW  273

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE +R LA+ IV++ K+Y++F+KYCRPSCYPDEHYIPTY++  +G +N+NRS+T
Sbjct  274  RKGSQWFEAHRTLAVKIVADFKYYSIFRKYCRPSCYPDEHYIPTYVRKFYGALNSNRSLT  333

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            YVDWS+ GPHPA++TA NIT  F+Q +R+NGT CSYN  KT ICYLFARKF  SALEPL 
Sbjct  334  YVDWSMMGPHPATFTAVNITTQFLQLLRNNGTMCSYNSEKTNICYLFARKFDESALEPLL  393

Query  158  KLSLKVMGF  132
             +S +VMGF
Sbjct  394  SISSQVMGF  402



>emb|CDO97644.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+FP VY YLT S HSF++SYDDP+RYGRGRY+ RM+PDI+L +W
Sbjct  211  SNERFVLLSESCIPVYNFPAVYGYLTGSMHSFVQSYDDPSRYGRGRYSRRMQPDIRLADW  270

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA I+V+ETK+Y++FKK+CRPSCYPDEHY+PT+L   +G  NANR+VT
Sbjct  271  RKGSQWFELNRYLAAIVVAETKYYSIFKKHCRPSCYPDEHYLPTFLHKFYGATNANRTVT  330

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYN-RGKTQICYLFARKFFPSALEPL  162
            YVDWS+  PHP ++TA N+TEGFI+SIR+NGT+CSYN +  T +CYLFARKF P ALEPL
Sbjct  331  YVDWSVIAPHPGTFTAVNVTEGFIRSIRNNGTACSYNLKSTTTVCYLFARKFTPDALEPL  390

Query  161  EKLSLKVMGF  132
              LS +VM +
Sbjct  391  LNLSSEVMRY  400



>ref|XP_010099779.1| hypothetical protein L484_010966 [Morus notabilis]
 gb|EXB80397.1| hypothetical protein L484_010966 [Morus notabilis]
Length=395

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY+F T+Y YL  ST SF+++YD+PTRYGRGRY+ RM PDIKL++W
Sbjct  207  SNERFVLLSESCIPVYNFSTIYNYLIGSTQSFVQAYDEPTRYGRGRYSRRMLPDIKLYQW  266

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NRALA+ IVS+TK+Y +FKKYC P+CYPDEHY+PTY+ + HG +N+NR+VT
Sbjct  267  RKGSQWFELNRALAVYIVSDTKYYTLFKKYCLPACYPDEHYLPTYINMFHGPLNSNRTVT  326

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +V+WS+GGPHP +Y  AN+T  FIQ+IR+NGT C YN   T ICYLFARKF PSALEPL 
Sbjct  327  WVNWSIGGPHPVTYGEANVTVDFIQAIRNNGTPCQYNTQTTSICYLFARKFAPSALEPLL  386

Query  158  KLSLKVMGF  132
             LS  VM F
Sbjct  387  NLSSSVMKF  395



>gb|EAZ41277.1| hypothetical protein OsJ_25784 [Oryza sativa Japonica Group]
Length=295

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVY+YL  S HSF+ESY+  T    GRYN RM P I   +W
Sbjct  107  SNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHILPSQW  166

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ I+++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T
Sbjct  167  RKGSEWFELNRELALRIIADNKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTIT  226

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA Y A+NI+E FIQ+IR+NGT C+YN   T +CYLFARKF PSAL PL 
Sbjct  227  WVDWSRGGPHPARYGASNISEEFIQAIRNNGTRCTYNSKPTSVCYLFARKFAPSALGPLM  286

Query  158  KLSLKVMGF  132
             L+  ++ F
Sbjct  287  NLTSTILDF  295



>ref|XP_009411881.1| PREDICTED: uncharacterized protein LOC103993515 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESC+PVY+FP+VY+YL  S HSF+ESYD+ +  GRGRY+  M P+I+ ++W
Sbjct  199  SNERFVLLSESCVPVYNFPSVYEYLINSAHSFVESYDEDSPQGRGRYSQNMAPEIQEYQW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
             KGS+WFE+NR LA+ IV++ K+Y++F+KYC+PSCYPDEHYIPTYL + HG +NANRSVT
Sbjct  259  MKGSEWFELNRELAVNIVADYKYYSIFRKYCKPSCYPDEHYIPTYLNMFHGALNANRSVT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA Y   NIT GFIQ+IR+N T C YN   T IC+LFARKF PSAL PL 
Sbjct  319  WVDWSRGGPHPARYGDPNITVGFIQAIRNNATFCMYNSRPTPICFLFARKFAPSALVPLL  378

Query  158  KLSLKVMGF  132
             ++  VMGF
Sbjct  379  DMASTVMGF  387



>gb|EAZ05353.1| hypothetical protein OsI_27557 [Oryza sativa Indica Group]
Length=407

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVY+YL  S HSF+ESY+  T    GRYN RM P I   +W
Sbjct  219  SNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHILPSQW  278

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ I+++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T
Sbjct  279  RKGSEWFELNRELALRIIADNKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTIT  338

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA Y A+NI+E FIQ+IR+NGT C+YN   T +CYLFARKF PSAL PL 
Sbjct  339  WVDWSRGGPHPARYGASNISEEFIQAIRNNGTRCTYNSKPTSVCYLFARKFAPSALGPLM  398

Query  158  KLSLKVMGF  132
             L+  ++ F
Sbjct  399  NLTSTILDF  407



>ref|NP_001060819.1| Os08g0110400 [Oryza sativa Japonica Group]
 dbj|BAD09537.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22733.1| Os08g0110400 [Oryza sativa Japonica Group]
 dbj|BAG94403.1| unnamed protein product [Oryza sativa Japonica Group]
Length=407

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVY+YL  S HSF+ESY+  T    GRYN RM P I   +W
Sbjct  219  SNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHILPSQW  278

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ I+++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T
Sbjct  279  RKGSEWFELNRELALRIIADNKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTIT  338

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA Y A+NI+E FIQ+IR+NGT C+YN   T +CYLFARKF PSAL PL 
Sbjct  339  WVDWSRGGPHPARYGASNISEEFIQAIRNNGTRCTYNSKPTSVCYLFARKFAPSALGPLM  398

Query  158  KLSLKVMGF  132
             L+  ++ F
Sbjct  399  NLTSTILDF  407



>gb|EMS61782.1| hypothetical protein TRIUR3_23279 [Triticum urartu]
 gb|EMT25870.1| hypothetical protein F775_27169 [Aegilops tauschii]
Length=295

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVY+YL  S HSF+ESY+  T    GRYN RM P I   +W
Sbjct  107  SNERFVLLSESCIPVFNFPTVYEYLINSEHSFVESYNIDTPQSAGRYNRRMAPHILPEQW  166

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ +V++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T
Sbjct  167  RKGSEWFELNRELAVRVVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTIT  226

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA Y A NI   FI++IR+NGT C YN   T +CYLFARKF PSAL PL 
Sbjct  227  WVDWSRGGPHPARYGAGNINVDFIKAIRNNGTQCLYNSKHTSVCYLFARKFAPSALGPLM  286

Query  158  KLSLKVMGF  132
             L+  V+ F
Sbjct  287  NLTSTVLDF  295



>ref|XP_002444900.1| hypothetical protein SORBIDRAFT_07g001090 [Sorghum bicolor]
 gb|EES14395.1| hypothetical protein SORBIDRAFT_07g001090 [Sorghum bicolor]
Length=412

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVY+YL  S HSF+ESY+  T    GRYN RM P I   +W
Sbjct  224  SNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQSAGRYNRRMAPHIMADQW  283

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ IV++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T
Sbjct  284  RKGSEWFELNRELAVQIVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGPLNANRTIT  343

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPASY AA+ITE FIQ+IR+NGT C YN   T +CYLFARKF P+AL  L 
Sbjct  344  WVDWSRGGPHPASYGAADITEDFIQAIRNNGTQCFYNSKPTSVCYLFARKFAPNALGRLM  403

Query  158  KLSLKVMGF  132
             ++  V+ F
Sbjct  404  NMTSTVLDF  412



>ref|XP_004972466.1| PREDICTED: uncharacterized protein LOC101769924 [Setaria italica]
Length=410

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 151/189 (80%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVY+YL  S HSF+ESY+  T    GRYN RM P I   +W
Sbjct  222  SNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHIMADQW  281

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ IV++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T
Sbjct  282  RKGSEWFELNRELAVQIVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGPLNANRTIT  341

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPASY AA+ITE FIQ+IR+NGT C YN   T +CYLFARKF P+AL  L 
Sbjct  342  WVDWSRGGPHPASYGAADITEEFIQTIRNNGTQCFYNSKPTSVCYLFARKFAPNALGRLM  401

Query  158  KLSLKVMGF  132
             L+  V+ F
Sbjct  402  NLTSTVLDF  410



>ref|XP_003573284.1| PREDICTED: uncharacterized protein LOC100833185 [Brachypodium 
distachyon]
Length=406

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVY+YL  S HSF+ESY+  T    GRYN RM P I   +W
Sbjct  218  SNERFVLLSESCIPVFNFPTVYEYLINSEHSFVESYNIDTPQSAGRYNRRMAPHILPDQW  277

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ +V++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T
Sbjct  278  RKGSEWFELNRELAVRVVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTIT  337

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA Y AANI   FIQ+IR+NGT C YN   T +CYLFARKF PSAL PL 
Sbjct  338  WVDWSRGGPHPARYGAANINVEFIQAIRNNGTQCLYNSKHTSVCYLFARKFAPSALGPLM  397

Query  158  KLSLKVMGF  132
             L+  ++ F
Sbjct  398  NLTSTILDF  406



>ref|NP_001143222.1| uncharacterized protein LOC100275738 [Zea mays]
 gb|ACG29937.1| hypothetical protein [Zea mays]
 gb|ACN25800.1| unknown [Zea mays]
 gb|ACN28199.1| unknown [Zea mays]
 gb|AFW74275.1| hypothetical protein ZEAMMB73_796456 [Zea mays]
Length=414

 Score =   267 bits (683),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVY+YL  S HSF+ESY+  T    GRYN RM P I   +W
Sbjct  226  SNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHIMADQW  285

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ IV++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T
Sbjct  286  RKGSEWFELNRELAVQIVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGPLNANRTIT  345

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPASY A +ITE FIQ+IR+NGT C YN   T +CYLFARKF P+AL  L 
Sbjct  346  WVDWSRGGPHPASYGATDITEDFIQAIRNNGTQCFYNSKPTSVCYLFARKFAPNALPRLM  405

Query  158  KLSLKVMGF  132
             L+  V+ F
Sbjct  406  NLTSTVLDF  414



>ref|NP_001143215.1| uncharacterized protein LOC100275720 [Zea mays]
 gb|ACG29786.1| hypothetical protein [Zea mays]
Length=414

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVY+YL  S HSF+ESY+  T    GRYN RM P I   +W
Sbjct  226  SNERFVLLSESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHIMADQW  285

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+NR LA+ IV++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T
Sbjct  286  RKGSEWFELNRELAVQIVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGPLNANRTIT  345

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPASY A +ITE FIQ+IR+NGT C YN   T +CYLFARKF P+AL  L 
Sbjct  346  WVDWSRGGPHPASYGATDITEEFIQAIRNNGTQCFYNSKPTSVCYLFARKFAPNALPRLM  405

Query  158  KLSLKVMGF  132
             L+  V+ F
Sbjct  406  NLTSTVLDF  414



>ref|NP_001052347.1| Os04g0272400 [Oryza sativa Japonica Group]
 emb|CAE01750.2| OSJNBb0056F09.13 [Oryza sativa Japonica Group]
 dbj|BAF14261.1| Os04g0272400 [Oryza sativa Japonica Group]
 gb|EAZ30027.1| hypothetical protein OsJ_14085 [Oryza sativa Japonica Group]
 dbj|BAH00498.1| unnamed protein product [Oryza sativa Japonica Group]
Length=412

 Score =   254 bits (649),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVL SESC+PV++FPTVY+YL  S  S++ESY+       GRYN RM PD+   +W
Sbjct  224  SNERFVLASESCVPVFNFPTVYEYLVNSAQSYVESYNIDVPQCAGRYNPRMAPDVLEEQW  283

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFEM+R LA  IV++ K++A+F+K+C PSCYPDEHYIPTYL L HG  NANR+VT
Sbjct  284  RKGSEWFEMSRDLAADIVADRKYHAIFRKHCTPSCYPDEHYIPTYLHLRHGARNANRTVT  343

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +  A +T  F+Q+IR+NGT C+YN   T +CYLFARKF PSAL PL 
Sbjct  344  WVDWSRGGPHPARFGKATVTPAFVQAIRNNGTRCAYNGKPTTVCYLFARKFAPSALGPLL  403

Query  158  KLSLKVMGF  132
             +S  ++ F
Sbjct  404  NMSTTLLEF  412



>emb|CAH67921.1| OSIGBa0138E08-OSIGBa0161L23.2 [Oryza sativa Indica Group]
Length=412

 Score =   254 bits (649),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVL SESC+PV++FPTVY+YL  S  S++ESY+       GRYN RM PD+   +W
Sbjct  224  SNERFVLASESCVPVFNFPTVYEYLVNSAQSYVESYNIDVPQCAGRYNPRMAPDVLEEQW  283

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFEM+R LA  IV++ K++A+F+K+C PSCYPDEHYIPTYL L HG  NANR+VT
Sbjct  284  RKGSEWFEMSRDLAADIVADRKYHAIFRKHCTPSCYPDEHYIPTYLHLRHGARNANRTVT  343

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +  A +T  F+Q+IR+NGT C+YN   T +CYLFARKF PSAL PL 
Sbjct  344  WVDWSRGGPHPARFGKATVTPAFVQAIRNNGTRCAYNGKPTTVCYLFARKFAPSALGPLL  403

Query  158  KLSLKVMGF  132
             +S  ++ F
Sbjct  404  NMSTTLLEF  412



>ref|XP_009341368.1| PREDICTED: uncharacterized protein LOC103933398 [Pyrus x bretschneideri]
Length=390

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 148/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+F TVY+YL  S HS+++SYDDP RYGRGRY   M PDI   +W
Sbjct  202  SNERFVLLSESCIPIYNFTTVYEYLVGSNHSYVQSYDDPGRYGRGRYRRNMFPDITPRQW  261

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++RAL++ IVSETK+Y +F  YC P+CYPDEHY+PTY+ +  G +N+NR+VT
Sbjct  262  RKGSQWFELSRALSVYIVSETKYYTIFSNYCLPACYPDEHYLPTYINMLQGSLNSNRTVT  321

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWSL GPHP +Y   NITE F++ IR+NG  C YN     ICYLFARKF P+ALEPL 
Sbjct  322  WVDWSLRGPHPTTYGGDNITEDFLRWIRNNGAPCQYNAEMKSICYLFARKFAPTALEPLL  381

Query  158  KLSLKVMGF  132
            KL+  VM +
Sbjct  382  KLAAVVMEY  390



>ref|XP_008786440.1| PREDICTED: uncharacterized protein LOC103704783 isoform X2 [Phoenix 
dactylifera]
Length=284

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++F TVYKYLT+S +SF++SYD+ +  G G YN+ + P+IKL +W
Sbjct  96   SNERFVLLSESCIPVFNFSTVYKYLTKSAYSFVQSYDENSFQGLGHYNSHLAPEIKLPQW  155

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+ R+LA+ IV++ K+Y  F++YC+ +CYPDE YIPTYL + HG  NANR+VT
Sbjct  156  RKGSRWFEIQRSLAVNIVADKKYYFFFREYCKTNCYPDEFYIPTYLNMFHGLSNANRTVT  215

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +  WS+GG HPA+Y   +ITE  I+SIRSNGT C+YN   + +C+LFA KF P ALEPL 
Sbjct  216  WAGWSIGGHHPATYGREDITESLIRSIRSNGTICTYNSKPSSLCFLFAMKFSPDALEPLL  275

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  276  NLTSTVMKF  284



>ref|XP_009415010.1| PREDICTED: uncharacterized protein LOC103995962 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 142/187 (76%), Gaps = 1/187 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPVY FPTVYKYL  S HSF++S+D+ +  GRGRYN RM PDI L +W
Sbjct  205  SNERFVLLSESCIPVYGFPTVYKYLIRSAHSFVQSFDENSPLGRGRYNHRMAPDIVLSQW  264

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+W E++R+LA+ +V++ K++ +F+KYC+P CY DEHY PTY  + HG + ANRS+T
Sbjct  265  RKGSEWLELSRSLAVEVVADFKYHFLFRKYCQPPCYADEHYFPTYFNMFHGALIANRSIT  324

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA+Y   NIT+  IQSIR +   C YN G T +C+LFARKF   ALE L 
Sbjct  325  WVDWSRGGPHPATYGYQNITKDLIQSIRESKI-CKYNSGATTMCFLFARKFASDALELLL  383

Query  158  KLSLKVM  138
             L+  VM
Sbjct  384  NLTSAVM  390



>ref|XP_008786439.1| PREDICTED: uncharacterized protein LOC103704783 isoform X1 [Phoenix 
dactylifera]
Length=384

 Score =   246 bits (629),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 147/189 (78%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++F TVYKYLT+S +SF++SYD+ +  G G YN+ + P+IKL +W
Sbjct  196  SNERFVLLSESCIPVFNFSTVYKYLTKSAYSFVQSYDENSFQGLGHYNSHLAPEIKLPQW  255

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+ R+LA+ IV++ K+Y  F++YC+ +CYPDE YIPTYL + HG  NANR+VT
Sbjct  256  RKGSRWFEIQRSLAVNIVADKKYYFFFREYCKTNCYPDEFYIPTYLNMFHGLSNANRTVT  315

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +  WS+GG HPA+Y   +ITE  I+SIRSNGT C+YN   + +C+LFA KF P ALEPL 
Sbjct  316  WAGWSIGGHHPATYGREDITESLIRSIRSNGTICTYNSKPSSLCFLFAMKFSPDALEPLL  375

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  376  NLTSTVMKF  384



>ref|XP_008786442.1| PREDICTED: uncharacterized protein LOC103704784 [Phoenix dactylifera]
Length=298

 Score =   243 bits (620),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 144/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLS+ CIP+YDF T+Y+YL  S HSF+ SYD+ T  GRGRY+  + P IKL +W
Sbjct  110  SNERFVLLSDGCIPLYDFVTIYRYLLRSDHSFVHSYDEDTENGRGRYSRHLAPAIKLSQW  169

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFE++R+LA+ IV++ K+Y +F+KY     YPDEHYIPT+L + +G   ANR++T
Sbjct  170  RKGAQWFELHRSLAVNIVADDKYYNLFRKYAGSLNYPDEHYIPTFLSMIYGASIANRTLT  229

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS  GPHPA++   NITEGFIQSIR+N T+CSYN   T +C+LFARKF   ALEPL 
Sbjct  230  WVDWSTRGPHPATFGRRNITEGFIQSIRNNATTCSYNFRPTSVCFLFARKFSRDALEPLL  289

Query  158  KLSLKVMGF  132
             +S  VM F
Sbjct  290  NISPTVMRF  298



>ref|XP_003567325.1| PREDICTED: uncharacterized protein LOC100845991 [Brachypodium 
distachyon]
Length=395

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 139/190 (73%), Gaps = 1/190 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV  FP V+ YL  S HSF+E Y  P++  RGRYN RM PDI L +W
Sbjct  206  SNERFVLLSESCIPVQPFPVVHDYLVGSRHSFVEVYYVPSKQCRGRYNRRMAPDITLRQW  265

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R +A  ++++ K+Y +F+K+CRPSCYPDEHYIPT + + HG+ N+NR++T
Sbjct  266  RKGSQWFELSRDVATAVLADAKYYPLFRKHCRPSCYPDEHYIPTMVNMLHGHRNSNRTIT  325

Query  338  YVDWSLGGPHPASYTAANITEGFIQSI-RSNGTSCSYNRGKTQICYLFARKFFPSALEPL  162
            +VDWS GGPHPA Y A ++T   IQ I R  G  C YN   T +C+LFARKF P  L PL
Sbjct  326  FVDWSKGGPHPAKYGAGDVTVELIQRIRRRTGRPCLYNSRPTSMCFLFARKFTPDMLGPL  385

Query  161  EKLSLKVMGF  132
              +S  VMGF
Sbjct  386  LNMSSAVMGF  395



>ref|XP_010930512.1| PREDICTED: uncharacterized protein LOC105051676 [Elaeis guineensis]
Length=383

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 141/183 (77%), Gaps = 0/183 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVYKYL +S +SF++SYD+ +  G   YN+RM PDIKL +W
Sbjct  197  SNERFVLLSESCIPVFNFPTVYKYLIDSAYSFVQSYDENSNQGLRYYNSRMAPDIKLSQW  256

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE+ R LA+ IV++ K+Y+ F+KYC+  C+PDE YIPTYL + HG  NANR+VT
Sbjct  257  RKGSRWFEIQRLLAVDIVADKKYYSFFRKYCKTGCFPDEFYIPTYLNMFHGLSNANRTVT  316

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +  WS GG HPA+Y   +ITE  IQSIR+NG  C+YN   + +C+LFA KF P ALEPL 
Sbjct  317  WAGWSRGGHHPATYGREDITESLIQSIRNNGIICTYNSKPSSVCFLFAMKFSPDALEPLL  376

Query  158  KLS  150
             L+
Sbjct  377  NLT  379



>ref|XP_008377912.1| PREDICTED: uncharacterized protein LOC103440993, partial [Malus 
domestica]
Length=220

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESCIP+Y+F  +Y+YL +S +S++ ++DDP  YGRGRYN  M P++ + +W
Sbjct  33   SNERFILLSESCIPLYNFSVIYQYLMKSKYSYVGAFDDPGPYGRGRYNDNMAPEVSISKW  92

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +TKFY  FK++CRP+CY DEHY PT L +  G   ANRS+T
Sbjct  93   RKGSQWFEVNRKLAITIVEDTKFYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANRSIT  152

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  A+ITE F++ I      C+YN   + +C+LF RKF PSA+EPL 
Sbjct  153  WVDWSRGGPHPATFGRADITEEFLKRIFER-QRCTYNDRNSTVCFLFGRKFAPSAMEPLL  211

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  212  HLAPKFLGF  220



>ref|XP_010916432.1| PREDICTED: uncharacterized protein LOC105041249 [Elaeis guineensis]
Length=399

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 147/189 (78%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RF+LLSESCIP+++F T+Y YL  ST +++ SYDDP   GRGRYN RMKP +KL EW
Sbjct  210  SNQRFILLSESCIPLFNFSTIYSYLINSTQTYVSSYDDPGPNGRGRYNIRMKPRVKLQEW  269

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++RALAI I+S+ K++ +FKKYCRPSCY DEHY+ T++ +   + NANRS+T
Sbjct  270  RKGSQWFEVDRALAIEIISDEKYFPVFKKYCRPSCYVDEHYLSTFVSMRFWWRNANRSLT  329

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +   ++T   ++ +R NG++C+YN   T +C+LFARKF P++L  L 
Sbjct  330  WVDWSKGGPHPARFGRLDVTTELLERMR-NGSTCNYNGRTTSVCFLFARKFLPNSLTRLM  388

Query  158  KLSLKVMGF  132
            + + +V+GF
Sbjct  389  RFAPRVLGF  397



>ref|XP_006645101.1| PREDICTED: uncharacterized protein LOC102713419 [Oryza brachyantha]
Length=385

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 141/189 (75%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV  FPTVY YLT S HSF+E Y    +  RGRY+ RM+PDI L +W
Sbjct  197  SNERFVLLSESCIPVQSFPTVYDYLTGSRHSFVEVYYHKDKTCRGRYSHRMEPDITLPQW  256

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ ++++T++Y +F+++C PSCYPDEHY+PT + + HG  N+NR+VT
Sbjct  257  RKGSQWFELSRGLAVSVLADTRYYPLFRQHCLPSCYPDEHYLPTLVTMLHGAANSNRTVT  316

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            YVDWS GG HP +Y A ++T   IQS+R + T C YN   T  C+LFARKF P ALEPL 
Sbjct  317  YVDWSRGGAHPVTYAAGDVTPDLIQSLRRSETPCMYNSRPTTACFLFARKFSPDALEPLL  376

Query  158  KLSLKVMGF  132
             +S  VM +
Sbjct  377  NMSSTVMQY  385



>ref|XP_010227722.1| PREDICTED: uncharacterized protein LOC104581568 [Brachypodium 
distachyon]
Length=411

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+L+SESC+PV++FPTVY+YL  S  S++ESY+       GRYN RM PD+   +W
Sbjct  223  SNERFLLVSESCVPVFNFPTVYEYLVNSAQSYVESYNMDVPQCAGRYNPRMAPDVLEEQW  282

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE++R LA+ +VS+ ++YA+F+K+C PSCYPDEHYIPTYL L HG  NANR+VT
Sbjct  283  RKGSEWFEVSRELAVDVVSDRRYYAVFRKHCTPSCYPDEHYIPTYLHLVHGPRNANRTVT  342

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSA  174
            +VDWS GGPHPA Y    +T  F+Q+IR+NGT C YN   T +CYLFARKF PSA
Sbjct  343  WVDWSRGGPHPARYGKGTVTAEFLQAIRNNGTQCLYNGKPTTVCYLFARKFAPSA  397



>ref|XP_009763004.1| PREDICTED: uncharacterized protein LOC104214963 isoform X2 [Nicotiana 
sylvestris]
Length=230

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+F T+Y Y+  ST +F+ESYD P+  GRGRYN +M+P I L +W
Sbjct  42   SNERFVLLSESCIPLYNFTTIYNYIMNSTKTFMESYDLPSPVGRGRYNKKMQPWITLDQW  101

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R +AI I+++ K++ +FK+YC+P+CY DEHY+PT++ + + + N NR++T
Sbjct  102  RKGSQWFEVDREIAIDIITDQKYFQLFKRYCKPACYSDEHYLPTFVTMRYWWKNGNRTLT  161

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDW+ GGPHP  +   ++T   +  +R NGT C YN   T +CYLFARKF PS L+ L 
Sbjct  162  WVDWTKGGPHPTRFIRTDVTADLLNRMR-NGTQCEYNGDPTNMCYLFARKFLPSTLDRLL  220

Query  158  KLSLKVMGF  132
            + + K+M F
Sbjct  221  RFAPKIMKF  229



>gb|EMS55277.1| hypothetical protein TRIUR3_33067 [Triticum urartu]
Length=449

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVL+SESC+PV++FPTVY+YL  S  S++ESY+       GRYN RM PD+   +W
Sbjct  261  SNQRFVLVSESCVPVFNFPTVYEYLINSAQSYVESYNIDVPQCAGRYNPRMAPDVTEQQW  320

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE++R LA+ IV++ ++Y +F+K+C PSCYPDEHYIPTYL L HG  NANR++T
Sbjct  321  RKGSEWFELSRELAVDIVADRRYYHVFRKHCTPSCYPDEHYIPTYLHLVHGPRNANRTIT  380

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSA  174
            +VDWS GGPHPA Y  A++T+ FIQ+IR+NGT C YN   T +CYLFARKF PSA
Sbjct  381  WVDWSRGGPHPARYGKASVTKEFIQAIRNNGTQCLYNGRPTTVCYLFARKFAPSA  435



>ref|XP_010942042.1| PREDICTED: uncharacterized protein LOC105060116 isoform X2 [Elaeis 
guineensis]
Length=298

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+F   Y+YL  S +SF+ S+DDP  +GRGRYN RMKP++ + +W
Sbjct  110  SNERFVLLSESCIPLYNFSITYRYLMRSRYSFVGSFDDPGPHGRGRYNLRMKPEVNIAQW  169

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFE+NR LAI I+S+ K+Y  F+ +C+P CY DEHY PT L +   ++ ANRSVT
Sbjct  170  RKGAQWFEVNRKLAINIISDAKYYPKFRDFCKPGCYVDEHYFPTMLAIESPHLMANRSVT  229

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +ITE F++ I   G SC YN   + +C+LFARKF P+ALEPL 
Sbjct  230  WVDWSRGGAHPATFGKRDITEAFLKKIL-EGKSCFYNAQPSSVCFLFARKFAPNALEPLL  288

Query  158  KLSLKVMGF  132
            +L+  ++GF
Sbjct  289  QLAPSLLGF  297



>ref|XP_008795296.1| PREDICTED: uncharacterized protein LOC103711078 [Phoenix dactylifera]
Length=385

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 145/189 (77%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++F T+Y YL  S +SF++S D+    G G YN+RM P+IK  +W
Sbjct  197  SNERFVLLSESCIPVFNFQTIYNYLINSAYSFVQSNDENPIQGHGSYNSRMAPEIKHSQW  256

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            R+G++WFE+ R+LA+ IV++ K+Y++F+KYC+ +CYPD+ YIPTYL +  G +NANR+VT
Sbjct  257  REGTRWFEVKRSLAVNIVADNKYYSIFRKYCKITCYPDDSYIPTYLNMLDGILNANRTVT  316

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS  G HPA+Y + +ITEG IQSIR+NGT C+YN   + +C+LFA KF P ALEPL 
Sbjct  317  WADWSKRGHHPATYGSEDITEGLIQSIRNNGTICTYNSKPSSVCFLFAMKFSPDALEPLL  376

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  377  NLASMVMKF  385



>ref|XP_010453221.1| PREDICTED: uncharacterized protein LOC104735185 [Camelina sativa]
Length=387

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+Y+F T+Y YL+ S HSF+ ++DDP  YGRGRYN  M+P++ L +W
Sbjct  200  SNEWFVLVSESCIPLYNFTTIYSYLSRSKHSFMGAFDDPGPYGRGRYNGNMEPEVPLTKW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  260  RKGSQWFEINRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPAVLANRSIT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++ITE F + I  +G +C+YN   T +CYLFARKF PSALEPL 
Sbjct  320  WVDWSRGGPHPATFGRSDITEKFFERI-FDGRNCTYNGRNTSLCYLFARKFAPSALEPLL  378

Query  158  KLSLKVMGF  132
             ++ K++GF
Sbjct  379  HIAPKILGF  387



>dbj|BAK04145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 141/194 (73%), Gaps = 5/194 (3%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP++ F  VY YL  S HSF+E Y   T+  +GRY+ RM P I+L +W
Sbjct  198  SNERFVLLSESCIPLHSFRAVYDYLVGSRHSFVEVYFQQTKQCQGRYSRRMAPAIRLPQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI ++++TK+Y +F+++CRPSCYPDEHY+PT + + HG  NANR+VT
Sbjct  258  RKGSQWFELNRDLAISVLADTKYYPLFRRHCRPSCYPDEHYLPTTVDMLHGARNANRTVT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIR-----SNGTSCSYNRGKTQICYLFARKFFPSA  174
            YVDW+ GG HPA YTA+N+T   IQ IR      +  SC YN   T +C+LFARKF P  
Sbjct  318  YVDWTKGGAHPAKYTASNVTAAAIQGIRRRRWKGDRPSCYYNDRPTSMCFLFARKFAPDT  377

Query  173  LEPLEKLSLKVMGF  132
            L PL  +S  VMG+
Sbjct  378  LGPLLNMSSAVMGY  391



>ref|XP_006842358.1| hypothetical protein AMTR_s00079p00180800 [Amborella trichopoda]
 gb|ERN04033.1| hypothetical protein AMTR_s00079p00180800 [Amborella trichopoda]
Length=206

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 139/190 (73%), Gaps = 1/190 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSE+CIP+++F TVY YLT S HS++ S+DDP   GRGRY  RM+P +KL  W
Sbjct  17   SNERFVLLSEACIPLFNFTTVYSYLTNSRHSYVHSFDDPGANGRGRYPRRMRPHVKLSSW  76

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++RA+A  IV+E+ +Y +F KYC+P+CY DEHY+ T + L  G  +ANRS+T
Sbjct  77   RKGSQWFELDRAMAQDIVAESNYYGLFAKYCKPTCYVDEHYLSTLVALKFGGRSANRSLT  136

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSN-GTSCSYNRGKTQICYLFARKFFPSALEPL  162
            +VDWS GGPHP  +    +T   +  +RS  G  C YN G T IC+LFARKF P+AL+ L
Sbjct  137  WVDWSRGGPHPMRFGRREVTIEVLNKMRSGEGKRCGYNGGSTDICFLFARKFLPNALDRL  196

Query  161  EKLSLKVMGF  132
             + + KV+G+
Sbjct  197  LRFAPKVLGY  206



>ref|XP_008796992.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
 ref|XP_008796993.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
 ref|XP_008796994.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
Length=384

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+F  +Y YL  S +SF+ S+DDP  YGRGRYN RM P++ + +W
Sbjct  196  SNERFVLLSESCIPLYNFSIIYHYLMRSRYSFVGSFDDPGPYGRGRYNLRMAPEVNIMQW  255

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFE+NR LAI IV +TK+Y  F ++CRPSCY DEHY PT L +   ++ ANR++T
Sbjct  256  RKGAQWFEVNRKLAIDIVRDTKYYPKFNEFCRPSCYVDEHYFPTMLTIESPHLIANRTIT  315

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +ITE F++ I   G +C YN   + +C+LFARKF PSALEPL 
Sbjct  316  WVDWSRGGAHPATFGKGDITEAFLKKIL-EGKTCLYNDQPSSVCFLFARKFAPSALEPLL  374

Query  158  KLSLKVMGF  132
            + +  ++GF
Sbjct  375  QFATSLLGF  383



>ref|XP_010942037.1| PREDICTED: uncharacterized protein LOC105060116 isoform X1 [Elaeis 
guineensis]
Length=384

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+F   Y+YL  S +SF+ S+DDP  +GRGRYN RMKP++ + +W
Sbjct  196  SNERFVLLSESCIPLYNFSITYRYLMRSRYSFVGSFDDPGPHGRGRYNLRMKPEVNIAQW  255

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFE+NR LAI I+S+ K+Y  F+ +C+P CY DEHY PT L +   ++ ANRSVT
Sbjct  256  RKGAQWFEVNRKLAINIISDAKYYPKFRDFCKPGCYVDEHYFPTMLAIESPHLMANRSVT  315

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +ITE F++ I   G SC YN   + +C+LFARKF P+ALEPL 
Sbjct  316  WVDWSRGGAHPATFGKRDITEAFLKKI-LEGKSCFYNAQPSSVCFLFARKFAPNALEPLL  374

Query  158  KLSLKVMGF  132
            +L+  ++GF
Sbjct  375  QLAPSLLGF  383



>ref|XP_006394845.1| hypothetical protein EUTSA_v10004382mg [Eutrema salsugineum]
 gb|ESQ32131.1| hypothetical protein EUTSA_v10004382mg [Eutrema salsugineum]
Length=387

 Score =   238 bits (607),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+++F T++ Y+T+S HSF+ S+DDP+ YGRGRYN  M P++ ++EW
Sbjct  200  SNEWFVLLSESCIPLFNFTTIHGYITKSKHSFMGSFDDPSPYGRGRYNGNMSPEVSINEW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ I+ +T +Y  FK++C P+CY DEHY PT L +      ANRS+T
Sbjct  260  RKGSQWFEVNRELAVSIIKDTLYYPKFKEFCTPACYVDEHYFPTMLTIEKPAALANRSLT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++++E F   I  NG +C+YN G T +CYLFARKF PSALEPL 
Sbjct  320  WVDWSRGGPHPATFGQSDVSEEFFARIL-NGDNCTYNGGNTSMCYLFARKFSPSALEPLI  378

Query  158  KLSLKVMGF  132
             ++ K++ F
Sbjct  379  YIAPKILSF  387



>ref|XP_006286517.1| hypothetical protein CARUB_v10001158mg [Capsella rubella]
 gb|EOA19415.1| hypothetical protein CARUB_v10001158mg [Capsella rubella]
Length=386

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+L+SESCIP+Y+F T+Y YL+ S HSF+ ++DDP  YGRGRYN+ M+P++ + +W
Sbjct  199  SNEWFILVSESCIPLYNFTTIYSYLSRSKHSFMGAFDDPGPYGRGRYNSNMEPEVPITKW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  259  RKGSQWFEINRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPEVLANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  +++TE F   I  +G +C+YN   T +CYLFARKF PSALEPL 
Sbjct  319  WVDWSRGGPHPATFGRSDVTENFFVKI-FDGRNCTYNGRNTSMCYLFARKFAPSALEPLL  377

Query  158  KLSLKVMGF  132
             +S K++GF
Sbjct  378  SISPKILGF  386



>ref|XP_002871492.1| hypothetical protein ARALYDRAFT_909140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47751.1| hypothetical protein ARALYDRAFT_909140 [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+++F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ L +W
Sbjct  200  SNEWFVLVSESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNGNMEPEVPLSKW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  260  RKGSQWFEVDRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPTVLANRSLT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++ITE F + I  +G +CSYN G T +CYLFARKF PS LEPL 
Sbjct  320  WVDWSRGGPHPATFGRSDITEKFFERI-FDGRNCSYNGGNTSMCYLFARKFAPSTLEPLL  378

Query  158  KLSLKVMGF  132
             ++ KV+GF
Sbjct  379  HIAPKVLGF  387



>ref|XP_010491917.1| PREDICTED: uncharacterized protein LOC104769408 [Camelina sativa]
Length=387

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+Y+F T+Y YL+ S HSF+ ++DDP  YGRGRYN  M+P++ + +W
Sbjct  200  SNEWFVLVSESCIPLYNFTTIYSYLSRSKHSFMGAFDDPGPYGRGRYNGNMEPEVPVTKW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  260  RKGSQWFEINRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPAVLANRSIT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++ITE F   I  +G +C+YN   T ICYLFARKF PSALEPL 
Sbjct  320  WVDWSRGGPHPATFGRSDITEKFFGRI-FDGRNCTYNGRNTSICYLFARKFAPSALEPLL  378

Query  158  KLSLKVMGF  132
             ++ K++GF
Sbjct  379  HIAPKILGF  387



>ref|NP_196734.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 emb|CAB87691.1| putative protein [Arabidopsis thaliana]
 gb|AAM13183.1| putative protein [Arabidopsis thaliana]
 gb|AAP68292.1| At5g11730 [Arabidopsis thaliana]
 dbj|BAE99143.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91715.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38636.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=386

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+Y+F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ L +W
Sbjct  199  SNEWFVLVSESCIPLYNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNGNMEPEVPLTKW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  259  RKGSQWFEVNRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPTVLANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++ITE F   I  +G +CSYN   T +CYLFARKF PSALEPL 
Sbjct  319  WVDWSRGGPHPATFGRSDITENFFGKI-FDGRNCSYNGRNTSMCYLFARKFAPSALEPLL  377

Query  158  KLSLKVMGF  132
             ++ K++GF
Sbjct  378  HIAPKILGF  386



>ref|XP_006355313.1| PREDICTED: uncharacterized protein LOC102601627 [Solanum tuberosum]
Length=388

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+Y+F  +YKY+++S HSF+ ++DDP  YGRGRY+  M P++ + +W
Sbjct  201  SNEWFVLLSESCIPLYNFNVIYKYISQSKHSFVGAFDDPGPYGRGRYDENMLPEVNISQW  260

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R LA+ IV +TKFY  F ++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  261  RKGSQWFEMSRKLALFIVEDTKFYPKFAEFCRPACYVDEHYFPTMLTIQASNLLANRSIT  320

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  ++ITE F++ + + G +C+YN   T +CY+FARKF PSALEPL 
Sbjct  321  WVDWSRGGAHPATFGKSDITEEFMKRMLA-GPNCTYNDRNTSMCYIFARKFAPSALEPLF  379

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  380  LLAPKYLGF  388



>gb|ADE76813.1| unknown [Picea sitchensis]
Length=345

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 141/183 (77%), Gaps = 1/183 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSE+CIPV++F T+Y YL +S HSF+ S+DDP   GRGRYN +M P++ L +W
Sbjct  158  SNERFILLSETCIPVFNFSTIYNYLIKSKHSFVHSFDDPRPEGRGRYNIKMAPEVTLSQW  217

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI I+S+TK+Y +FK +C+PSCY DEHYIPT L +  G + +NRS+T
Sbjct  218  RKGSQWFEVHRKLAIDIISDTKYYQIFKAFCKPSCYIDEHYIPTILSMQFGSLISNRSIT  277

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA +   +IT+ F+ SIR +  +C+YN     +C+LFARKF PSAL+PL 
Sbjct  278  WVDWSRGGSHPAMFGKDDITQEFMMSIR-DVNNCTYNDQTMSLCFLFARKFSPSALDPLL  336

Query  158  KLS  150
             +S
Sbjct  337  NMS  339



>ref|XP_009337144.1| PREDICTED: uncharacterized protein LOC103929645 [Pyrus x bretschneideri]
 ref|XP_009337145.1| PREDICTED: uncharacterized protein LOC103929645 [Pyrus x bretschneideri]
Length=389

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESCIP+Y+F  +Y YL +S +S++ ++DDP  YGRGRYN  M P++K+ +W
Sbjct  202  SNERFILLSESCIPLYNFSVIYHYLMKSKYSYVGAFDDPGPYGRGRYNDNMAPEVKISKW  261

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +TKFY  FK++CRP+CY DEHY PT L +  G   ANRS+T
Sbjct  262  RKGSQWFEVNRKLAITIVEDTKFYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANRSIT  321

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  A+IT  F++ I      C+YN   + IC+LF RKF PSA+EPL 
Sbjct  322  WVDWSRGGPHPATFGRAHITGEFLKRIFET-QRCTYNDRNSTICFLFGRKFAPSAMEPLL  380

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  381  HLAPKFLGF  389



>gb|KDP29447.1| hypothetical protein JCGZ_18368 [Jatropha curcas]
Length=353

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSE+CIP+++F T+Y YL  S  SF+ SYDDP+R GRGRYN R+ P + L +W
Sbjct  164  SNERFVLLSETCIPIFNFTTIYNYLINSNQSFLASYDDPSRAGRGRYNKRLWPTVTLSDW  223

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R L   IVS+ K+Y +F+ YC+P CY DEHY PT +      +N+NRS+T
Sbjct  224  RKGSQWFEIHRKLTGKIVSDVKYYPIFRDYCKPPCYMDEHYFPTLVTKICPELNSNRSIT  283

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWSLGGPHP +Y   +++E F+  IR NG +CSYN   T +C+LFARKF  SAL+PL 
Sbjct  284  WVDWSLGGPHPRNYVKKDVSEAFLNWIR-NGFNCSYNGAMTTVCFLFARKFHSSALQPLL  342

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  343  RIAPALLGF  351



>ref|XP_010519868.1| PREDICTED: uncharacterized protein LOC104799181 [Tarenaya hassleriana]
Length=384

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSE+CIP+++F T+++Y+T+S HSF+ S+DDP  YGRGRYN+ M P++ + +W
Sbjct  197  SNEWFVLLSETCIPLFNFTTIHRYITKSKHSFVGSFDDPGPYGRGRYNSSMAPEMDITQW  256

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +T +Y  F+ +CRP+CY DEHY PT L +    + ANRSVT
Sbjct  257  RKGSQWFEVNRELAVTIVKDTVYYPKFRDFCRPACYVDEHYFPTMLNVEKPGLLANRSVT  316

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  +++TE F   I   G +CSYN   T +CYLFARKF PSALEPL 
Sbjct  317  WVDWSRGGAHPATFGRSDMTEDFFGRIH-GGRNCSYNGHNTSMCYLFARKFAPSALEPLL  375

Query  158  KLSLKVMGF  132
             L+ KV+GF
Sbjct  376  HLAPKVLGF  384



>ref|XP_004141306.1| PREDICTED: uncharacterized protein LOC101205668 [Cucumis sativus]
 gb|KGN55314.1| hypothetical protein Csa_4G645880 [Cucumis sativus]
Length=386

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            +NE F+LLSESCIP+++F  +YKYL ES +SF+ S+DD   YGRGRY   M P++ + EW
Sbjct  199  NNEWFILLSESCIPLFNFSVIYKYLKESKYSFVGSFDDLGPYGRGRYRDAMAPEVNITEW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +TKFY  F+++CRP CY DEHY PT L +  G + ANRS+T
Sbjct  259  RKGSQWFEVNRKLAISIVQDTKFYKKFEQFCRPPCYVDEHYFPTMLTIEAGDVIANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++   +ITE  +  I  NG +CSYN G + IC LFARKF PS+L PL 
Sbjct  319  WVDWSRGGPHPATFGRRDITEELLARI-VNGQNCSYNNGTSSICSLFARKFAPSSLRPLL  377

Query  158  KLSLKVMGF  132
            +L+L V G+
Sbjct  378  RLALDVFGY  386



>ref|XP_007217120.1| hypothetical protein PRUPE_ppa015089m1g, partial [Prunus persica]
 gb|EMJ18319.1| hypothetical protein PRUPE_ppa015089m1g, partial [Prunus persica]
Length=214

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I +  W
Sbjct  25   SNQRFVLLSESCIPLFNFTTTYDYLINSNLSFLSSFDDPRKPGRGRYNPKMYPIINITNW  84

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI IVS+ K+Y +F++YCRPSCY DEHYIPT + + +  +N+ RS+T
Sbjct  85   RKGSQWFEVHRELAIHIVSDCKYYPIFQEYCRPSCYIDEHYIPTLVNILYSELNSKRSIT  144

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +  ++IT+ F+  IR  G+ C YN   T IC+LFARKF P+ LEPL 
Sbjct  145  WVDWSRGGPHPGKFEWSDITDEFLNRIRF-GSECEYNGNTTSICFLFARKFMPNTLEPLL  203

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  204  RVAPLLLGF  212



>ref|XP_006426464.1| hypothetical protein CICLE_v100272021mg, partial [Citrus clementina]
 gb|ESR39704.1| hypothetical protein CICLE_v100272021mg, partial [Citrus clementina]
Length=212

 Score =   231 bits (588),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESC+P+++F  VY Y+++S +SF+ESYDDP  YGRGRYN  M+P++ L +W
Sbjct  25   SNEWFILLSESCVPLHNFSIVYYYISKSRYSFMESYDDPGPYGRGRYNGNMEPEVTLSQW  84

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ I+ +T +Y  F+ +C+P CY DEHY PT L +H   + ANR++T
Sbjct  85   RKGSQWFEINRRLAVDIIEDTSYYPKFRDFCKPGCYVDEHYFPTMLTIHFSRLLANRTLT  144

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GG HPA+Y  A+I+E F + I ++ + C YN+  T  CYLFARKF PSAL PL 
Sbjct  145  WTDWSRGGAHPATYGGADISEEFFRKITAS-SQCYYNKQVTSFCYLFARKFAPSALGPLL  203

Query  158  KLSLKVMGF  132
            +LSL   GF
Sbjct  204  ELSLSAFGF  212



>ref|XP_009601239.1| PREDICTED: uncharacterized protein LOC104096562 [Nicotiana tomentosiformis]
Length=388

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+Y+F  +YKY+++S HSFI ++DDP  YGRGRY+  M P++ + +W
Sbjct  201  SNEWFVLLSESCIPLYNFNVIYKYISQSKHSFIGAFDDPGPYGRGRYDENMLPEVNITDW  260

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +TKFY  F ++C+P+CY DEHY PT L +    + ANRS+T
Sbjct  261  RKGSQWFEINRKLALYIVEDTKFYPKFAEFCKPACYVDEHYFPTMLTIQASNLLANRSIT  320

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  ++ITE F++ + + G +C+YN   T +C+LFARKF PSALEPL 
Sbjct  321  WVDWSRGGAHPATFGKSDITEEFMKRMLA-GRNCTYNERNTSMCFLFARKFAPSALEPLF  379

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  380  LLAPKYLGF  388



>ref|XP_006399687.1| hypothetical protein EUTSA_v10013787mg [Eutrema salsugineum]
 gb|ESQ41140.1| hypothetical protein EUTSA_v10013787mg [Eutrema salsugineum]
Length=386

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+++F T+Y YL++S HSF+ ++DDP  +GRGRYN  M+P++ + +W
Sbjct  199  SNEWFVLVSESCIPLFNFTTIYSYLSQSKHSFMGAFDDPGPFGRGRYNPNMEPEVPITKW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  259  RKGSQWFEINRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPVVLANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++ITE F   I  +G +C+YN   T +CYLFARKF PSALEPL 
Sbjct  319  WVDWSRGGPHPATFGRSDITENFFGKI-FDGRNCTYNGRNTSMCYLFARKFAPSALEPLL  377

Query  158  KLSLKVMGF  132
             ++ K++GF
Sbjct  378  HIAPKILGF  386



>ref|XP_008452696.1| PREDICTED: uncharacterized protein LOC103493641 [Cucumis melo]
Length=386

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            +NE F+LLSESCIP+++F  +YKYL ES +SF+ S+DD   YGRGRY   M P++ + EW
Sbjct  199  NNEWFILLSESCIPLFNFSVIYKYLKESKYSFVGSFDDLGPYGRGRYRDAMAPEVNITEW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +TK+Y  F+++CRP CY DEHY PT L +  G + ANRS+T
Sbjct  259  RKGSQWFEVNRKLAISIVQDTKYYQKFEQFCRPPCYVDEHYFPTMLTIEAGDVIANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++   +ITE  +  I  NG +CSYN G + IC LFARKF PS+L+PL 
Sbjct  319  WVDWSRGGPHPATFGRRDITEELLARI-VNGQNCSYNNGTSSICSLFARKFAPSSLQPLL  377

Query  158  KLSLKVMGF  132
            +L+L V G+
Sbjct  378  RLALDVFGY  386



>ref|XP_006485819.1| PREDICTED: uncharacterized protein LOC102611796 [Citrus sinensis]
Length=419

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 145/189 (77%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            +N+RFVLLSESCIP+++F T+Y YL  S+ +F+E+YD P   GRGRYN RM+P I+L +W
Sbjct  231  TNQRFVLLSESCIPLFNFSTIYNYLINSSKAFVEAYDLPGPVGRGRYNRRMRPVIRLEQW  290

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+RALA+ ++S+ K++  FK++C+ SCY DEHY+PT++       N+NRS+T
Sbjct  291  RKGSQWFEMDRALALEVISDKKYFVTFKRHCKASCYADEHYLPTFVSAKFWKRNSNRSLT  350

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +   ++T  F++ +RS G+ C YN  +T IC+LFARKF P+AL+ L 
Sbjct  351  WVDWSKGGPHPAKFQRRDVTIEFLKRLRS-GSHCEYNGKRTNICFLFARKFLPNALDRLL  409

Query  158  KLSLKVMGF  132
            + + KVMGF
Sbjct  410  RFAPKVMGF  418



>ref|XP_010912680.1| PREDICTED: uncharacterized protein LOC105038537 [Elaeis guineensis]
Length=385

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 143/189 (76%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++FPTVY YL +S +SF++SYD+    G+G Y++ M P+I   +W
Sbjct  197  SNERFVLLSESCIPVFNFPTVYNYLIDSAYSFVQSYDENPIQGQGYYDSHMAPEINHSQW  256

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+ WFE+ R+LA+ IV++ K+Y++F+KYC+ +C+ D+ YIPTYL +  G +NANR+V 
Sbjct  257  RKGTPWFEVQRSLAVNIVADNKYYSIFRKYCKTTCHSDDSYIPTYLNMLDGILNANRTVI  316

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS+ G HPA+Y   +ITEG IQSIR+NGT C YN   + +C+LFA KF P ALEPL 
Sbjct  317  WADWSMRGSHPATYGHEDITEGIIQSIRNNGTICRYNSKPSSVCFLFAMKFSPDALEPLL  376

Query  158  KLSLKVMGF  132
             L+  VM F
Sbjct  377  NLTSTVMKF  385



>ref|XP_010108861.1| hypothetical protein L484_027054 [Morus notabilis]
 gb|EXC20501.1| hypothetical protein L484_027054 [Morus notabilis]
Length=405

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F  +Y YL  S  SF+ S+DDP   GRGRYN +M+P IKL +W
Sbjct  216  SNQRFVLLSESCIPLFNFTAIYSYLINSNLSFLGSFDDPRSPGRGRYNPQMQPHIKLSDW  275

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFE++R LA+ ++S+ KFY +F+  CRP+CY DEHY+PT + + +G  NANRSVT
Sbjct  276  RKGAQWFELHRDLAVRVLSDRKFYPLFRDLCRPACYSDEHYLPTLVNILYGESNANRSVT  335

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +   ++T+ F+  IR  G+ C YN  +T +C+LFARKF P+ALEPL 
Sbjct  336  WVDWSRGGPHPGRFGWGDVTDEFLNRIRF-GSKCLYNGNETSMCFLFARKFLPNALEPLL  394

Query  158  KLSLKVMGF  132
            ++S  ++GF
Sbjct  395  RVSPVLLGF  403



>ref|XP_006842356.1| hypothetical protein AMTR_s00079p00179880 [Amborella trichopoda]
 gb|ERN04031.1| hypothetical protein AMTR_s00079p00179880 [Amborella trichopoda]
Length=376

 Score =   236 bits (601),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+++F T Y YL  S HSF+ S+DDP   GRGRYN  M P+I L EW
Sbjct  187  SNERFVLLSESCIPLFNFTTAYSYLINSHHSFVGSFDDPRHCGRGRYNKTMAPEILLSEW  246

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NRALAI IVS+TK+YA+F+++C P CY DEHY+PT++  +    N+NRS  
Sbjct  247  RKGSQWFEVNRALAIEIVSDTKYYAIFREHCNPPCYMDEHYLPTFVTKNFPSSNSNRSFM  306

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++ + + TE F+  IR N  +C+YN   T IC+LFARK+ P+AL+PL 
Sbjct  307  WVDWSRGGSHPATFRSGDATERFLNQIR-NSENCTYNGNPTSICFLFARKWAPNALQPLL  365

Query  158  KLSLKVMGF  132
            +++ +V+G 
Sbjct  366  RIAPRVLGL  374



>ref|XP_006853920.1| hypothetical protein AMTR_s00036p00191120 [Amborella trichopoda]
 gb|ERN15387.1| hypothetical protein AMTR_s00036p00191120 [Amborella trichopoda]
Length=327

 Score =   234 bits (596),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 134/188 (71%), Gaps = 1/188 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+ +F TVY YL  S HSF+ S+DDP+ YGRGRYN  M P++ + EW
Sbjct  140  SNERFVLLSESCIPIMNFTTVYHYLMRSRHSFVGSFDDPSVYGRGRYNENMAPEVNITEW  199

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ ++ +T +Y  FK +CRP+CY DEHY PT   +   Y  ANRS+T
Sbjct  200  RKGSQWFEVNRKLALTLIEDTTYYPKFKNFCRPACYVDEHYFPTMFTIKAPYHIANRSIT  259

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +IT  FI  I  NG  C YN   + +C+LFARKF PSAL PL 
Sbjct  260  WVDWSRGGAHPATFGKVDITVEFIARI-VNGNECKYNNQSSSVCFLFARKFAPSALVPLL  318

Query  158  KLSLKVMG  135
             L+ K +G
Sbjct  319  DLAPKFIG  326



>ref|XP_010419754.1| PREDICTED: uncharacterized protein LOC104705440 [Camelina sativa]
Length=387

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            +NE FVL+SESCIP+Y+F T+Y Y++ S HSF+ ++DDP  YGRGRYN  M+P++ L +W
Sbjct  200  NNEWFVLVSESCIPLYNFTTIYSYISRSKHSFMGAFDDPGPYGRGRYNGNMEPEVPLTKW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  260  RKGSQWFEINRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPAVLANRSIT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++ITE F   I  +G +C+YN   T +CYLFARKF PSALEPL 
Sbjct  320  WVDWSRGGPHPATFGRSDITEKFFGRI-FDGRNCTYNGRNTSMCYLFARKFAPSALEPLL  378

Query  158  KLSLKVMGF  132
             ++ K++GF
Sbjct  379  HIAPKILGF  387



>ref|XP_010648315.1| PREDICTED: uncharacterized protein LOC100249300 [Vitis vinifera]
Length=385

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+F  +Y Y+ +S +SF+ ++DDP  YGRGRYN  MKP++ + +W
Sbjct  198  SNERFVLLSESCIPLYNFTLIYHYIMKSKYSFMGAFDDPGPYGRGRYNGNMKPEVSISQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFE+NR LA+ IV +T FY  F+++C+P+CY DEHY PT L +  G++ ANRS+T
Sbjct  258  RKGAQWFEVNRKLAVNIVEDTTFYKKFEEFCKPACYVDEHYFPTMLTIQSGHLIANRSIT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  A+ITE F+  + SN   C YN   +  C+LFARKF PS LEPL 
Sbjct  318  WVDWSRGGAHPATFGKADITEEFLHRVVSN-HKCLYNNQPSSTCFLFARKFAPSTLEPLL  376

Query  158  KLSLKVMGF  132
            +L+ K +GF
Sbjct  377  QLAHKHLGF  385



>ref|XP_004165595.1| PREDICTED: uncharacterized protein LOC101231487 [Cucumis sativus]
Length=386

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            +NE F+LLSESCIP+++F  +YKYL ES +SF+ S+DD   YGRGRY   M P++ + EW
Sbjct  199  NNEWFILLSESCIPLFNFSVIYKYLKESKYSFVGSFDDLGPYGRGRYRDAMAPEVNITEW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +TKFY  F+++CRP CY DEHY PT L +  G + ANRS+T
Sbjct  259  RKGSQWFEVNRKLAISIVQDTKFYKKFEQFCRPPCYVDEHYFPTMLTIEAGDVIANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++   +ITE  +  I  NG +CSYN G + IC LFARKF PS+L PL 
Sbjct  319  WVDWSRGGPHPATFGRRDITEELLARI-VNGQNCSYNNGTSSICSLFARKFAPSSLRPLL  377

Query  158  KLSLKVMGF  132
             L+L V G+
Sbjct  378  PLALDVFGY  386



>dbj|BAD82090.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ14347.1| hypothetical protein OsJ_04268 [Oryza sativa Japonica Group]
Length=380

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIPV  FP  Y YLT S HSF+E Y    +  RGRY+ RM+PDI L +W
Sbjct  192  SNDRFVLLSESCIPVQSFPVAYGYLTGSRHSFVEVYYHKGKTCRGRYSRRMEPDITLPQW  251

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ R LA+  +++ ++Y +F+++CRPSCYPDEHY+PT++ + HG  N+NR+VT
Sbjct  252  RKGSQWFELRRDLAVAALTDARYYPLFRRHCRPSCYPDEHYLPTFVAMLHGADNSNRTVT  311

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            YVDWS GG HPA+YTA ++T   I SIR +   C YN   T  C+LFARKF   ALEPL 
Sbjct  312  YVDWSRGGAHPATYTAGDVTPELILSIRRSEVPCMYNSRPTTACFLFARKFSADALEPLL  371

Query  158  KLSLKVMGF  132
             +S  VM +
Sbjct  372  NISSTVMQY  380



>ref|NP_001044966.1| Os01g0875800 [Oryza sativa Japonica Group]
 dbj|BAF06880.1| Os01g0875800 [Oryza sativa Japonica Group]
 dbj|BAG97459.1| unnamed protein product [Oryza sativa Japonica Group]
Length=384

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIPV  FP  Y YLT S HSF+E Y    +  RGRY+ RM+PDI L +W
Sbjct  196  SNDRFVLLSESCIPVQSFPVAYGYLTGSRHSFVEVYYHKGKTCRGRYSRRMEPDITLPQW  255

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ R LA+  +++ ++Y +F+++CRPSCYPDEHY+PT++ + HG  N+NR+VT
Sbjct  256  RKGSQWFELRRDLAVAALTDARYYPLFRRHCRPSCYPDEHYLPTFVAMLHGADNSNRTVT  315

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            YVDWS GG HPA+YTA ++T   I SIR +   C YN   T  C+LFARKF   ALEPL 
Sbjct  316  YVDWSRGGAHPATYTAGDVTPELILSIRRSEVPCMYNSRPTTACFLFARKFSADALEPLL  375

Query  158  KLSLKVMGF  132
             +S  VM +
Sbjct  376  NISSTVMQY  384



>ref|XP_002872192.1| hypothetical protein ARALYDRAFT_910666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48451.1| hypothetical protein ARALYDRAFT_910666 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+++F T+Y Y+T+S HSF+ S+DDP+ YGRGRY+  M P++ +++W
Sbjct  199  SNEWFVLLSESCIPLFNFTTIYTYITKSKHSFMGSFDDPSPYGRGRYHGNMAPEVSINQW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +T +Y  FK++C+P+CY DEHY PT L +      ANRSVT
Sbjct  259  RKGSQWFEVNRELAVSIVKDTLYYPKFKQFCKPACYVDEHYFPTMLTIEKPAALANRSVT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++ A +I+E F   +   G +C+YN G T +CYLFARKF PSALEPL 
Sbjct  319  WVDWSRGGAHPATFGAQDISEEFFAWVL-KGDNCTYNGGYTSMCYLFARKFSPSALEPLI  377

Query  158  KLSLKVMGF  132
            +++ K++ F
Sbjct  378  QIAPKILSF  386



>ref|XP_002872191.1| hypothetical protein ARALYDRAFT_351610 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48450.1| hypothetical protein ARALYDRAFT_351610 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+++F T+Y Y+T+S HSF+ S+DDP+ YGRGRY+  M P++ + +W
Sbjct  199  SNEWFVLLSESCIPLFNFTTIYTYITKSKHSFMGSFDDPSPYGRGRYHGNMAPEVSIDQW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +T +Y  FK++C+P+CY DEHY PT L +      ANRSVT
Sbjct  259  RKGSQWFEVNRELAVSIVKDTLYYPKFKQFCKPACYVDEHYFPTMLTIEKPAALANRSVT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++ A +I+E F   +   G +C+YN G T +CYLFARKF PSALEPL 
Sbjct  319  WVDWSRGGAHPATFGAQDISEEFFAWVL-KGDNCTYNGGYTSMCYLFARKFSPSALEPLI  377

Query  158  KLSLKVMGF  132
            +++ K++ F
Sbjct  378  QIAPKILSF  386



>ref|XP_010265065.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
 ref|XP_010265066.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
 ref|XP_010265067.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
Length=411

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLS++CIP+++F TVY YL  ST SF+E+YD+P   GRGRY+ RMKPDIKL +W
Sbjct  223  SNQRFVLLSDACIPLFNFSTVYNYLIGSTKSFVEAYDEPGPVGRGRYSPRMKPDIKLSQW  282

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R LAI I S+ K++++F +YC+PSCY DEHYIPT + L     N+NRS+T
Sbjct  283  RKGSQWFEMDRDLAIEIASDRKYFSLFGRYCKPSCYSDEHYIPTLVSLKFWEKNSNRSLT  342

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +   ++T   ++ +RS G +C YN   T +C LFARKF+P+ L+ L 
Sbjct  343  WVDWSRGGPHPTRFMRTDVTVELLERMRS-GRTCEYNGKTTNVCSLFARKFYPNTLDRLL  401

Query  158  KLSLKVMGF  132
            + + KVM F
Sbjct  402  RFAPKVMKF  410



>ref|XP_008243270.1| PREDICTED: uncharacterized protein LOC103341513 [Prunus mume]
Length=398

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+++F TVY YL  S  SF++ YDDP+  GRGRYN+ M P I L +W
Sbjct  209  SNERFVLLSESCIPLHNFSTVYSYLVHSRESFVQVYDDPSSVGRGRYNSHMYPKISLSQW  268

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R  AI IVS+ K++  F+KYCR SCY DEHY+PT+  ++ G  N+NRS+T
Sbjct  269  RKGSQWFEMHRRHAIDIVSDKKYFPAFQKYCRGSCYADEHYLPTFANINFGAKNSNRSLT  328

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +T  ++T   +  +R NGT+C YN   T +C+LFARKF P  LE L 
Sbjct  329  WVDWSRGGPHPAKFTRTDVTVEVLSRLR-NGTACVYNGKSTNVCFLFARKFGPDTLERLL  387

Query  158  KLSLKVMGF  132
            + + K+M F
Sbjct  388  RFAPKLMRF  396



>ref|XP_007222675.1| hypothetical protein PRUPE_ppa008602mg [Prunus persica]
 gb|EMJ23874.1| hypothetical protein PRUPE_ppa008602mg [Prunus persica]
Length=325

 Score =   233 bits (594),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+L+SESCIP+Y+F  +Y YL +S +SFI ++DDP  +GRGRYN  M P++ + +W
Sbjct  138  SNEWFILVSESCIPLYNFSVIYHYLMKSKYSFIGAFDDPGPFGRGRYNNNMAPEVNITQW  197

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +T FY  F+K+CRP+CY DEHY PT L +  G   ANRS+T
Sbjct  198  RKGSQWFEVNRKLAISIVEDTTFYQKFEKFCRPACYVDEHYFPTMLTIQAGNSLANRSIT  257

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  A+ITE F + +   G  C+YN   + IC+LF RKF PSA+EPL 
Sbjct  258  WVDWSRGGPHPATFGRADITEEFFKRML-EGHRCTYNDRNSSICFLFGRKFAPSAMEPLL  316

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  317  HLAPKFLGF  325



>gb|EAY76682.1| hypothetical protein OsI_04637 [Oryza sativa Indica Group]
Length=380

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIPV  FP  Y YLT S HSF+E Y    +  RGRY+ RM+PDI L +W
Sbjct  192  SNDRFVLLSESCIPVQSFPVAYGYLTGSRHSFVEVYYHKGKTCRGRYSRRMEPDITLPQW  251

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ R LA+  +++ ++Y +F+++CRPSCYPDEHY+PT++ + HG  N+NR+VT
Sbjct  252  RKGSQWFELRRDLAVASLTDARYYPLFRRHCRPSCYPDEHYLPTFVAMLHGADNSNRTVT  311

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            YVDWS GG HPA+YTA ++T   I SIR +   C YN   T  C+LFARKF   ALEPL 
Sbjct  312  YVDWSRGGAHPATYTAGDVTPELILSIRRSEVPCMYNSRPTTACFLFARKFSADALEPLL  371

Query  158  KLSLKVMGF  132
             +S  VM +
Sbjct  372  NISSTVMQY  380



>ref|XP_004959909.1| PREDICTED: uncharacterized protein LOC101775358 [Setaria italica]
Length=410

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVL+SESC+PV++F TVY+YL  S HS++ESY+       GRYN  M P++   +W
Sbjct  222  SNQRFVLVSESCVPVFNFRTVYEYLVNSAHSYVESYNIDVPQCAGRYNPAMAPEVMEEQW  281

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFE++R LA+ +V++ ++YA+F+++C PSCYPDEHYIPTYL L HG  NANR+VT
Sbjct  282  RKGSEWFELSRELAVDVVADQRYYALFRRHCTPSCYPDEHYIPTYLHLRHGARNANRTVT  341

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSA  174
            +VDWS GGPHPA +  A  T GF+ +IR+NGT C YN   T +CYLFARKF PSA
Sbjct  342  WVDWSRGGPHPARFGRAATTAGFVAAIRNNGTRCLYNGKPTTVCYLFARKFAPSA  396



>ref|XP_007222895.1| hypothetical protein PRUPE_ppa006723mg [Prunus persica]
 gb|EMJ24094.1| hypothetical protein PRUPE_ppa006723mg [Prunus persica]
Length=398

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F TVY YL  S  SF++ YDDP+  GRGRYN+ M P I L +W
Sbjct  209  SNQRFVLLSESCIPLHNFSTVYSYLVRSRESFVQVYDDPSSVGRGRYNSHMYPKISLSQW  268

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R  AI IVS+ K++  F+KYCR SCY DEHY+PT+  ++ G  N+NRS+T
Sbjct  269  RKGSQWFEMDRRHAIEIVSDKKYFPAFQKYCRGSCYADEHYLPTFANINFGAKNSNRSLT  328

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +T  ++T   +  +R NGT+C YN   T +C+LFARKF P  LE L 
Sbjct  329  WVDWSRGGPHPAKFTRTDVTVELLSRLR-NGTACVYNGKSTNVCFLFARKFGPDTLERLL  387

Query  158  KLSLKVMGF  132
            + + K+M F
Sbjct  388  RFAPKLMRF  396



>ref|XP_008339646.1| PREDICTED: uncharacterized protein LOC103402673 [Malus domestica]
Length=400

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+++F TVY Y+  S  +F++ YDDP+  GRGRY+  M P + L++W
Sbjct  211  SNERFVLLSESCIPLHNFSTVYNYIIRSNETFVQVYDDPSSVGRGRYSFNMYPQVWLNQW  270

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R+LAI +VS+ K++ +F+ YC+ SCY DEHY+PT++ +  G  N+NR++T
Sbjct  271  RKGSQWFEMDRSLAIEVVSDRKYFPVFQSYCKGSCYADEHYLPTFVNMKFGKKNSNRTLT  330

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +T  ++T   + S+R NGTSC YN   + +CYLFARKF P  LE L 
Sbjct  331  WVDWSRGGPHPAKFTRTDVTIDVLNSLR-NGTSCIYNGRVSNVCYLFARKFGPETLERLL  389

Query  158  KLSLKVMGF  132
            K + K+MGF
Sbjct  390  KFAPKLMGF  398



>ref|XP_009357077.1| PREDICTED: uncharacterized protein LOC103947833 [Pyrus x bretschneideri]
Length=400

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSE+CIP+++F TVY Y+  S  +F++ YDDP+  GRGRY+  M P + L++W
Sbjct  211  SNERFVLLSEACIPLHNFSTVYNYVIRSNETFVQVYDDPSSVGRGRYSFNMYPQVWLNQW  270

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R+LAI +VS+ K++ +F+ YC+ SCY DEHY+PT++ +  G  N+NRS+T
Sbjct  271  RKGSQWFEMDRSLAIEVVSDRKYFPVFQSYCKGSCYADEHYLPTFVNMKFGKKNSNRSLT  330

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +T  ++T   + S+R NGTSC YN   + +CYLFARKF P  LE L 
Sbjct  331  WVDWSRGGPHPAKFTRTDVTVDVLNSLR-NGTSCIYNGRVSNVCYLFARKFGPETLERLL  389

Query  158  KLSLKVMGF  132
            K + K+MGF
Sbjct  390  KFAPKLMGF  398



>emb|CBI26990.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSE+CIP+++F T+YKYL  S HSF+ S+DDP   GRGRYN RM P + L +W
Sbjct  107  SNERFVLLSETCIPLFNFTTIYKYLINSNHSFVSSFDDPRHIGRGRYNKRMFPTVTLPDW  166

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI IVS+  +Y +F+++CRP CY DEHY+ T +      +N+NRS+T
Sbjct  167  RKGSQWFEVHRKLAIEIVSDVTYYPIFQEHCRPPCYMDEHYLATLVNKLRPDLNSNRSIT  226

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HP  +   +++E F+   R +G +CSYN G + IC+LFARKF PS LEPL 
Sbjct  227  WVDWSRGGSHPTKFVRKDVSEAFLNQAR-HGFNCSYNSGLSSICFLFARKFHPSTLEPLL  285

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  286  RIAPSLLGF  294



>gb|KFK25431.1| hypothetical protein AALP_AA8G114400 [Arabis alpina]
Length=387

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVL+SESCIP+++F T+Y YL +S HSF+ ++DD   +GRGRY+  M+P++ + +W
Sbjct  200  SNERFVLVSESCIPLFNFTTIYSYLIKSKHSFMGAFDDLGPFGRGRYSQNMEPEVPITKW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  260  RKGSQWFEINRDLAATIVEDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPAVLANRSLT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++ITE F + I  +G +C YN G T +CYLFARKF PS LEPL 
Sbjct  320  WVDWSRGGPHPATFGRSDITEKFFERI-FDGRNCPYNDGNTSMCYLFARKFAPSTLEPLL  378

Query  158  KLSLKVMGF  132
             ++ KV+GF
Sbjct  379  HIAHKVLGF  387



>emb|CAN70606.1| hypothetical protein VITISV_040196 [Vitis vinifera]
Length=385

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+F  +Y Y+ +S +SF+ ++DDP  YGRGRYN  MKP++ + +W
Sbjct  198  SNERFVLLSESCIPLYNFTLIYHYIMKSKYSFMGAFDDPGPYGRGRYNGNMKPEVSISQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFE+NR LA+ IV +T FY  F+++C+P+CY DEHY PT L +  G + ANRS+T
Sbjct  258  RKGAQWFEVNRKLAVNIVEDTTFYKKFEEFCKPACYVDEHYFPTMLTIQSGNLIANRSIT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  A+ITE F+  + SN   C YN   +  C+LFARKF PS LEPL 
Sbjct  318  WVDWSRGGAHPATFGKADITEEFLHRVVSN-HKCLYNNQPSSTCFLFARKFAPSTLEPLL  376

Query  158  KLSLKVMGF  132
            +L+ K +GF
Sbjct  377  QLAHKHLGF  385



>ref|NP_001173628.1| Os03g0731050 [Oryza sativa Japonica Group]
 dbj|BAH92356.1| Os03g0731050, partial [Oryza sativa Japonica Group]
Length=240

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+++F T Y+YL  S+ SF+ ++DDP  YGRGRYN  M P+++L +W
Sbjct  52   SNEWFVLVSESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELTQW  111

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRS+T
Sbjct  112  RKGSQWFEVNRELAIEIVRDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSIT  171

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +ITE F++ ++  G +C YN   + +C+LFARKF PSALEPL 
Sbjct  172  WVDWSRGGAHPATFGRGDITEEFLRRVQE-GRTCLYNGQNSTMCFLFARKFAPSALEPLL  230

Query  158  KLSLKVMGF  132
            +L+  V+GF
Sbjct  231  ELAPTVLGF  239



>ref|XP_008806040.1| PREDICTED: uncharacterized protein LOC103718829 [Phoenix dactylifera]
Length=397

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 143/188 (76%), Gaps = 1/188 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RF+LLSESCIP+++F T+Y YL  ST +++ SYDDP   GRGRYN RMKP +KL +W
Sbjct  208  SNQRFILLSESCIPLFNFSTIYSYLINSTKTYVSSYDDPGPNGRGRYNIRMKPHVKLQQW  267

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI I+S+ K++ +FK+YC+PSCY DEHY+ T++ +   + NANRS+T
Sbjct  268  RKGSQWFEVDRNLAIEIISDDKYFPVFKRYCKPSCYVDEHYLSTFVSMRFWWRNANRSLT  327

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS  GPHPA +   ++T   ++ +R NG++C YN   T IC+LFARKF P++L  L 
Sbjct  328  WVDWSKRGPHPARFGRLDVTIELLKGMR-NGSTCDYNGRTTSICFLFARKFLPNSLTRLM  386

Query  158  KLSLKVMG  135
            + + KVMG
Sbjct  387  RFAPKVMG  394



>emb|CBI33634.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I + +W
Sbjct  107  SNQRFVLLSESCIPLFNFTTTYNYLMASNLSFLGSFDDPRKPGRGRYNPQMWPAINISDW  166

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ I+S+ K+Y +F +YC P CY DEHYIPT + + +  MN+NRS+T
Sbjct  167  RKGSQWFEVHRELAVQIISDRKYYTIFGEYCHPPCYMDEHYIPTLVNMLYVKMNSNRSIT  226

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP+ +   +IT+ F+  IR  G+ C YN   T IC+LFARKF P+ALEPL 
Sbjct  227  WVDWSRGGPHPSKFGWGDITDEFLNKIRY-GSDCIYNGNTTNICFLFARKFLPTALEPLL  285

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  286  RIAPLLLGF  294



>ref|XP_010099264.1| hypothetical protein L484_015454 [Morus notabilis]
 gb|EXB77528.1| hypothetical protein L484_015454 [Morus notabilis]
Length=423

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSE+CIP+Y+F T+Y YL  +T + + +YD+P   GRGRYN  M PDI L +W
Sbjct  233  SNERFILLSEACIPLYNFKTIYNYLINATKNHVMAYDEPGVVGRGRYNYHMYPDISLKQW  292

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEMNR LAI +VS++K++ +F+KYCR +CY DEHY+PT + +     N+NRS+T
Sbjct  293  RKGSQWFEMNRELAIEVVSDSKYFPIFQKYCRGNCYSDEHYLPTLVSIKFWEGNSNRSLT  352

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +   ++T   ++S+R N T C+YN   T +CYLFARKF PS ++ L 
Sbjct  353  WVDWSKGGPHPARFWRTDVTLELLRSMRRNNTGCAYNENSTNLCYLFARKFLPSTVDRLL  412

Query  158  KLSLKVMGF  132
            K + K+M F
Sbjct  413  KFAPKIMHF  421



>ref|XP_010318628.1| PREDICTED: uncharacterized protein LOC101267221 isoform X2 [Solanum 
lycopersicum]
Length=282

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+YDF T+Y Y+  S ++F+ESYD  +  GRGRYN +MKP + L +W
Sbjct  94   SNERFVLLSESCIPLYDFTTIYDYIINSANTFMESYDLISPVGRGRYNKKMKPLVTLAQW  153

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R +AI I+S+ K+  +FK++CRP+CY DEHY+PT++ + + + N NR++T
Sbjct  154  RKGSQWFEVDREIAIDIISDQKYSNLFKRFCRPACYSDEHYLPTFVTMKYWWKNENRTLT  213

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDW+ GGPHP  +   ++TE  +  +R NGT C YN   + +CYLFARKF PS L+ L 
Sbjct  214  WVDWAKGGPHPTKFIRPDVTEDLLYGMR-NGTKCEYNGQPSNMCYLFARKFLPSTLDRLL  272

Query  158  KLSLKVMGF  132
            + + K+M F
Sbjct  273  RFAPKIMKF  281



>ref|XP_009763003.1| PREDICTED: uncharacterized protein LOC104214963 isoform X1 [Nicotiana 
sylvestris]
Length=409

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+F T+Y Y+  ST +F+ESYD P+  GRGRYN +M+P I L +W
Sbjct  221  SNERFVLLSESCIPLYNFTTIYNYIMNSTKTFMESYDLPSPVGRGRYNKKMQPWITLDQW  280

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R +AI I+++ K++ +FK+YC+P+CY DEHY+PT++ + + + N NR++T
Sbjct  281  RKGSQWFEVDREIAIDIITDQKYFQLFKRYCKPACYSDEHYLPTFVTMRYWWKNGNRTLT  340

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDW+ GGPHP  +   ++T   +  +R NGT C YN   T +CYLFARKF PS L+ L 
Sbjct  341  WVDWTKGGPHPTRFIRTDVTADLLNRMR-NGTQCEYNGDPTNMCYLFARKFLPSTLDRLL  399

Query  158  KLSLKVMGF  132
            + + K+M F
Sbjct  400  RFAPKIMKF  408



>ref|XP_010941940.1| PREDICTED: uncharacterized protein LOC105060052 [Elaeis guineensis]
Length=384

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+Y+F  +Y+YL  S +SF+ S+DDP  YGRGRYN RM P+I + +W
Sbjct  196  SNEWFVLLSESCIPLYNFSIIYQYLMRSRYSFVGSFDDPGPYGRGRYNLRMAPEIDITQW  255

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFE+NR LAI IV +TK+Y  FK++C+PSCY DEHY PT L +   ++ ANR++T
Sbjct  256  RKGAQWFEVNRKLAIDIVRDTKYYPKFKEFCKPSCYVDEHYFPTMLTIESPHLIANRTLT  315

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +ITE F++ I   G SC YN   + +C+LFARKF PSA+ PL 
Sbjct  316  WVDWSRGGAHPATFGKGDITEAFLKKI-FEGKSCLYNDQPSSVCFLFARKFAPSAMAPLL  374

Query  158  KLSLKVMGF  132
            + +  ++GF
Sbjct  375  QFAPSLLGF  383



>ref|XP_009131226.1| PREDICTED: uncharacterized protein LOC103855927 [Brassica rapa]
Length=386

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+Y+F T+Y YL++S HSFI + DDP  +GRGRYN +M+P++ + +W
Sbjct  199  SNEWFVLVSESCIPLYNFTTIYTYLSQSKHSFIGAVDDPGPFGRGRYNEKMEPEVPITKW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG QWFE+ R LA  IV +T ++  F+++CRP+CY DEHY PT L +      ANRSVT
Sbjct  259  RKGPQWFEVGRDLAATIVRDTLYHQKFREFCRPACYSDEHYFPTMLTIEKPTALANRSVT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GGPHPA++  ++ITE F   I  +GT+CSYN   T +CYLFARKF PSALEPL 
Sbjct  319  WTDWSRGGPHPATFGRSDITEEFFGKI-FDGTNCSYNGRNTSMCYLFARKFAPSALEPLL  377

Query  158  KLSLKVMGF  132
             ++ K+MGF
Sbjct  378  HIAPKIMGF  386



>ref|XP_004245124.1| PREDICTED: uncharacterized protein LOC101267146 [Solanum lycopersicum]
Length=388

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+Y+F  +YK+++ S HSF+ ++DDP  YGRGRY+  M P++ + +W
Sbjct  201  SNEWFVLLSESCIPLYNFNVIYKHISRSKHSFVGAFDDPGPYGRGRYDENMLPEVNVSQW  260

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R LA+ IV +T FY  F ++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  261  RKGSQWFEMSRKLALFIVEDTIFYPKFAEFCRPACYVDEHYFPTMLTIEASNLLANRSIT  320

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  ++ITE F++ +   G +C+YN   T ICYLFARKF PSALEPL 
Sbjct  321  WVDWSRGGAHPATFGKSDITEEFMKRML-QGQNCTYNNRNTSICYLFARKFAPSALEPLF  379

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  380  LLAPKYLGF  388



>ref|XP_006442617.1| hypothetical protein CICLE_v10020320mg [Citrus clementina]
 gb|ESR55857.1| hypothetical protein CICLE_v10020320mg [Citrus clementina]
Length=419

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            +N+RFVLLSESCIP+++F T+Y YL  S+ +FIE+YD P   GRGRYN  M+P I+L +W
Sbjct  231  TNQRFVLLSESCIPLFNFSTIYNYLINSSKAFIEAYDLPGPVGRGRYNRPMRPVIRLEQW  290

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+RALA+ ++S+ K++  FK++C+ SCY DEHY+PT++ +     N+NRS+T
Sbjct  291  RKGSQWFEMDRALALEVISDKKYFVTFKRHCKASCYADEHYLPTFVSVKFWKRNSNRSLT  350

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +   ++T  F++ +RS G+ C YN   T IC+LFARKF P+AL+ L 
Sbjct  351  WVDWSKGGPHPAKFQRRDVTIEFLKRLRS-GSHCEYNGKSTNICFLFARKFLPNALDRLL  409

Query  158  KLSLKVMGF  132
            + + KVMGF
Sbjct  410  RFAPKVMGF  418



>dbj|BAB86235.1| P0648C09.24 [Oryza sativa Japonica Group]
Length=481

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 136/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIPV  FP  Y YLT S HSF+E Y    +  RGRY+ RM+PDI L +W
Sbjct  192  SNDRFVLLSESCIPVQSFPVAYGYLTGSRHSFVEVYYHKGKTCRGRYSRRMEPDITLPQW  251

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+ R LA+  +++ ++Y +F+++CRPSCYPDEHY+PT++ + HG  N+NR+VT
Sbjct  252  RKGSQWFELRRDLAVAALTDARYYPLFRRHCRPSCYPDEHYLPTFVAMLHGADNSNRTVT  311

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            YVDWS GG HPA+YTA ++T   I SIR +   C YN   T  C+LFARKF   ALEPL 
Sbjct  312  YVDWSRGGAHPATYTAGDVTPELILSIRRSEVPCMYNSRPTTACFLFARKFSADALEPLL  371

Query  158  KLSLKVM  138
             +S  VM
Sbjct  372  NISSTVM  378



>ref|XP_010097098.1| hypothetical protein L484_019537 [Morus notabilis]
 gb|EXB66899.1| hypothetical protein L484_019537 [Morus notabilis]
Length=387

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+F  +Y Y+++S  SF+ ++DDP  YGRGRYN  M P++ +  W
Sbjct  200  SNERFVLLSESCIPLYNFSIIYHYISKSKFSFMGAFDDPGPYGRGRYNDNMLPEVNISRW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  I+ +T FY  F+K+CRP+CY DEHY PT L +    + ANRS+T
Sbjct  260  RKGSQWFEVNRKLATYIIGDTTFYPKFEKFCRPACYVDEHYFPTMLTIEAANLLANRSIT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +IT+ F + +   GT C+YN   + IC+LFARKF PSALEPL 
Sbjct  320  WVDWSRGGAHPATFGRPDITDEFFKRV-FEGTRCTYNNRNSSICFLFARKFAPSALEPLL  378

Query  158  KLSLKVMGF  132
            ++S KV+G+
Sbjct  379  RISKKVLGY  387



>emb|CDM85189.1| unnamed protein product [Triticum aestivum]
Length=385

 Score =   233 bits (593),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 138/193 (72%), Gaps = 4/193 (2%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP++ F  VY YL  S HSF+E Y   T+  +GRY+ RM P I L +W
Sbjct  193  SNERFVLLSESCIPLHSFRAVYDYLIGSRHSFVEVYFQQTKQCQGRYSRRMAPAITLQQW  252

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI ++++TK+Y +F+++CRPSCYPDEHY+PT + + HG  NANR+VT
Sbjct  253  RKGSQWFELSRDLAISVLADTKYYPLFRRHCRPSCYPDEHYLPTTVSMLHGARNANRTVT  312

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTS----CSYNRGKTQICYLFARKFFPSAL  171
            YVDWS GG HPA +TA N+T   IQ IR         C YN+  T +C+LFARKF P  L
Sbjct  313  YVDWSKGGAHPAKHTAENVTAAAIQGIRRRRWRNDRPCYYNQRPTSMCFLFARKFAPDTL  372

Query  170  EPLEKLSLKVMGF  132
             PL  +S  VMG+
Sbjct  373  GPLLNMSSAVMGY  385



>gb|KJB18563.1| hypothetical protein B456_003G060300 [Gossypium raimondii]
Length=383

 Score =   233 bits (593),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+Y+F  +Y Y++ S HSF+ESYDDP  YGRGRY++RM+P++ L +W
Sbjct  196  SNEWFILLSESCIPLYNFSVIYHYISRSNHSFMESYDDPGPYGRGRYDSRMEPEVTLGQW  255

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI I+ + K+Y  FK++C+P+CY DEHY  T L +   ++ ANR++T
Sbjct  256  RKGSQWFEVNRMLAINIIEDNKYYPKFKEFCQPACYVDEHYFTTMLTIQVPHLLANRTLT  315

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GG HPA++   ++TE F Q I   G +C YN   T +C+LFARKF P+AL+PL 
Sbjct  316  WTDWSRGGAHPATFGKDDMTEAFFQKI-FEGQACLYNGQPTSLCFLFARKFAPNALDPLL  374

Query  158  KLSLKVMGF  132
            +L+ KV GF
Sbjct  375  ELAPKVFGF  383



>ref|XP_009624653.1| PREDICTED: uncharacterized protein LOC104115679 [Nicotiana tomentosiformis]
Length=408

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+Y+F T+Y Y+  ST +F+ESYD P+  GRGRYN +M+P I L +W
Sbjct  220  SNERFVLLSESCIPLYNFTTIYNYIMNSTKTFMESYDLPSPVGRGRYNKKMRPWITLDQW  279

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R +AI I+S+ K++ +FK+YC+P+CY DEHY+PT   + + + N NR++T
Sbjct  280  RKGSQWFEVDREMAIDIISDQKYFQLFKRYCKPACYSDEHYLPTVATMRYWWKNGNRTLT  339

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +    +T   +  +R NGT C YN   T +CYLFARKF PS L+ L 
Sbjct  340  WVDWSKGGPHPTRFIRTEVTADLLNRMR-NGTKCEYNGEPTNMCYLFARKFLPSTLDRLL  398

Query  158  KLSLKVMGF  132
            + + K+M F
Sbjct  399  RFAPKIMKF  407



>ref|XP_004291015.1| PREDICTED: uncharacterized protein LOC101301742 [Fragaria vesca 
subsp. vesca]
Length=389

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+Y+F  VY+Y+ +S +S++ ++DD   +GRGRYN  M P++ + +W
Sbjct  202  SNEWFILLSESCIPLYNFTVVYEYMRKSKYSYMGAFDDHGPFGRGRYNDNMAPEVNITQW  261

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +TKFY  FK++CRP+CY DEHY PT L +  G M ANRS+T
Sbjct  262  RKGSQWFEVNRKLAITIVEDTKFYPKFKEFCRPACYVDEHYFPTMLTIQAGSMIANRSIT  321

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++   +ITE F++ +  +   C+YN   + +C+LFARKF PS LEPL 
Sbjct  322  WVDWSRGGPHPATFGRGDITEDFMKRMLGSH-RCTYNNQNSTMCFLFARKFAPSTLEPLL  380

Query  158  KLSLKVMGF  132
            +L+ K +GF
Sbjct  381  RLAPKFLGF  389



>ref|XP_009361651.1| PREDICTED: uncharacterized protein LOC103951891 [Pyrus x bretschneideri]
Length=389

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+Y+F  V++YL +S +S++ ++DDP  +GRGRYN  M P++ + +W
Sbjct  202  SNEWFILLSESCIPLYNFSVVHRYLMKSKYSYVGAFDDPGPHGRGRYNDNMAPEVNISDW  261

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +TK+Y  FK++CRP+CY DEHY PT L +  G   ANRS+T
Sbjct  262  RKGSQWFEVNRKLAISIVEDTKYYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANRSIT  321

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  A+ITE F++ I   G  C YN   + IC+LF RKF PSA+EPL 
Sbjct  322  WVDWSRGGPHPATFGRADITEEFLKRIFW-GQRCPYNGQNSTICFLFGRKFAPSAMEPLL  380

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  381  HLAPKFLGF  389



>ref|XP_011081713.1| PREDICTED: uncharacterized protein LOC105164695 [Sesamum indicum]
 ref|XP_011081714.1| PREDICTED: uncharacterized protein LOC105164695 [Sesamum indicum]
Length=385

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+Y+F  VY Y+T S +SFI ++DDP  YGRGRYN  M P++ + +W
Sbjct  198  SNEWFVLLSESCIPLYNFSMVYNYITGSKYSFIGAFDDPGPYGRGRYNDNMLPEVNITDW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+N+ LA+ IV +TKFY  F ++C+P+CY DEHY PT L +    + ANRS+T
Sbjct  258  RKGSQWFEINKKLALYIVEDTKFYPKFSEFCKPACYVDEHYFPTMLTIQAATLLANRSIT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  ++ITE F + I  +G SC YN   + ICYLFARKF PSALE L 
Sbjct  318  WVDWSRGGAHPATFGGSDITEEFFKKI-FDGRSCLYNNKPSSICYLFARKFSPSALEALF  376

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  377  LLAPKFLGF  385



>ref|XP_008812373.1| PREDICTED: uncharacterized protein LOC103723273 [Phoenix dactylifera]
Length=406

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RF+LLSESCIP+++F T+Y YL  ST +++ S+DD    GRGRYN RMKP +KL EW
Sbjct  217  SNQRFILLSESCIPLFNFSTIYSYLINSTKTYVSSFDDRGPNGRGRYNIRMKPQVKLQEW  276

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQW E++R LAI I+S+ K++ +FKKYC+ SCY DEHY+PT++ +   + N+NRS+T
Sbjct  277  RKGSQWLEVDRDLAIEIISDEKYFPVFKKYCKRSCYVDEHYLPTFVSMRFWWSNSNRSLT  336

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +   ++T   ++ +R NG++C YN   T +C+LFARKF P++L  L 
Sbjct  337  WVDWSKGGPHPARFGRLDVTIELLERMR-NGSTCKYNGRTTNVCFLFARKFLPNSLTRLM  395

Query  158  KLSLKVMGF  132
            + + KVMGF
Sbjct  396  RFAPKVMGF  404



>ref|XP_009772023.1| PREDICTED: uncharacterized protein LOC104222493 [Nicotiana sylvestris]
Length=388

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+Y+F  +YKY+++S HSFI ++DDP  YGRGRY+  M P++ + +W
Sbjct  201  SNEWFVLLSESCIPLYNFNVIYKYISQSKHSFIGAFDDPGPYGRGRYDENMLPEVNITDW  260

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +TKFY  F ++C+P+CY DEHY PT L +    + ANRS+T
Sbjct  261  RKGSQWFEINRKLALYIVEDTKFYPKFAEFCKPACYVDEHYFPTMLTIQASNLLANRSIT  320

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  ++ITE F++ + + G +C+YN     +C+LFARKF PSALEPL 
Sbjct  321  WVDWSRGGAHPATFGKSDITEEFMKRMLAGG-NCTYNERNISMCFLFARKFAPSALEPLF  379

Query  158  KLSLKVMGF  132
             L+   +GF
Sbjct  380  LLAPTYLGF  388



>ref|XP_008220437.1| PREDICTED: uncharacterized protein LOC103320525 [Prunus mume]
Length=388

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+L+SESCIP+Y+F  +Y YL +S +SFI ++DDP  +GRGRYN  M P++ + +W
Sbjct  201  SNEWFILVSESCIPLYNFSVIYHYLMKSKYSFIGAFDDPGPFGRGRYNNNMAPEVNITQW  260

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +T FY  F+K+CRP+CY DEHY PT L +  G   ANRS+T
Sbjct  261  RKGSQWFEVNRKLAISIVEDTTFYPKFEKFCRPACYVDEHYFPTMLTIQAGNSLANRSIT  320

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  A+I+E F + +   G  C+YN   + IC+LF RKF PSA+EPL 
Sbjct  321  WVDWSRGGPHPATFGRADISEEFFKRML-EGHRCTYNDRNSSICFLFGRKFAPSAMEPLL  379

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  380  HLAPKFLGF  388



>ref|XP_004981886.1| PREDICTED: uncharacterized protein LOC101780921 [Setaria italica]
Length=389

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP++DF T YKY   S+ SF+ ++DDP  YGRGRYN  M P+++L +W
Sbjct  201  SNEWFVLVSESCIPIFDFNTTYKYFQNSSQSFLMAFDDPGPYGRGRYNWNMTPEVELDQW  260

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ IV +T +Y  FK++CRP CY DEHY PT L +   +  ANRSVT
Sbjct  261  RKGSQWFEVDRELAVAIVKDTVYYPKFKEFCRPHCYVDEHYFPTMLTIEAPHSLANRSVT  320

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +I+E F++ +R  G +C YN   + +C+LFARKF PSALEPL 
Sbjct  321  WVDWSRGGAHPATFGRGDISEEFLRRVR-EGRTCLYNNQNSTMCFLFARKFSPSALEPLL  379

Query  158  KLSLKVMGF  132
            +L+  V+GF
Sbjct  380  ELAPTVLGF  388



>ref|XP_002280674.1| PREDICTED: uncharacterized protein LOC100244641 [Vitis vinifera]
Length=414

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I + +W
Sbjct  225  SNQRFVLLSESCIPLFNFTTTYNYLMASNLSFLGSFDDPRKPGRGRYNPQMWPAINISDW  284

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ I+S+ K+Y +F +YC P CY DEHYIPT + + +  MN+NRS+T
Sbjct  285  RKGSQWFEVHRELAVQIISDRKYYTIFGEYCHPPCYMDEHYIPTLVNMLYVKMNSNRSIT  344

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP+ +   +IT+ F+  IR  G+ C YN   T IC+LFARKF P+ALEPL 
Sbjct  345  WVDWSRGGPHPSKFGWGDITDEFLNKIRY-GSDCIYNGNTTNICFLFARKFLPTALEPLL  403

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  404  RIAPLLLGF  412



>ref|XP_008393663.1| PREDICTED: uncharacterized protein LOC103455840 isoform X1 [Malus 
domestica]
 ref|XP_008393664.1| PREDICTED: uncharacterized protein LOC103455840 isoform X1 [Malus 
domestica]
Length=388

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F LLSESCIP+Y+F  V+ YL +S +S++ ++DDP  +GRGRYN  M P++K+  W
Sbjct  201  SNEWFXLLSESCIPLYNFSVVHHYLMKSKYSYVGAFDDPGPHGRGRYNYNMAPEVKISNW  260

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +TK+Y  FK++CRP+CY DEHY PT L +  G   ANRS+T
Sbjct  261  RKGSQWFEVNRKLAVSIVEDTKYYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANRSIT  320

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  A+ITE F++ I   G  C+YN   + IC+LF RKF PSA+EPL 
Sbjct  321  WVDWSRGGPHPATFGRADITEEFLKRI-FRGQRCTYNGQNSTICFLFGRKFAPSAMEPLL  379

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  380  HLAPKFLGF  388



>ref|XP_011019540.1| PREDICTED: uncharacterized protein LOC105122240 [Populus euphratica]
Length=385

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVL+SESCIP+Y+F  +Y Y+  S HSFI ++DD   YGRGRYN  M P++ + +W
Sbjct  198  SNERFVLVSESCIPLYNFSVIYDYIMRSKHSFIGAFDDHGPYGRGRYNENMAPEVNITQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ +V + ++Y  F+++CRPSCY DEHY PT L +    + ANR++T
Sbjct  258  RKGSQWFEINRKLAVSVVEDARYYPKFEEFCRPSCYVDEHYFPTMLTIEAAPLLANRTLT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  A+ITE F + IR +   C YN   + +C+LFARKF PSALEPL 
Sbjct  318  WVDWSRGGAHPATFGRADITEEFFKKIRED-KHCIYNNQSSPVCFLFARKFAPSALEPLL  376

Query  158  KLSLKVMGF  132
            ++S  V+GF
Sbjct  377  QVSQNVLGF  385



>gb|ABK28713.1| unknown [Arabidopsis thaliana]
Length=388

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+++F T+Y Y+T+S HSF+ S+DDP  YGRGRY+  M P++ + +W
Sbjct  200  SNEWFVLLSESCIPLFNFTTIYTYMTKSEHSFMGSFDDPGAYGRGRYHGNMAPEVFIDQW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +T +Y  FK++C+P+CY DEHY PT L +      ANRSVT
Sbjct  260  RKGSQWFEINRELAVSIVKDTLYYPKFKEFCQPACYVDEHYFPTMLTIEKPAALANRSVT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++ A +I E F   I   G +C+YN G T +CYLFARKF PSALEPL 
Sbjct  320  WVDWSRGGAHPATFGAQDINEEFFARIL-KGDNCTYNGGYTSMCYLFARKFSPSALEPLV  378

Query  158  KLSLKVM  138
            +++ K++
Sbjct  379  QIAPKLL  385



>ref|NP_197969.2| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|ABE66181.1| hypothetical protein At5g25970 [Arabidopsis thaliana]
 gb|AED93506.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38604.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=387

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+++F T+Y Y+T+S HSF+ S+DDP  YGRGRY+  M P++ + +W
Sbjct  200  SNEWFVLLSESCIPLFNFTTIYTYMTKSEHSFMGSFDDPGAYGRGRYHGNMAPEVFIDQW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +T +Y  FK++C+P+CY DEHY PT L +      ANRSVT
Sbjct  260  RKGSQWFEINRELAVSIVKDTLYYPKFKEFCQPACYVDEHYFPTMLTIEKPAALANRSVT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++ A +I E F   I   G +C+YN G T +CYLFARKF PSALEPL 
Sbjct  320  WVDWSRGGAHPATFGAQDINEEFFARIL-KGDNCTYNGGYTSMCYLFARKFSPSALEPLV  378

Query  158  KLSLKVM  138
            +++ K++
Sbjct  379  QIAPKLL  385



>gb|EYU20381.1| hypothetical protein MIMGU_mgv1a0226482mg, partial [Erythranthe 
guttata]
Length=212

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+++F T++ Y+T S +SF  ++DDP  +GRGRYN  M P++ + +W
Sbjct  25   SNERFVLLSESCIPLHNFTTIHSYITGSKYSFTGAFDDPGPFGRGRYNDHMLPEVDIKDW  84

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ ++ + KFY  F+++CRP+CY DEHY PT L +  G + ANRSVT
Sbjct  85   RKGSQWFEVSRQLALYLIQDKKFYPKFEQFCRPACYVDEHYFPTMLTVQAGNLLANRSVT  144

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  ++ITE F + I   G  C YN   + +C LFARKF PSALEPL 
Sbjct  145  WVDWSRGGAHPATFGRSDITEDFFKRI-FEGEKCLYNDQPSSVCSLFARKFSPSALEPLF  203

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  204  FLAPKFLGF  212



>ref|XP_008393665.1| PREDICTED: uncharacterized protein LOC103455840 isoform X2 [Malus 
domestica]
Length=387

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F LLSESCIP+Y+F  V+ YL +S +S++ ++DDP  +GRGRYN  M P++K+  W
Sbjct  200  SNEWFXLLSESCIPLYNFSVVHHYLMKSKYSYVGAFDDPGPHGRGRYNYNMAPEVKISNW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +TK+Y  FK++CRP+CY DEHY PT L +  G   ANRS+T
Sbjct  260  RKGSQWFEVNRKLAVSIVEDTKYYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANRSIT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  A+ITE F++ I   G  C+YN   + IC+LF RKF PSA+EPL 
Sbjct  320  WVDWSRGGPHPATFGRADITEEFLKRI-FRGQRCTYNGQNSTICFLFGRKFAPSAMEPLL  378

Query  158  KLSLKVMGF  132
             L+ K +GF
Sbjct  379  HLAPKFLGF  387



>ref|XP_010049161.1| PREDICTED: uncharacterized protein LOC104437817 [Eucalyptus grandis]
 gb|KCW81640.1| hypothetical protein EUGRSUZ_C03002 [Eucalyptus grandis]
Length=385

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESCIP+Y+F  +Y Y+ +S +SF+ ++DDP  YGRGRYN  M P++ + +W
Sbjct  198  SNERFILLSESCIPLYNFSLIYHYIMKSGYSFMGAFDDPGPYGRGRYNLNMAPEVNISQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +  ++  F+ +CRP+CY DEHY PT L +  G++ ANRS+T
Sbjct  258  RKGSQWFEINRKLAINIVEDATYHPKFETFCRPACYVDEHYFPTMLTIQAGHLLANRSIT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  ++ITE F++ I  N   C+YN+  +  C+LFARKF PSAL PL 
Sbjct  318  WVDWSRGGAHPATFGRSDITEEFLRRISKN-QRCTYNKRNSSTCFLFARKFAPSALHPLL  376

Query  158  KLSLKVMGF  132
            +L+ KV+G+
Sbjct  377  ELAPKVLGY  385



>ref|XP_002279551.2| PREDICTED: uncharacterized protein LOC100250702 [Vitis vinifera]
Length=427

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSE+CIP+++F T+YKYL  S HSF+ S+DDP   GRGRYN RM P + L +W
Sbjct  238  SNERFVLLSETCIPLFNFTTIYKYLINSNHSFVSSFDDPRHIGRGRYNKRMFPTVTLPDW  297

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI IVS+  +Y +F+++CRP CY DEHY+ T +      +N+NRS+T
Sbjct  298  RKGSQWFEVHRKLAIEIVSDVTYYPIFQEHCRPPCYMDEHYLATLVNKLRPDLNSNRSIT  357

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HP  +   +++E F+   R +G +CSYN G + IC+LFARKF PS LEPL 
Sbjct  358  WVDWSRGGSHPTKFVRKDVSEAFLNQAR-HGFNCSYNSGLSSICFLFARKFHPSTLEPLL  416

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  417  RIAPSLLGF  425



>gb|AFW60050.1| hypothetical protein ZEAMMB73_108408 [Zea mays]
Length=437

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 138/189 (73%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVL+SESC+PV++F TVY+YL  S  S++ESY+       GRYN +M P++    W
Sbjct  249  SNQRFVLVSESCVPVFNFRTVYEYLVNSAMSYVESYNIDVPQCAGRYNPQMAPEVLEEHW  308

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFEM+R LA+ +V++ ++YA+F+++C PSCYPDEHYIPT+L L HG  NANR+VT
Sbjct  309  RKGSEWFEMSRDLAVDVVADQRYYALFRRHCTPSCYPDEHYIPTFLHLRHGARNANRTVT  368

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +  A  T   + +IRSNGT C YN   T +CYLFARKF PSAL  L 
Sbjct  369  WVDWSRGGPHPARFGKAATTADLMAAIRSNGTLCLYNGKPTTVCYLFARKFAPSALPMLL  428

Query  158  KLSLKVMGF  132
              S  ++ F
Sbjct  429  NFSNTLLDF  437



>emb|CDX69735.1| BnaA10g20840D [Brassica napus]
Length=386

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+++F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ + +W
Sbjct  199  SNEWFVLVSESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNDNMEPEVPITKW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +      ANRS+T
Sbjct  259  RKGSQWFEINRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPMALANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++ITE F + I  +G +C YN   T +CYLFARKF PSALE L 
Sbjct  319  WVDWSRGGPHPATFGRSDITEKFFEKIL-DGKNCVYNGRNTSMCYLFARKFAPSALESLL  377

Query  158  KLSLKVMGF  132
             ++ K++G+
Sbjct  378  HIAPKILGY  386



>ref|XP_008663766.1| PREDICTED: uncharacterized protein LOC103642231 [Zea mays]
Length=439

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 138/189 (73%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVL+SESC+PV++F TVY+YL  S  S++ESY+       GRYN +M P++    W
Sbjct  251  SNQRFVLVSESCVPVFNFRTVYEYLVNSAMSYVESYNIDVPQCAGRYNPQMAPEVLEEHW  310

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFEM+R LA+ +V++ ++YA+F+++C PSCYPDEHYIPT+L L HG  NANR+VT
Sbjct  311  RKGSEWFEMSRDLAVDVVADQRYYALFRRHCTPSCYPDEHYIPTFLHLRHGARNANRTVT  370

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +  A  T   + +IRSNGT C YN   T +CYLFARKF PSAL  L 
Sbjct  371  WVDWSRGGPHPARFGKAATTADLMAAIRSNGTLCLYNGKPTTVCYLFARKFAPSALPMLL  430

Query  158  KLSLKVMGF  132
              S  ++ F
Sbjct  431  NFSNTLLDF  439



>ref|XP_009778079.1| PREDICTED: uncharacterized protein LOC104227520 [Nicotiana sylvestris]
Length=382

 Score =   231 bits (588),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 137/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+++F  VY+Y++ES HSFI  +DDP   GRGRYN  M P++ + EW
Sbjct  195  SNEWFVLLSESCIPLHNFSVVYRYISESRHSFISVFDDPGPVGRGRYNKNMSPEVNITEW  254

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +  +Y  F ++C+PSCY DEHY PT L + + ++ ANRS+T
Sbjct  255  RKGSQWFEVNRKLAIDIVKDQVYYLKFDQFCKPSCYVDEHYFPTMLHIQYPHLLANRSLT  314

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
             VDWS GG HPA++  A+IT+ F++ I   GT C YN   T +C+LF RKF PS LEPL 
Sbjct  315  LVDWSRGGAHPATFGKADITDQFLKKIVEGGT-CVYNNQATSLCFLFTRKFSPSTLEPLL  373

Query  158  KLSLKVMGF  132
            + S K +GF
Sbjct  374  ERSSKYLGF  382



>gb|KJB70318.1| hypothetical protein B456_011G068900 [Gossypium raimondii]
Length=387

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 139/186 (75%), Gaps = 1/186 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+++F  +Y+Y++ S HSF+ S+D+P  YGRGRYN  M+P++ L +W
Sbjct  200  SNEWFILLSESCIPLHNFSIIYRYISRSRHSFMGSFDEPGPYGRGRYNPHMQPEVTLSQW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +T +Y  FKK+CRP+CY DEHY PT L +   ++ ANR++T
Sbjct  260  RKGSQWFEVNRKLAIDIVVDTTYYPKFKKFCRPACYVDEHYFPTMLTIQSPHLLANRTLT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GG HPA++  A+ITEGF + I   G  C YN   + +CYLFARKF PSAL+PL 
Sbjct  320  WTDWSRGGAHPATFGKADITEGFFKKI-FEGQVCLYNGQPSTVCYLFARKFAPSALDPLL  378

Query  158  KLSLKV  141
             L+ KV
Sbjct  379  GLASKV  384



>gb|KHG10617.1| Putative non-structural 4 [Gossypium arboreum]
Length=388

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+Y+F  +Y+Y+ +S HSF+ ++DDP  +GRGRYN  M P++ + +W
Sbjct  201  SNEWFILLSESCIPLYNFSVIYQYIMKSKHSFMGAFDDPGPFGRGRYNYNMVPEVNISKW  260

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +  +Y  F+++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  261  RKGSQWFEVNRKLAINIVEDVTYYPKFEQFCRPACYVDEHYFPTMLTIQTPNLLANRSIT  320

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP ++  ++ITE F   I   G  C YN   + IC+LFARKF PSA+EPL 
Sbjct  321  WVDWSRGGPHPGTFGRSDITEDFFNRIL-EGRQCRYNDQPSSICFLFARKFAPSAMEPLL  379

Query  158  KLSLKVMGF  132
            +++ KV+GF
Sbjct  380  QIAQKVLGF  388



>ref|XP_007024391.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY27013.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=386

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+++F  +Y+Y++ S HSF+ S+D+   YGRGRYN RM+P++ L +W
Sbjct  199  SNEWFILLSESCIPLHNFSIIYRYISRSRHSFMGSFDEAGPYGRGRYNPRMEPEVTLSQW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI I+ +T +Y  FK++CRP+CY DEHY PT L +   ++ ANR++T
Sbjct  259  RKGSQWFEVNRRLAINIIEDTTYYPKFKEFCRPACYVDEHYFPTMLSIQFPHLLANRTLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GG HPA++  A+ITEG    I   G  C YN   + +CYLFARKF PSAL+PL 
Sbjct  319  WTDWSRGGAHPATFGKADITEGLFNKIL-EGQLCLYNNQPSSVCYLFARKFAPSALDPLL  377

Query  158  KLSLKVMGF  132
             L+ KV+G+
Sbjct  378  GLASKVLGY  386



>ref|XP_008244554.1| PREDICTED: uncharacterized protein LOC103342693 [Prunus mume]
Length=341

 Score =   229 bits (583),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I +  W
Sbjct  152  SNQRFVLLSESCIPLFNFTTTYDYLINSNLSFLSSFDDPRKPGRGRYNPQMYPIINITNW  211

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI IVS+ K+Y +F++YC P CY DEHYIPT + L +  +N+ RS+T
Sbjct  212  RKGSQWFEVHRELAIHIVSDCKYYPIFQEYCHPPCYIDEHYIPTLVNLLYSELNSKRSIT  271

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +  ++IT+ F+  IR  G+ C YN   T IC+LFARKF P+ LEPL 
Sbjct  272  WVDWSRGGPHPGKFGGSDITDEFLNRIRF-GSECEYNGNTTSICFLFARKFMPNTLEPLL  330

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  331  RVAPLLLGF  339



>ref|XP_011007501.1| PREDICTED: uncharacterized protein LOC105113152 isoform X2 [Populus 
euphratica]
Length=411

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSE+CIPV++F T+Y YL  S  SF+ S+DDP   GRGRYN RM+P + L +W
Sbjct  222  SNERFVLLSETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDW  281

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE +R +AI ++S+ K+Y +F+ +CRP CY DEHY PT +      +N+NRS+T
Sbjct  282  RKGSQWFEAHRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSIT  341

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HP  +   +++E F+  IR NG +C+YN G T +C+LFARKF PS L+PL 
Sbjct  342  WVDWSGGGSHPTRFVRKDVSEAFLNQIR-NGFNCTYNGGITTVCFLFARKFHPSTLDPLL  400

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  401  RIAPGLLGF  409



>gb|KCW83891.1| hypothetical protein EUGRSUZ_B00742 [Eucalyptus grandis]
Length=302

 Score =   228 bits (580),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F T+Y YL  ST SFIE+YD P   GRGRYN RM+P I++ +W
Sbjct  114  SNQRFVLLSESCIPLFNFTTIYSYLVGSTRSFIEAYDKPGPVGRGRYNLRMRPVIQIGQW  173

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R LA+ +VS+ K+ ++F+++C+ SCY DEHY+PT + +     N+NRS+T
Sbjct  174  RKGSQWFEMDRGLAVEVVSDMKYISVFRRFCKGSCYSDEHYLPTLVSIKFWRRNSNRSLT  233

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +    +T   ++ +R     C YN   T +C+LFARKF P+AL+ L 
Sbjct  234  WVDWSKGGPHPTRFGRWQVTVELLKRLRGGSRKCEYNGKSTSVCFLFARKFLPNALDRLL  293

Query  158  KLSLKVMGF  132
            + + KVM F
Sbjct  294  RFAPKVMEF  302



>ref|XP_010033803.1| PREDICTED: uncharacterized protein LOC104423043 [Eucalyptus grandis]
 gb|KCW53627.1| hypothetical protein EUGRSUZ_J02890 [Eucalyptus grandis]
Length=384

 Score =   230 bits (587),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+L+SESCIP+ +  TVY YL++S +SFI S+D+ + YGRGRYN +M P+I L EW
Sbjct  197  SNEWFILVSESCIPIQNLTTVYSYLSQSRYSFIGSFDEDSSYGRGRYNKKMAPEINLTEW  256

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI I+ ++ +Y  FKK+CRP+CY DEHY PT L +    + ANRS+T
Sbjct  257  RKGSQWFEVNRKLAIDIIEDSTYYPKFKKFCRPTCYVDEHYFPTMLSIQSPDLLANRSLT  316

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  A+IT+ F + I  N +SCSYN     +C+LFARKF PSAL  L 
Sbjct  317  WVDWSRGGPHPATFGEADITKEFFKKILEN-SSCSYNDQPYSLCFLFARKFAPSALVSLS  375

Query  158  KLSLKVMGF  132
             L+L V G+
Sbjct  376  DLALDVFGY  384



>ref|XP_004236422.2| PREDICTED: uncharacterized protein LOC101267221 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318627.1| PREDICTED: uncharacterized protein LOC101267221 isoform X1 [Solanum 
lycopersicum]
Length=426

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+YDF T+Y Y+  S ++F+ESYD  +  GRGRYN +MKP + L +W
Sbjct  238  SNERFVLLSESCIPLYDFTTIYDYIINSANTFMESYDLISPVGRGRYNKKMKPLVTLAQW  297

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R +AI I+S+ K+  +FK++CRP+CY DEHY+PT++ + + + N NR++T
Sbjct  298  RKGSQWFEVDREIAIDIISDQKYSNLFKRFCRPACYSDEHYLPTFVTMKYWWKNENRTLT  357

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDW+ GGPHP  +   ++TE  +  +R NGT C YN   + +CYLFARKF PS L+ L 
Sbjct  358  WVDWAKGGPHPTKFIRPDVTEDLLYGMR-NGTKCEYNGQPSNMCYLFARKFLPSTLDRLL  416

Query  158  KLSLKVMGF  132
            + + K+M F
Sbjct  417  RFAPKIMKF  425



>ref|XP_007044267.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY00099.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=404

 Score =   231 bits (588),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            +NERFVLLSE+CIP+++F TVY YL  S+ SF+ S+DDPT  GRGRYN +M P + L +W
Sbjct  214  TNERFVLLSEACIPLFNFTTVYNYLINSSRSFLGSFDDPTHTGRGRYNKQMWPTVSLADW  273

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IVS+ K+Y +F+ +CRP CY DEHY+PT + L    +N+NRS+T
Sbjct  274  RKGSQWFEVNRMLAAEIVSDDKYYPVFRDHCRPPCYMDEHYLPTLVNLICPELNSNRSIT  333

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  Y   +++   +  +R  G +C+YN  ++ IC+LFARKF PS LEPL 
Sbjct  334  WVDWSRGGPHPTKYLRKDVSVALLNQVR-QGFNCTYNGERSSICFLFARKFHPSTLEPLL  392

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  393  RIAPALLGF  401



>gb|AAD40142.1|AF149413_23 contains similarity to several Arabidopsis thaliana hypothetical 
proteins including GB:U95973 and GB:AC002392 [Arabidopsis 
thaliana]
Length=436

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 140/187 (75%), Gaps = 1/187 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+++F T+Y Y+T+S HSF+ S+DDP  YGRGRY+  M P++ + +W
Sbjct  249  SNEWFVLLSESCIPLFNFTTIYTYMTKSEHSFMGSFDDPGAYGRGRYHGNMAPEVFIDQW  308

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +T +Y  FK++C+P+CY DEHY PT L +      ANRSVT
Sbjct  309  RKGSQWFEINRELAVSIVKDTLYYPKFKEFCQPACYVDEHYFPTMLTIEKPAALANRSVT  368

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++ A +I E F   I   G +C+YN G T +CYLFARKF PSALEPL 
Sbjct  369  WVDWSRGGAHPATFGAQDINEEFFARIL-KGDNCTYNGGYTSMCYLFARKFSPSALEPLV  427

Query  158  KLSLKVM  138
            +++ K++
Sbjct  428  QIAPKLL  434



>ref|XP_010926004.1| PREDICTED: uncharacterized protein LOC105048408 [Elaeis guineensis]
Length=407

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++FPT+Y YL  ST +++ SYDDP   GRGRY  +M+P ++L +W
Sbjct  218  SNQRFVLLSESCIPLFNFPTIYSYLINSTKTYVSSYDDPGPNGRGRYRIKMRPYLELQQW  277

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI I+S+ K++ +FKKYC+PSCY DEHY+ T++ +     NANRS+T
Sbjct  278  RKGSQWFEVDRNLAIEIISDEKYFPVFKKYCKPSCYVDEHYLSTFVSISFWGRNANRSLT  337

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +   ++T   ++ +R NG++C YN   T IC+LFARKF P++L    
Sbjct  338  WVDWSKGGPHPARFGRLDVTIELLERLR-NGSTCDYNGRTTNICFLFARKFLPNSLTRFL  396

Query  158  KLSLKVMG  135
            + + KVMG
Sbjct  397  RFAPKVMG  404



>ref|XP_002466519.1| hypothetical protein SORBIDRAFT_01g009210 [Sorghum bicolor]
 gb|EER93517.1| hypothetical protein SORBIDRAFT_01g009210 [Sorghum bicolor]
Length=402

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 138/192 (72%), Gaps = 4/192 (2%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP++DF T Y Y   S+HSF+ S DDP R GRGRYN  M P+++L +W
Sbjct  211  SNEWFVLVSESCIPLFDFNTTYGYFQNSSHSFVMSIDDPGRDGRGRYNLNMAPEVELEQW  270

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG QWFE +R LA+ IV +T +Y  FK++CRP CY DEHYI T L++   +  ANR+ T
Sbjct  271  RKGWQWFEADRDLAVAIVEDTVYYPKFKQFCRPGCYADEHYIQTMLKIEAPHKLANRTAT  330

Query  338  YVDWSLGGP---HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALE  168
            +VDWS GGP   HPA++   +ITE F++ IR  G +C YN   T +CYLFARKF PSALE
Sbjct  331  WVDWSRGGPNSAHPATFGRGDITEEFLKGIR-GGETCLYNGQNTTLCYLFARKFAPSALE  389

Query  167  PLEKLSLKVMGF  132
            PL +L+  V+GF
Sbjct  390  PLLELAPTVLGF  401



>ref|XP_011007493.1| PREDICTED: uncharacterized protein LOC105113152 isoform X1 [Populus 
euphratica]
Length=415

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSE+CIPV++F T+Y YL  S  SF+ S+DDP   GRGRYN RM+P + L +W
Sbjct  226  SNERFVLLSETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDW  285

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE +R +AI ++S+ K+Y +F+ +CRP CY DEHY PT +      +N+NRS+T
Sbjct  286  RKGSQWFEAHRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSIT  345

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HP  +   +++E F+  IR NG +C+YN G T +C+LFARKF PS L+PL 
Sbjct  346  WVDWSGGGSHPTRFVRKDVSEAFLNQIR-NGFNCTYNGGITTVCFLFARKFHPSTLDPLL  404

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  405  RIAPGLLGF  413



>ref|XP_009403975.1| PREDICTED: uncharacterized protein LOC103987406 [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 137/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN RFVLLSESCIP+++FPTVY YL  ST  F+E YDDP   GRGRY + +KP I+  +W
Sbjct  208  SNRRFVLLSESCIPLFNFPTVYSYLINSTEVFVEVYDDPGPNGRGRYKSTLKPGIEFKQW  267

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWF ++R LA+ IVS+ K++ +F++YCRPSC  DEHY+PT + +   +  ANRS+T
Sbjct  268  RKGSQWFAVDRGLAMEIVSDEKYFPLFQRYCRPSCLADEHYLPTLMNVRSFWGTANRSLT  327

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GGPHPA      IT   +Q +R NG++CSYN   T+ICYLF RKF P++L  L 
Sbjct  328  WADWSKGGPHPARIGRNEITAELLQRMR-NGSACSYNGRTTRICYLFGRKFLPNSLNRLV  386

Query  158  KLSLKVMGF  132
            +L+ K+M F
Sbjct  387  RLAPKLMDF  395



>ref|XP_002315929.2| hypothetical protein POPTR_0010s13160g [Populus trichocarpa]
 gb|EEF02100.2| hypothetical protein POPTR_0010s13160g [Populus trichocarpa]
Length=411

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSE+CIPV++F T+Y YL  S  SF+ S+DDP   GRGRYN RM+P + L +W
Sbjct  222  SNERFVLLSETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDW  281

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE +R +AI ++S+ K+Y +F+ +CRP CY DEHY PT +      +N+NRS+T
Sbjct  282  RKGSQWFEAHRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSIT  341

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA +   +++E F+  IR NG +C+YN G T +C+LFARKF PS L+ L 
Sbjct  342  WVDWSGGGSHPARFVRKDVSEAFLNQIR-NGFNCTYNGGITTVCFLFARKFHPSTLDSLL  400

Query  158  KLSLKVMGF  132
            +++ +++GF
Sbjct  401  RIAPELLGF  409



>ref|XP_009344746.1| PREDICTED: uncharacterized protein LOC103936628 [Pyrus x bretschneideri]
Length=558

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I + +W
Sbjct  369  SNQRFVLLSESCIPLFNFTTAYHYLINSNLSFLNSFDDPRKPGRGRYNPQMYPMINITDW  428

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ IVS+ K+Y +F++YC P CY DEHYIPT + L +  +N+NRSVT
Sbjct  429  RKGSQWFEVHRELAVHIVSDRKYYPIFQQYCNPPCYIDEHYIPTLVNLMYTELNSNRSVT  488

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +   +IT+ F+  IR  G+ C+YN   T +C+LFARKF P ALEPL 
Sbjct  489  WVDWSRGGPHPGKFGWMDITDEFLNRIRF-GSECTYNGNTTSVCFLFARKFLPDALEPLL  547

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  548  RVAPLLLGF  556



>ref|XP_006466159.1| PREDICTED: uncharacterized protein LOC102619633 [Citrus sinensis]
Length=385

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+++F  VY Y+++S +SF+ESYDDP  YGRGRYN  M+P++ L +W
Sbjct  198  SNEWFILLSESCIPLHNFSIVYYYISKSRYSFMESYDDPGPYGRGRYNGNMEPEVTLSQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ I+ +T +Y  F+ +C+P CY DEHY PT L +H   + ANR++T
Sbjct  258  RKGSQWFEINRRLAVDIIEDTSYYPKFRDFCKPGCYVDEHYFPTMLTIHFSRLLANRTLT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GG HPA+Y  A+I+E F + I ++ + C YN+  T  CYLF RKF PSAL PL 
Sbjct  318  WTDWSRGGAHPATYGGADISEEFFRKITAS-SQCYYNKQVTSFCYLFGRKFAPSALGPLL  376

Query  158  KLSLKVMGF  132
            +LSL   GF
Sbjct  377  ELSLSAFGF  385



>gb|AFO66494.1| hypothetical protein [Brassica napus]
Length=386

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+++F T+Y YL+ + HSF+ ++DDP  +GRGRYN  M+P++ + +W
Sbjct  199  SNEWFVLVSESCIPLFNFTTIYSYLSRTKHSFMGAFDDPGPFGRGRYNDNMEPEVPITKW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +      ANRS+T
Sbjct  259  RKGSQWFEINRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPMALANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++ITE F + I  +G +C YN   T +CYLFARKF PSALE L 
Sbjct  319  WVDWSRGGPHPATFGRSDITEKFFERIL-DGKNCVYNGRNTSMCYLFARKFAPSALESLL  377

Query  158  KLSLKVMGF  132
             ++ K++G+
Sbjct  378  HIAPKILGY  386



>ref|XP_010264609.1| PREDICTED: uncharacterized protein LOC104602574 [Nelumbo nucifera]
Length=404

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 143/189 (76%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RF+LLSE+CIP+++F TVY YL  S  +F+E+YD+P   GRGRYN RMKP I L +W
Sbjct  215  SNQRFILLSEACIPLFNFSTVYNYLIGSNMTFVEAYDEPGPVGRGRYNHRMKPLITLDQW  274

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFEM+R LAI IVS+ K++++F KYC+ SCY DEHYIPT++ ++    N+NR++T
Sbjct  275  RKGAQWFEMDRDLAIEIVSDVKYFSVFGKYCKGSCYSDEHYIPTFVSVNFWEKNSNRTLT  334

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +   ++T   ++ +R+  T+C YN   T ICYLFARKF+P++L+ L 
Sbjct  335  WVDWSRGGPHPTRFIRTDVTIELLEMMRT-ATTCKYNGNTTNICYLFARKFYPNSLDRLL  393

Query  158  KLSLKVMGF  132
            + + KVM F
Sbjct  394  RFAPKVMMF  402



>gb|ACF84653.1| unknown [Zea mays]
Length=302

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 134/189 (71%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIPV++F TVY YL  S HSF+E+Y    R  R RY+ RM PDI L EW
Sbjct  114  SNERFVLLSESCIPVHNFTTVYDYLVGSRHSFVEAYYRDDRGCRSRYSRRMAPDITLREW  173

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQW E++R LA  ++++T++Y +F+++C PSCYPDEHY+ TY+ L HG  N+NR+VT
Sbjct  174  RKGSQWLELSRDLAASVLADTRYYPLFRRHCTPSCYPDEHYVQTYVSLRHGARNSNRTVT  233

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
             V+W  G  HP +Y A + T   ++SIR++   C+YN   T  CYLFARKF P AL PL 
Sbjct  234  RVEWPAGTSHPVTYGAGDATPELVRSIRTSAEPCAYNSRLTSTCYLFARKFSPDALAPLL  293

Query  158  KLSLKVMGF  132
             +S  VM +
Sbjct  294  NMSAAVMHY  302



>ref|XP_006353820.1| PREDICTED: uncharacterized protein LOC102581987 [Solanum tuberosum]
Length=325

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSE+CIP+Y+F T+Y Y+  ST +F+ESYD+    GRGRYN++M P + + +W
Sbjct  137  SNERFVLLSEACIPLYNFTTIYTYIMNSTKTFVESYDEWGPVGRGRYNSQMTPWVTIEQW  196

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R +A+ ++++TKF+ +FK +CRP+CY DEHY+PT++ + + + N NR++T
Sbjct  197  RKGSQWFELDREIALDMITDTKFFNLFKDFCRPACYSDEHYLPTFVTMRYWWKNGNRTLT  256

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDW+ GGPHP  +    +T   +  +R+ G  C YN   T +CYLFARKF PSAL+ L 
Sbjct  257  WVDWTKGGPHPTKFARTEVTRELLHQMRT-GIQCMYNGEPTSMCYLFARKFLPSALDRLL  315

Query  158  KLSLKVMGF  132
            K + KVM F
Sbjct  316  KFAPKVMMF  324



>ref|XP_006651782.1| PREDICTED: uncharacterized protein LOC102702183 [Oryza brachyantha]
Length=330

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+++F T Y+YL  S+ SF+ ++DDP  YGRGRYN  M P+++L +W
Sbjct  142  SNEWFVLVSESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELEQW  201

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRS+T
Sbjct  202  RKGSQWFEVDRELAIAIVKDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSIT  261

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +ITE F++ ++  G +C YN   + +C+LFARKF PS+LEPL 
Sbjct  262  WVDWSRGGAHPATFGRGDITEEFLRRVQE-GRTCLYNGQNSTMCFLFARKFAPSSLEPLL  320

Query  158  KLSLKVMGF  132
            +L+  V+GF
Sbjct  321  ELAPTVLGF  329



>gb|KDP29448.1| hypothetical protein JCGZ_18369 [Jatropha curcas]
Length=258

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSE+CIP+++F T+Y YL  ST +F+E+YD     GRGRYN +M P I + +W
Sbjct  69   SNQRFVLLSEACIPLFNFSTIYSYLINSTKNFVEAYDLEGPVGRGRYNHQMSPQITIDQW  128

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R LAI +VS+ K++ +F+KYC+ +CY DEHY+PT++ + H   N+NRS+T
Sbjct  129  RKGSQWFEMDRQLAIEVVSDQKYFPIFQKYCKGNCYADEHYLPTFVSMKHWQRNSNRSLT  188

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +    +T  F++ +RS G+ C YN   + IC+LFARKF P+AL+ L 
Sbjct  189  WVDWSRGGPHPTRFIRTEVTVEFLEKLRS-GSKCLYNGKSSSICFLFARKFLPTALDRLL  247

Query  158  KLSLKVMGF  132
            + + K M F
Sbjct  248  RFAPKAMHF  256



>gb|EEE59868.1| hypothetical protein OsJ_12453 [Oryza sativa Japonica Group]
Length=383

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+++F T Y+YL  S+ SF+ ++DDP  YGRGRYN  M P+++L +W
Sbjct  195  SNEWFVLVSESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELTQW  254

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRS+T
Sbjct  255  RKGSQWFEVNRELAIEIVRDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSIT  314

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +ITE F++ ++  G +C YN   + +C+LFARKF PSALEPL 
Sbjct  315  WVDWSRGGAHPATFGRGDITEEFLRRVQ-EGRTCLYNGQNSTMCFLFARKFAPSALEPLL  373

Query  158  KLSLKVMGF  132
            +L+  V+GF
Sbjct  374  ELAPTVLGF  382



>emb|CDX97141.1| BnaC09g44840D [Brassica napus]
Length=386

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+++F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ + +W
Sbjct  199  SNEWFVLVSESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNHNMEPEVPITKW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IV +T +Y  FK +CRP+CY DEHY PT L +      ANRS+T
Sbjct  259  RKGSQWFEINRELAATIVKDTLYYPKFKDFCRPACYVDEHYFPTMLTIEKPMALANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++ITE F + I  +G +C YN   T +CYLFARKF PSALE L 
Sbjct  319  WVDWSRGGPHPATFGRSDITERFFEKIL-DGKNCIYNGRNTSMCYLFARKFAPSALESLL  377

Query  158  KLSLKVMGF  132
             ++ K++G+
Sbjct  378  HIAPKILGY  386



>emb|CDX97139.1| BnaC09g44860D [Brassica napus]
Length=386

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+++F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ + +W
Sbjct  199  SNEWFVLVSESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNHNMEPEVPITKW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA  IV +T +Y  FK +CRP+CY DEHY PT L +      ANRS+T
Sbjct  259  RKGSQWFEINRELAATIVKDTLYYPKFKDFCRPACYVDEHYFPTMLTIEKPMALANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA++  ++ITE F + I  +G +C YN   T +CYLFARKF PSALE L 
Sbjct  319  WVDWSRGGPHPATFGRSDITERFFEKIL-DGKNCIYNGRNTSMCYLFARKFAPSALESLL  377

Query  158  KLSLKVMGF  132
             ++ K++G+
Sbjct  378  HIAPKILGY  386



>gb|KDO58674.1| hypothetical protein CISIN_1g040146mg [Citrus sinensis]
Length=385

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESC+P+++F  VY Y+++S +SF+ESYDDP  YGRGRYN  M+P++ L +W
Sbjct  198  SNEWFILLSESCVPLHNFSIVYYYISKSRYSFMESYDDPGPYGRGRYNGNMEPEVTLSQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ I+ +T +Y  F+ +C+P CY DEHY PT L +H   + ANR++T
Sbjct  258  RKGSQWFEINRRLAVDIIEDTSYYPKFRDFCKPGCYVDEHYFPTMLTIHFSRLLANRTLT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GG HPA+Y  A+I+E F + I ++ + C YN+  T  CYLF RKF PSAL PL 
Sbjct  318  WTDWSRGGAHPATYGGADISEEFFRKITAS-SQCYYNKQVTSFCYLFGRKFAPSALGPLL  376

Query  158  KLSLKVMGF  132
            +LSL   GF
Sbjct  377  ELSLSAFGF  385



>ref|XP_002516477.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45818.1| conserved hypothetical protein [Ricinus communis]
Length=371

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESCIP+Y+F  +Y Y+ +S +SFI ++DD   YGRGRYN  M P++ + +W
Sbjct  184  SNERFILLSESCIPLYNFSVIYHYIMKSRYSFIGAFDDHGPYGRGRYNENMAPEVNITQW  243

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +T FY  F+++C+P CY DEHY PT L +   ++ ANRS+T
Sbjct  244  RKGSQWFEINRRLAVNIVEDTTFYPKFEEFCKPHCYVDEHYFPTMLTIQAAHLLANRSIT  303

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +ITE F + I + G +C+YN   +  C+LFARKF PSALEPL 
Sbjct  304  WVDWSRGGAHPATFGRGDITEDFFRRIHA-GQNCTYNNQPSSTCFLFARKFAPSALEPLL  362

Query  158  KLSLKVMGF  132
             +S K +GF
Sbjct  363  LVSSKFLGF  371



>gb|AAT77886.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF98696.1| expressed protein [Oryza sativa Japonica Group]
Length=398

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+++F T Y+YL  S+ SF+ ++DDP  YGRGRYN  M P+++L +W
Sbjct  210  SNEWFVLVSESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELTQW  269

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRS+T
Sbjct  270  RKGSQWFEVNRELAIEIVRDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSIT  329

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +ITE F++ ++  G +C YN   + +C+LFARKF PSALEPL 
Sbjct  330  WVDWSRGGAHPATFGRGDITEEFLRRVQ-EGRTCLYNGQNSTMCFLFARKFAPSALEPLL  388

Query  158  KLSLKVMGF  132
            +L+  V+GF
Sbjct  389  ELAPTVLGF  397



>gb|KDP34129.1| hypothetical protein JCGZ_07700 [Jatropha curcas]
Length=386

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+Y+F  +Y Y+  S +SF+ ++DDP  YGRGRYN  M P++ + +W
Sbjct  199  SNEWFILLSESCIPLYNFTVIYHYIMRSKYSFVGAFDDPGPYGRGRYNENMAPEVNISQW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +TK+Y  F+++C+P+CY DEHY PT L +   ++ ANRS+T
Sbjct  259  RKGSQWFEVNRRLAVTIVEDTKYYPKFEEFCKPNCYVDEHYFPTMLNIQAAHLIANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  A+ITE F +     G  C+YN   + IC+LF RKF PSALEPL 
Sbjct  319  WVDWSRGGAHPATFGRADITEDFFRKF-FEGQHCTYNNQPSSICFLFGRKFAPSALEPLL  377

Query  158  KLSLKVMGF  132
             ++  V+GF
Sbjct  378  HIAPSVLGF  386



>tpg|DAA51165.1| TPA: hypothetical protein ZEAMMB73_778026 [Zea mays]
Length=207

 Score =   223 bits (568),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 136/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP++DF T Y+Y   S  SF+ ++DDP  YGRGRYN  M P+++L +W
Sbjct  19   SNEWFVLVSESCIPIFDFNTTYRYFRNSNQSFLMAFDDPGPYGRGRYNWNMTPEVELDQW  78

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRSVT
Sbjct  79   RKGSQWFEVHRELAIEIVKDTVYYPKFKEFCRPHCYVDEHYFPTMLTIEAPNRLANRSVT  138

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +IT  F++ +R  G +C +N   + +C+LFARKF PS LEPL 
Sbjct  139  WVDWSRGGAHPATFGRGDITLEFLRRVRE-GRTCLHNNQNSTMCFLFARKFAPSTLEPLL  197

Query  158  KLSLKVMGF  132
            +L+  V+GF
Sbjct  198  ELAPTVLGF  206



>ref|XP_009345696.1| PREDICTED: uncharacterized protein LOC103937474 [Pyrus x bretschneideri]
Length=411

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I + +W
Sbjct  222  SNQRFVLLSESCIPLFNFTTAYHYLINSNLSFLNSFDDPRKPGRGRYNPQMYPMINITDW  281

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ IVS+ K+Y +F++YC P CY DEHYIPT + L +  +N+NRSVT
Sbjct  282  RKGSQWFEVHRELAVHIVSDRKYYPIFQQYCNPPCYIDEHYIPTLVNLMYTELNSNRSVT  341

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +   +IT+ F+  IR  G+ C+YN   T + +LFARKF P ALEPL 
Sbjct  342  WVDWSRGGPHPGKFGWMDITDEFLNRIRF-GSECTYNGNTTSVFFLFARKFLPDALEPLL  400

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  401  RVAPLLLGF  409



>gb|KJB54739.1| hypothetical protein B456_009G047200 [Gossypium raimondii]
 gb|KJB54740.1| hypothetical protein B456_009G047200 [Gossypium raimondii]
Length=388

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+Y+F  +Y+Y+ +S HSF+ ++DDP  +GRGRYN  M P++ + +W
Sbjct  201  SNEWFILLSESCIPLYNFSVIYQYIMKSKHSFMGAFDDPGPFGRGRYNYNMVPEVNISKW  260

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +  +Y  F+++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  261  RKGSQWFEVNRKLAINIVEDVTYYPKFEQFCRPACYVDEHYFPTMLTIQTPNLLANRSIT  320

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP ++  ++IT  F + I   G  C YN   + IC+LFARKF PSA+EPL 
Sbjct  321  WVDWSRGGPHPGTFGRSDITVDFFKRIL-EGHQCKYNDQPSSICFLFARKFAPSAMEPLL  379

Query  158  KLSLKVMGF  132
            +++ KV+GF
Sbjct  380  QIAQKVLGF  388



>ref|NP_001169393.1| uncharacterized protein LOC100383262 [Zea mays]
 gb|ACN33611.1| unknown [Zea mays]
 tpg|DAA51166.1| TPA: hypothetical protein ZEAMMB73_632462 [Zea mays]
Length=403

 Score =   229 bits (583),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 139/192 (72%), Gaps = 4/192 (2%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP++DF T Y+Y   S+HSF+ S DDP R GRGRYN  M P+++L +W
Sbjct  212  SNEWFVLVSESCIPLFDFNTTYEYFQNSSHSFVMSIDDPGRDGRGRYNLNMAPEVELEQW  271

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG QWFE +R LA+ IV +T +Y  FK++CRP CY DEHYI T L++   +  ANR+ T
Sbjct  272  RKGWQWFEADRDLAVAIVEDTVYYPKFKQFCRPGCYADEHYIQTMLKIEAPHKLANRTAT  331

Query  338  YVDWSLGGP---HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALE  168
            +VDWS GGP   HPA++   +ITE F++ +R  G +C YN   T +C+LFARKF PSAL+
Sbjct  332  WVDWSRGGPNSAHPATFGRGDITEEFLKGVR-GGETCLYNGRNTTVCFLFARKFAPSALQ  390

Query  167  PLEKLSLKVMGF  132
            PL +L+  V+GF
Sbjct  391  PLLELAPTVLGF  402



>ref|XP_010244357.1| PREDICTED: uncharacterized protein LOC104588211 [Nelumbo nucifera]
 ref|XP_010244358.1| PREDICTED: uncharacterized protein LOC104588211 [Nelumbo nucifera]
Length=385

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 137/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+Y+F  +Y Y+  S +SFI ++DDP  YGRGRYN  M P++ + +W
Sbjct  198  SNEWFVLVSESCIPLYNFSIIYNYIARSRYSFIGAFDDPGPYGRGRYNENMAPEVNITQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +  FY  F+++C+P+CY DEHY PT L +    + ANRS+T
Sbjct  258  RKGSQWFEINRKLAINIVGDVIFYPKFEEFCKPNCYVDEHYFPTMLTIQAAQLLANRSIT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  A+ITE F++ I   G SC YN   + +CYLFARKF PSALEPL 
Sbjct  318  WVDWSRGGAHPATFGRADITEDFVKRIL-EGHSCLYNNQPSSVCYLFARKFAPSALEPLF  376

Query  158  KLSLKVMGF  132
             L+ K  G+
Sbjct  377  FLAPKYFGY  385



>gb|KHG11266.1| Insulin-degrading enzyme [Gossypium arboreum]
Length=359

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+Y+F  +Y Y+ +S +SFI ++DDP  +G+GRYN  M P++ L +W
Sbjct  172  SNEWFILLSESCIPLYNFSVIYHYIKKSKYSFIGAFDDPGPHGQGRYNESMAPEVNLTQW  231

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +  +Y  F+++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  232  RKGSQWFEINRKLAVNIVEDITYYPKFEQFCRPACYVDEHYFPTMLTIQASNLLANRSIT  291

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++ +A+ITE F   I   G  C YN   + IC+LFARKF PSALEPL 
Sbjct  292  WVDWSRGGAHPATFGSADITEEFFTRIY-EGHECWYNDQPSSICFLFARKFAPSALEPLL  350

Query  158  KLSLKVMGF  132
            +++ KV+GF
Sbjct  351  QIAPKVLGF  359



>ref|XP_002309520.1| hypothetical protein POPTR_0006s24970g [Populus trichocarpa]
 gb|EEE93043.1| hypothetical protein POPTR_0006s24970g [Populus trichocarpa]
Length=385

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVL+SESCIP+Y+F  +Y Y+  S +SFI ++DD   YGRGRYN  M P++ + +W
Sbjct  198  SNERFVLVSESCIPLYNFSVIYDYMMRSKYSFIGAFDDHGPYGRGRYNENMAPEVNITQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ +V + ++Y  F+++C+PSCY DEHY PT L +    + ANR++T
Sbjct  258  RKGSQWFEINRKLAVNVVEDARYYPKFEEFCKPSCYVDEHYFPTMLTIEAAPLLANRTLT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  A+IT+ F + IR + T C YN   + +C+LFARKF PSALEPL 
Sbjct  318  WVDWSRGGAHPATFGRADITKEFFKKIRED-THCVYNNQSSPVCFLFARKFAPSALEPLL  376

Query  158  KLSLKVMGF  132
            ++S  V+GF
Sbjct  377  QVSQNVLGF  385



>ref|XP_009151114.1| PREDICTED: uncharacterized protein LOC103874440 [Brassica rapa]
Length=386

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+Y+F T+Y Y+++S HSF+ S+DDP+ YGRGRYN  M P++ + +W
Sbjct  199  SNEWFVLLSESCIPLYNFTTIYGYISKSKHSFMGSFDDPSPYGRGRYNGNMSPEVSIEQW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ +V +T +Y  FK++C P+CY DEHY PT L +      ANRS+T
Sbjct  259  RKGSQWFEVNRELAVSLVKDTLYYPKFKEFCTPACYVDEHYFPTMLTIEKPAALANRSLT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +I E F   I   G +C+YN   T +C LFARKF PSALEPL 
Sbjct  319  WVDWSRGGAHPATFGEPDINEDFFAKIM-KGDNCTYNGESTSMCSLFARKFSPSALEPLI  377

Query  158  KLSLKVMGF  132
            +++ K++ F
Sbjct  378  QIAPKILSF  386



>gb|KJB65609.1| hypothetical protein B456_010G103300 [Gossypium raimondii]
Length=386

 Score =   228 bits (580),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+Y+F  +Y Y+ +S +SFI ++DDP  +G+GRYN  M P++ L +W
Sbjct  199  SNEWFILLSESCIPLYNFSVIYHYIKKSKYSFIGAFDDPGPHGQGRYNESMAPEVNLTQW  258

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +  +Y  F+++CRP+CY DEHY PT L +    + ANRS+T
Sbjct  259  RKGSQWFEINRKLAVNIVEDITYYPKFEQFCRPACYVDEHYFPTMLTIQASNLLANRSIT  318

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++ +A+ITE F   I   G  C YN   + IC+LFARKF PSALEPL 
Sbjct  319  WVDWSRGGAHPATFGSADITEEFFTRIY-EGHECRYNDQPSSICFLFARKFAPSALEPLL  377

Query  158  KLSLKVMGF  132
            +++ KV+GF
Sbjct  378  QIAPKVLGF  386



>emb|CDX70416.1| BnaC03g05000D [Brassica napus]
Length=437

 Score =   229 bits (584),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 140/188 (74%), Gaps = 1/188 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+Y+F T+Y YL++S HSFI + DDP  +GRGRYN +M+P++ + +W
Sbjct  197  SNEWFVLVSESCIPLYNFTTIYTYLSQSKHSFIGAVDDPGPFGRGRYNEKMEPEVPITKW  256

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG QWFE++R LA  IV +T ++  F+++CRP+CY DEHY PT L +      ANRSVT
Sbjct  257  RKGPQWFEVDRDLAATIVKDTLYHHKFREFCRPACYSDEHYFPTMLTIEKPTALANRSVT  316

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GGPHPA++  ++ITE F   I  +G +CSYN   T +CYLFARKF PSALEPL 
Sbjct  317  WTDWSRGGPHPATFGRSDITEEFFGKI-FDGENCSYNGRNTSMCYLFARKFAPSALEPLL  375

Query  158  KLSLKVMG  135
             ++ K+MG
Sbjct  376  HIAPKIMG  383



>gb|EMT03400.1| hypothetical protein F775_00930 [Aegilops tauschii]
Length=266

 Score =   224 bits (570),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 137/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP++DF T Y Y   S+ SF+  +DDP  YGRGRYN  M P+++L +W
Sbjct  78   SNEWFVLVSESCIPIFDFNTTYDYFQNSSQSFVMVFDDPGPYGRGRYNYNMTPEVELEQW  137

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI I+ +T++Y  FK++CRP CY DEHY PT L +      ANRSVT
Sbjct  138  RKGSQWFEVDRDLAIEIIRDTRYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSVT  197

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +ITE F++ +++ G +C YN   +  C+LFARKF PSAL+PL 
Sbjct  198  WVDWSRGGAHPATFGRGDITEEFLRRVQT-GRTCLYNNQNSTTCFLFARKFAPSALQPLL  256

Query  158  KLSLKVMGF  132
             L+  V+G+
Sbjct  257  VLAPTVLGY  265



>ref|XP_007044265.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
 gb|EOY00097.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
Length=399

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F TVY YL  S+ SF+ESYD     GRGRY+ RM P + L +W
Sbjct  210  SNQRFVLLSESCIPIFNFSTVYSYLINSSQSFVESYDLEGPVGRGRYSRRMSPRVTLDQW  269

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFEM+R LAI +VS+ +++ +F+KYC+ +CY DEHY+PT++ +  G+ N+NR++T
Sbjct  270  RKGAQWFEMDRELAIGVVSDQEYFPVFQKYCKGACYADEHYLPTFVTMKFGHKNSNRTLT  329

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +    +T  F++ +RS G+ C YN   T IC+LFARKF P AL  L 
Sbjct  330  WVDWSKGGPHPAKFLRTEVTVEFLERLRS-GSQCQYNGNTTDICHLFARKFSPDALYRLL  388

Query  158  KLSLKVMGF  132
            K + K+M F
Sbjct  389  KFAPKLMHF  397



>ref|XP_009356238.1| PREDICTED: uncharacterized protein LOC103947108 [Pyrus x bretschneideri]
Length=400

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RF+LLSESC+P+++FPTVY YL  S  +F+  YDDP+  GRGRY++ M P I L +W
Sbjct  211  SNQRFILLSESCVPLHNFPTVYNYLIRSNETFVGVYDDPSSVGRGRYSSHMYPQISLSQW  270

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R+LAI +VS+ K++ +F+ YCR SCY DEHY+PTY+ +     N+NRS+T
Sbjct  271  RKGSQWFEIDRSLAIEVVSDKKYFPVFQTYCRGSCYADEHYLPTYVNIKFAQKNSNRSLT  330

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA +T  ++T   ++S+R NGT+C YN   + +C+LFARKF P  LE L 
Sbjct  331  WVDWSRGGAHPAKFTRTDVTVEVLKSLR-NGTACIYNGRVSNVCFLFARKFGPGTLERLL  389

Query  158  KLSLKVMGF  132
            + + K+M F
Sbjct  390  RFAPKLMRF  398



>gb|EMT12183.1| hypothetical protein F775_15181 [Aegilops tauschii]
Length=275

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN RF+LLSES +P++DFPTVY YLT ST  ++ESYD+P   GRGRY   M P I   +W
Sbjct  87   SNARFILLSESHVPLFDFPTVYSYLTNSTKVYMESYDEPGGTGRGRYKRGMAPTITPWQW  146

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+RALAI +V++  ++ +FKK+C+ +CY DEHY+PT+L + H  + A R+VT
Sbjct  147  RKGSQWFEMDRALAIDVVADNVYFPVFKKFCKRNCYADEHYLPTFLHIRHPEVAAGRTVT  206

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP+ +T   +T  F++ +R  GT+C YN   T +C+LFARKF P++L    
Sbjct  207  WVDWSHGGPHPSRFTRMEVTVDFLRWLR-GGTTCEYNGKTTTVCFLFARKFLPNSLTRFL  265

Query  158  KLSLKVMGF  132
            + + KVMGF
Sbjct  266  RFAPKVMGF  274



>gb|KHN20747.1| hypothetical protein glysoja_019064 [Glycine soja]
Length=315

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 142/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            +N+RFVLLSESCIP+++F T+Y YL  ST +F+E+YD P   GRGRY+ +M+P I+L +W
Sbjct  127  TNQRFVLLSESCIPLFNFSTIYTYLMNSTKTFVEAYDLPGEVGRGRYSPQMRPQIRLSQW  186

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWF+++R+LA+ IVS+ +++++FKKYC+PSCY DEHY+PT + +     N+NR++T
Sbjct  187  RKGSQWFQIDRSLALQIVSDHQYFSVFKKYCKPSCYSDEHYLPTLVSIKFWKRNSNRTLT  246

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP+ Y   ++T  F   +R  G SC YN   T IC+LFARKF P AL+ L 
Sbjct  247  WVDWSRGGPHPSRYFRTDVTIEFFNKLRF-GRSCEYNGRTTNICHLFARKFTPHALDRLL  305

Query  158  KLSLKVMGF  132
            + + K+M F
Sbjct  306  RFAPKIMQF  314



>gb|EEC76122.1| hypothetical protein OsI_13390 [Oryza sativa Indica Group]
Length=3986

 Score =   241 bits (616),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 105/189 (56%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698   SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
             SNE FVL+SESCIP+++F T Y+YL  S+ SF+ ++DDP  YGRGRYN  M P+++L +W
Sbjct  3798  SNEWFVLVSESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELTQW  3857

Query  518   RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
             RKGSQWFE+NR LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRS+T
Sbjct  3858  RKGSQWFEVNRELAIEIVRDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSIT  3917

Query  338   YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
             +VDWS GG HPA++   +ITE F++ ++  G +C YN   + +C+LFARKF PSALEPL 
Sbjct  3918  WVDWSRGGAHPATFGRGDITEEFLRRVQE-GRTCLYNGQNSTMCFLFARKFAPSALEPLL  3976

Query  158   KLSLKVMGF  132
             +L+  V+GF
Sbjct  3977  ELAPTVLGF  3985



>ref|XP_006344151.1| PREDICTED: uncharacterized protein LOC102582712 [Solanum tuberosum]
Length=305

 Score =   224 bits (572),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESCIP ++F T+Y YLT S  SF+ S+DDP + GRGRYN RM P+I L +W
Sbjct  117  SNERFILLSESCIPFFNFTTIYTYLTNSDQSFLGSFDDPRKIGRGRYNKRMYPNITLSDW  176

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ IVS+  +Y +FK YC P CY DEHY+PT +      + +NRSVT
Sbjct  177  RKGSQWFEVHRKLAVKIVSDVMYYPVFKNYCVPPCYMDEHYLPTLVNKVCPGLTSNRSVT  236

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GG HP ++   ++TE F++S+ S   +CSYN   + IC+LF RKF PS L+PL 
Sbjct  237  WADWSAGGSHPMTFLKKDVTEEFLKSVGSE-LNCSYNGKMSSICFLFGRKFHPSTLQPLL  295

Query  158  KLSLKVMGF  132
            +++ K++GF
Sbjct  296  RIAPKLLGF  304



>emb|CDX78439.1| BnaA03g03510D [Brassica napus]
Length=401

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP+Y+F T+Y YL++S HSFI + DDP  +GRGRYN  M+P++ + +W
Sbjct  200  SNEWFVLVSESCIPLYNFTTIYTYLSQSKHSFIGAVDDPGPFGRGRYNDNMEPEVPITKW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG QWFE++R LA  IV +  ++  F+++CRP+CY DEHY PT L +      ANRSVT
Sbjct  260  RKGPQWFELDRDLAATIVKDALYHHKFREFCRPACYSDEHYFPTMLTIEKPTALANRSVT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GGPHPA++  ++ITE F   I  +G +CSYN   T +CYLFARKF PSALEPL 
Sbjct  320  WTDWSRGGPHPATFGRSDITEEFFGKI-FDGENCSYNGRNTSMCYLFARKFAPSALEPLL  378

Query  158  KLSLKVMG  135
             ++ K+MG
Sbjct  379  HIAPKIMG  386



>gb|KHG05757.1| hypothetical protein F383_31190 [Gossypium arboreum]
Length=387

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 138/186 (74%), Gaps = 1/186 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+++F  +Y Y++ S +SF+ S+D+P  YGRGRYN  M+P++ L +W
Sbjct  200  SNEWFILLSESCIPLHNFSIIYHYISRSRYSFMGSFDEPGPYGRGRYNPHMEPEVTLSQW  259

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI IV +T +Y  FKK+CRP+CY DEHY PT L +   ++ ANR++T
Sbjct  260  RKGSQWFEVNRKLAIDIVVDTTYYPKFKKFCRPACYVDEHYFPTMLTIQSPHLLANRTLT  319

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GG HPA++  A+ITEGF + I   G  C YN   + +CYLFARKF PSAL+PL 
Sbjct  320  WTDWSRGGAHPATFGKADITEGFFKKI-FEGQVCLYNGQPSTVCYLFARKFAPSALDPLL  378

Query  158  KLSLKV  141
             L+ KV
Sbjct  379  GLASKV  384



>ref|XP_010230469.1| PREDICTED: uncharacterized protein LOC100843610 [Brachypodium 
distachyon]
Length=390

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP++DF T Y+Y   S+ SF+  +DDP  YGRGRYN  M P++++ +W
Sbjct  202  SNEWFVLVSESCIPIFDFNTTYEYFQNSSQSFVMVFDDPGPYGRGRYNDNMTPEVEITQW  261

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI IV +T++Y  FK++CRP CY DEHY PT L +      ANRSVT
Sbjct  262  RKGSQWFEVDRELAIEIVKDTRYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSVT  321

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++   +ITE F++ ++S  T C YN   + +C+LFARKF PSALEPL 
Sbjct  322  WVDWSRGGAHPATFGRGDITEEFLRRVQSKHT-CLYNNQNSTMCFLFARKFAPSALEPLL  380

Query  158  KLSLKVMGF  132
             L+  V+G+
Sbjct  381  VLAPTVLGY  389



>ref|XP_010999299.1| PREDICTED: uncharacterized protein LOC105107168 [Populus euphratica]
Length=383

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSESCIP+++F  +Y+Y+++S +SFI  +DDP  YGRGRYN  M+P++ L +W
Sbjct  196  SNEWFILLSESCIPLHNFGIIYRYISKSRYSFIGVFDDPGPYGRGRYNWNMQPEVMLDQW  255

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ ++ ++ +Y  FK +CRP CY DEHY PT L +   ++ ANRSVT
Sbjct  256  RKGSQWFEVDRKLAVSVIEDSTYYPKFKDFCRPGCYADEHYFPTMLSIQFPHLLANRSVT  315

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GG HPA++  ++IT+ F + +   G SC YN     +C+LFARKF PSALEPL 
Sbjct  316  WTDWSRGGAHPATFGNSDITDEFFKRM-FEGQSCLYNNQPDNVCFLFARKFAPSALEPLL  374

Query  158  KLSLKVMGF  132
             LS KV+GF
Sbjct  375  DLSPKVLGF  383



>emb|CDP08214.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 138/187 (74%), Gaps = 1/187 (1%)
 Frame = -2

Query  692  ERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRK  513
            E FVLLSESCIP+Y+F  +Y Y+T+S +SF+ ++DDP  +GRGRYN  M P++++ +WRK
Sbjct  109  EWFVLLSESCIPLYNFSIIYHYITKSKYSFVGAFDDPGPFGRGRYNENMAPEVQISQWRK  168

Query  512  GSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYV  333
            G+QWF++NR LA+IIV++TKFY  F ++CR  CY DEHY PT L +      ANRS+T+V
Sbjct  169  GAQWFQINRKLALIIVADTKFYPKFAEFCRSPCYVDEHYFPTMLTIQAPNQLANRSITWV  228

Query  332  DWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKL  153
            DWS GG HPA++ +A+ITE FI+ I  N T C YN   T IC+LFARKF PS L+PL  L
Sbjct  229  DWSRGGAHPATFGSADITEPFIRGILENHT-CPYNDQPTSICHLFARKFAPSTLQPLFFL  287

Query  152  SLKVMGF  132
            + K  G+
Sbjct  288  APKYFGY  294



>ref|XP_004986256.1| PREDICTED: uncharacterized protein LOC101760830 [Setaria italica]
Length=407

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 138/192 (72%), Gaps = 4/192 (2%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVL+SESCIP++DF T Y+Y   S+ SF+ S DDP R GRGRYN  M P++ L +W
Sbjct  216  SNEWFVLVSESCIPLFDFNTTYQYFQNSSQSFVMSIDDPGRDGRGRYNLNMAPEVYLEQW  275

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG QWFE++R LAI IV +T +Y  FKK+CRP CY DEHYI T L +   +  ANR+VT
Sbjct  276  RKGWQWFEVDRELAIAIVRDTLYYPKFKKFCRPGCYADEHYIQTMLTIEATHSLANRTVT  335

Query  338  YVDWSLGGP---HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALE  168
            +VDWS GGP   HPA++   +ITE F++ IR  G +C YN   + +C+LFARKF PSALE
Sbjct  336  WVDWSRGGPHAAHPATFGRGDITEEFLRGIR-GGETCMYNNQNSTMCHLFARKFAPSALE  394

Query  167  PLEKLSLKVMGF  132
            PL +L+  V+GF
Sbjct  395  PLLELAPTVLGF  406



>ref|XP_002515894.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46314.1| conserved hypothetical protein [Ricinus communis]
Length=385

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSE+CIP+++F  +Y+Y++ S HSF+ S+D+ + YGRGRYN  M+P++ L +W
Sbjct  198  SNEWFILLSEACIPLHNFSIIYRYISRSRHSFMGSFDENSPYGRGRYNWNMQPEVTLEQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR  A+ IV +T +Y  F+ +C+P+CY DEHY PT L +   ++ ANR++T
Sbjct  258  RKGSQWFEVNRRFAVNIVEDTTYYPKFRDFCQPACYVDEHYFPTMLTIQVPHLLANRTLT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GG HPA++  A+ITE F + +   G SC+YN   T +CYLFARKF PSALEPL 
Sbjct  318  WTDWSRGGAHPATFGKADITEEFFKRM-FEGQSCTYNNQPTTVCYLFARKFAPSALEPLL  376

Query  158  KLSLKVMGF  132
             LS KV GF
Sbjct  377  GLSSKVFGF  385



>emb|CBI15481.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 137/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+Y+F T+Y YL  S  SF+ESYD P   GRGRYN RMKP IK+ +W
Sbjct  177  SNQRFVLLSESCIPLYNFSTIYSYLMGSKKSFVESYDLPGPVGRGRYNPRMKPLIKMEQW  236

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R LAI ++S+ K++ +F+K+C P CY DEHY+PT + +     N+NRS+T
Sbjct  237  RKGSQWFEMDRGLAIQVISDRKYFPVFQKFCTPPCYADEHYLPTLVSVKFWRRNSNRSLT  296

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA +    +T  F++ +R NG+ C YN   +  C++FARKF P+AL+ L 
Sbjct  297  WVDWSHGGAHPARFWRVAVTVDFLKKLR-NGSHCHYNGKSSNTCFMFARKFLPNALDRLL  355

Query  158  KLSLKVMGF  132
            +   K+M F
Sbjct  356  RFGPKLMKF  364



>ref|XP_010936142.1| PREDICTED: uncharacterized protein LOC105055840 [Elaeis guineensis]
Length=395

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE FVLLSESCIP+ +F   YK+L  S HSFI + DDP  YGRGRYN  M P++ + +W
Sbjct  207  SNEWFVLLSESCIPLSNFSIAYKHLMRSRHSFIGAMDDPGPYGRGRYNLNMAPEVNITQW  266

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWF ++R  A+ IV +T +Y  F+ +C+P+CY DEHY PT L +   ++ ANRS+T
Sbjct  267  RKGSQWFAVSRKSAVSIVKDTTYYPKFENFCKPNCYVDEHYFPTLLTIESPHLLANRSIT  326

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  A+ITE FI+SI   G +C YN   T +C+LFARKF PSALEPL 
Sbjct  327  WVDWSRGGAHPATFGGADITETFIRSIL-EGHTCLYNNQSTSLCHLFARKFAPSALEPLL  385

Query  158  KLSLKVMGF  132
            +++ K++GF
Sbjct  386  QVAPKMLGF  394



>ref|XP_003524367.1| PREDICTED: uncharacterized protein LOC100815747 [Glycine max]
Length=376

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F T+Y YL  ST +F+E+YD P   GRGRY+ RM+P + L +W
Sbjct  188  SNQRFVLLSESCIPLFNFSTIYNYLMNSTETFVEAYDMPGAVGRGRYSPRMRPLVNLSQW  247

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWF+++RALAI IVS+ +++ +FKKYCR  CY DEHY+PT++ +     N+NR++T
Sbjct  248  RKGSQWFQIDRALAIEIVSDQQYFPVFKKYCRNGCYGDEHYLPTFVSIMFWKRNSNRTLT  307

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +   ++T  F++ +R +G +C YN   T IC+LFARKF P  L+ L 
Sbjct  308  WVDWSRGGPHPARFMRQDVTIDFLKRLR-HGRTCQYNGKSTNICHLFARKFNPQGLDRLL  366

Query  158  KLSLKVMGF  132
            + + ++M F
Sbjct  367  RFAPRIMQF  375



>gb|EMS51218.1| hypothetical protein TRIUR3_07068 [Triticum urartu]
Length=349

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN RF+LLSES +P++DFPTVY YLT ST  ++ESYD+P   GRGRY   M P I   +W
Sbjct  161  SNSRFILLSESHVPLFDFPTVYSYLTNSTKVYMESYDEPGGTGRGRYKRGMAPTITPWQW  220

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+RALAI IV++  ++ +FKK+C+ +CY DEHYIPT+L + H  + A R+VT
Sbjct  221  RKGSQWFEMDRALAIDIVADNVYFPVFKKFCKRNCYTDEHYIPTFLHIRHPEVAARRTVT  280

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP+ +T   +T  F++ +R  GT+C YN   T +C+LFARKF P++L    
Sbjct  281  WVDWSHGGPHPSRFTRMEVTVDFLRWLR-GGTTCEYNGRTTTVCFLFARKFLPNSLTRFL  339

Query  158  KLSLKVMGF  132
            + + KVMGF
Sbjct  340  RFAPKVMGF  348



>gb|KJB31441.1| hypothetical protein B456_005G192100 [Gossypium raimondii]
Length=399

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 139/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSE+CIP+++F TVY YL  S+ SF+ESYD P   GRGRY+ RM+P + + +W
Sbjct  210  SNQRFVLLSEACIPLFNFSTVYSYLINSSQSFVESYDLPGPVGRGRYSRRMRPQVTIQQW  269

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKG+QWFEM+R LAI +VS+  ++ +F+KYC+ +CY DEHY+PT++ +     N+NR++T
Sbjct  270  RKGAQWFEMDRDLAIEVVSDQIYFPVFQKYCKGACYADEHYLPTFVTMKFANKNSNRTLT  329

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +   N+T  F++ +RS  + C YN   T IC+LFARKF P AL  L 
Sbjct  330  WVDWSKGGPHPAKFIRTNVTVEFLERLRSQ-SQCQYNGNTTDICHLFARKFSPDALYRLL  388

Query  158  KLSLKVMGF  132
            K + KVM F
Sbjct  389  KFAPKVMQF  397



>gb|KDP40817.1| hypothetical protein JCGZ_24816 [Jatropha curcas]
Length=381

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNE F+LLSE+CIP+++F   Y+Y++ S HSF+ S+D+   YGRGRYN+ M+P++ L +W
Sbjct  194  SNEWFILLSEACIPLHNFSIFYRYISRSRHSFMGSFDELGPYGRGRYNSNMQPEVTLEQW  253

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LAI I+ +T +Y  F+ +C+P+CY DEHY PT L +   ++ ANR++T
Sbjct  254  RKGSQWFEVNRRLAINIIEDTTYYPKFRDFCQPACYVDEHYFPTMLSIKLPHLLANRTLT  313

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS GG HPA++  A+ITE F + I   G SC+YN   T +CYLFARKF PSAL+PL 
Sbjct  314  WTDWSRGGAHPATFGKADITEEFFKRI-FEGQSCTYNNQPTTVCYLFARKFAPSALDPLL  372

Query  158  KLSLKVMGF  132
             L+ KV GF
Sbjct  373  ALASKVFGF  381



>gb|KHN21596.1| hypothetical protein glysoja_023448 [Glycine soja]
Length=376

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F T+Y YL  ST +F+E+YD P   GRGRY+ RM+P + L +W
Sbjct  188  SNQRFVLLSESCIPLFNFSTIYNYLMNSTENFVEAYDMPGAVGRGRYSPRMRPLVNLSQW  247

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWF+++RALAI IVS+ +++ +FKKYCR  CY DEHY+PT++ +     N+NR++T
Sbjct  248  RKGSQWFQIDRALAIEIVSDQQYFPVFKKYCRNGCYGDEHYLPTFVSIMFWKRNSNRTLT  307

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHPA +   ++T  F++ +R +G +C YN   T IC+LFARKF P  L+ L 
Sbjct  308  WVDWSRGGPHPARFMRQDVTIDFLKRLR-HGRTCQYNGKSTNICHLFARKFNPQGLDRLL  366

Query  158  KLSLKVMGF  132
            + + ++M F
Sbjct  367  RFAPRIMQF  375



>ref|XP_004252429.1| PREDICTED: uncharacterized protein LOC101255566 [Solanum lycopersicum]
Length=324

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSE+CIP+Y+F T+Y Y+  ST +F+ESYD+    GRGRYN++M P + + +W
Sbjct  137  SNERFVLLSEACIPLYNFTTIYTYIMNSTKTFVESYDEWGPVGRGRYNSQMTPWVTIEQW  196

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R +A+ ++++ K++ +FK +CRP+CY DEHY+PT++ + + + N NR++T
Sbjct  197  RKGSQWFELDREIALDMITDQKYFNLFKDFCRPACYSDEHYLPTFVTMRYWWKNGNRTLT  256

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDW+ GGPHP  +    +T+  +  +R+ G  C YN   T +CYLFARKF PSAL+ L 
Sbjct  257  WVDWTKGGPHPTKFARTEVTKELLHQMRT-GIQCMYNGEPTNMCYLFARKFLPSALDRLL  315

Query  158  KLSLKVMGF  132
            K + KVM F
Sbjct  316  KFAPKVMMF  324



>ref|XP_010267069.1| PREDICTED: uncharacterized protein LOC104604439 isoform X1 [Nelumbo 
nucifera]
Length=385

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 138/189 (73%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVL+SESCIP+Y+F  VY ++  S +SF+ ++DDP  YGRGRYN  M P++ + +W
Sbjct  198  SNERFVLVSESCIPLYNFSIVYHHIASSRYSFMGAFDDPGPYGRGRYNQNMAPEVNITQW  257

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE+NR LA+ IV +  FY  F+++C+P+CY DEHY PT L +    + ANRS+T
Sbjct  258  RKGSQWFEINRRLAVNIVEDVTFYPKFEEFCKPACYVDEHYFPTMLTIQTPQLLANRSIT  317

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA++  A+ITE F++ I   G SC YN   + +C+LFARKF PSALEPL 
Sbjct  318  WVDWSRGGAHPATFGNADITEDFLKRIL-EGNSCLYNNLPSSVCFLFARKFSPSALEPLL  376

Query  158  KLSLKVMGF  132
             L+ K  G+
Sbjct  377  LLASKYFGY  385



>ref|XP_004300973.1| PREDICTED: uncharacterized protein LOC101293399 [Fragaria vesca 
subsp. vesca]
Length=409

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+++F TVY YLT S +SFI S+DDP   GRGRYN RM P + L +W
Sbjct  213  SNERFVLLSESCIPLFNFTTVYDYLTNSKYSFISSFDDPRGTGRGRYNRRMWPTVTLSDW  272

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ IVS+  ++ +F+  C+P CY DEHY+ T +      +N+NRS+T
Sbjct  273  RKGSQWFEVHRNLALKIVSDVTYFPIFRDLCQPPCYNDEHYLATLVTKVGPGVNSNRSIT  332

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            + DWS+GGPHPA+Y   ++ E F+  +R +G +C+YN G + IC+LFARKF PSALEPL 
Sbjct  333  WADWSIGGPHPATYERRDVNEMFLNQLR-HGFNCTYNGGISNICHLFARKFHPSALEPLL  391

Query  158  KLSLKVMGF  132
            K++  +  F
Sbjct  392  KIAPALFKF  400



>ref|XP_004238913.2| PREDICTED: uncharacterized protein LOC101249916 [Solanum lycopersicum]
Length=351

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 140/189 (74%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERF+LLSESCIP+++F T+Y YLT S  SF+ S+DDP + GRGRYN RM P+I L +W
Sbjct  163  SNERFILLSESCIPLFNFTTIYTYLTNSDQSFLGSFDDPRKIGRGRYNKRMYPNITLFDW  222

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ IVS+  +Y +FK +C P CY DEHY+PT +      + +NRSVT
Sbjct  223  RKGSQWFEIHRELAVKIVSDVLYYPVFKNHCVPPCYMDEHYLPTLVNKVCPGLTSNRSVT  282

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HP ++   ++TE F++S+ S   +CSYN   + IC+LF RKF PS L+PL 
Sbjct  283  WVDWSAGGSHPMTFLKKDVTEEFLKSVGSE-LNCSYNGKMSSICFLFGRKFHPSTLQPLL  341

Query  158  KLSLKVMGF  132
            +++ K++GF
Sbjct  342  RIAPKLLGF  350



>ref|XP_002447391.1| hypothetical protein SORBIDRAFT_06g034240 [Sorghum bicolor]
 gb|EES11719.1| hypothetical protein SORBIDRAFT_06g034240 [Sorghum bicolor]
Length=446

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVL+SESC+PV++F TVY+YL  S  S++ESY+       GRYN RM P++    W
Sbjct  258  SNQRFVLVSESCVPVFNFRTVYEYLVNSAMSYVESYNIDVPQCAGRYNPRMAPEVLEEHW  317

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGS+WFEM+R LA+ +V++ ++Y +F+++C PSCYPDEHYIPT+L L HG  NANR+VT
Sbjct  318  RKGSEWFEMSRDLAVDVVADQRYYVLFRRHCTPSCYPDEHYIPTFLHLRHGAGNANRTVT  377

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSA  174
            +VDWS GGPHPA +  A  T   + +IRSNGT C YN   T +CYLFARKF PSA
Sbjct  378  WVDWSRGGPHPARFGKAATTSDLMAAIRSNGTLCLYNGKPTTVCYLFARKFAPSA  432



>ref|XP_010265068.1| PREDICTED: uncharacterized protein LOC104602905 [Nelumbo nucifera]
Length=409

 Score =   226 bits (577),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 140/188 (74%), Gaps = 1/188 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SNERFVLLSESCIP+++F TVY YL  S  SF+ S+DDP + GRGRYN  M P + + EW
Sbjct  220  SNERFVLLSESCIPLFNFTTVYNYLINSNVSFLGSFDDPRKAGRGRYNRLMWPIVNITEW  279

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LA+ I+++ K+Y +F+ YC PSCY DEHY+PT + +    +N+NRSVT
Sbjct  280  RKGSQWFEVHRDLAVEIIADRKYYPVFQNYCTPSCYMDEHYLPTLVNMIAPELNSNRSVT  339

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS  GPHP  +   ++T+ F+  IR  GT+C+YN   T IC+LFARKF PSALEPL 
Sbjct  340  WVDWSRPGPHPGKFGWNDMTDEFLNRIRY-GTNCTYNGLPTSICFLFARKFLPSALEPLL  398

Query  158  KLSLKVMG  135
            +++  ++G
Sbjct  399  RITPLLLG  406



>ref|XP_002276828.1| PREDICTED: uncharacterized protein LOC100247520 [Vitis vinifera]
Length=390

 Score =   226 bits (575),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 137/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+Y+F T+Y YL  S  SF+ESYD P   GRGRYN RMKP IK+ +W
Sbjct  202  SNQRFVLLSESCIPLYNFSTIYSYLMGSKKSFVESYDLPGPVGRGRYNPRMKPLIKMEQW  261

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R LAI ++S+ K++ +F+K+C P CY DEHY+PT + +     N+NRS+T
Sbjct  262  RKGSQWFEMDRGLAIQVISDRKYFPVFQKFCTPPCYADEHYLPTLVSVKFWRRNSNRSLT  321

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GG HPA +    +T  F++ +R NG+ C YN   +  C++FARKF P+AL+ L 
Sbjct  322  WVDWSHGGAHPARFWRVAVTVDFLKKLR-NGSHCHYNGKSSNTCFMFARKFLPNALDRLL  380

Query  158  KLSLKVMGF  132
            +   K+M F
Sbjct  381  RFGPKLMKF  389



>ref|XP_011469419.1| PREDICTED: uncharacterized protein LOC105352951 [Fragaria vesca 
subsp. vesca]
Length=410

 Score =   226 bits (577),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 137/189 (72%), Gaps = 1/189 (1%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F T Y YL  S  SF+  +DDP + GRGRYN +M P I + +W
Sbjct  221  SNQRFVLLSESCIPLFNFTTTYDYLLNSNQSFLSVFDDPRKPGRGRYNPQMWPQINITDW  280

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFE++R LAI IVS+ K+Y +F+++C P CY DEHYIPT + + +  +N+ RS+T
Sbjct  281  RKGSQWFEVHRDLAIHIVSDRKYYPIFQQHCHPPCYIDEHYIPTLVNMLYADLNSERSIT  340

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +   +IT+ F+  IR  G+ C YN   T IC+LF RKF P ALEPL 
Sbjct  341  WVDWSRGGPHPGKFGWPDITDEFLNGIRF-GSECKYNGNMTSICFLFGRKFLPHALEPLL  399

Query  158  KLSLKVMGF  132
            +++  ++GF
Sbjct  400  RVAPLLLGF  408



>ref|XP_010045650.1| PREDICTED: uncharacterized protein LOC104434412 [Eucalyptus grandis]
Length=412

 Score =   226 bits (576),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 137/189 (72%), Gaps = 0/189 (0%)
 Frame = -2

Query  698  SNERFVLLSESCIPVYDFPTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEW  519
            SN+RFVLLSESCIP+++F T+Y YL  ST SFIE+YD P   GRGRYN RM+P I++ +W
Sbjct  224  SNQRFVLLSESCIPLFNFTTIYSYLVGSTRSFIEAYDKPGPVGRGRYNLRMRPVIQIGQW  283

Query  518  RKGSQWFEMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVT  339
            RKGSQWFEM+R LA+ +VS+ K+ ++F+++C+ SCY DEHY+PT + +     N+NRS+T
Sbjct  284  RKGSQWFEMDRGLAVEVVSDMKYISVFRRFCKGSCYSDEHYLPTLVSIKFWRRNSNRSLT  343

Query  338  YVDWSLGGPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLE  159
            +VDWS GGPHP  +    +T   ++ +R     C YN   T +C+LFARKF P+AL+ L 
Sbjct  344  WVDWSKGGPHPTRFGRWQVTVELLKRLRGGSRKCEYNGKSTSVCFLFARKFLPNALDRLL  403

Query  158  KLSLKVMGF  132
            + + KVM F
Sbjct  404  RFAPKVMEF  412



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320