BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF037N03

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011016906.1|  PREDICTED: aspartic proteinase nepenthesin-1       343   1e-112   Populus euphratica
gb|ABK95290.1|  unknown                                                 342   1e-112   Populus trichocarpa [western balsam poplar]
ref|XP_002302336.2|  chloroplast nucleoid DNA-binding family protein    342   2e-112   Populus trichocarpa [western balsam poplar]
ref|XP_011091829.1|  PREDICTED: aspartic proteinase nepenthesin-1       339   1e-111   Sesamum indicum [beniseed]
gb|KDP41467.1|  hypothetical protein JCGZ_15874                         338   4e-111   Jatropha curcas
ref|XP_002283889.2|  PREDICTED: aspartic proteinase nepenthesin-1       338   4e-111   Vitis vinifera
emb|CDP11493.1|  unnamed protein product                                338   8e-111   Coffea canephora [robusta coffee]
ref|XP_004237984.1|  PREDICTED: aspartic proteinase nepenthesin-1...    329   1e-107   Solanum lycopersicum
ref|XP_009588036.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    328   4e-107   Nicotiana tomentosiformis
ref|XP_002514026.1|  Aspartic proteinase nepenthesin-1 precursor,...    328   4e-107   Ricinus communis
dbj|BAE71208.1|  hypothetical protein                                   327   6e-107   Trifolium pratense [peavine clover]
ref|XP_004501630.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    327   9e-107   Cicer arietinum [garbanzo]
gb|EYU36857.1|  hypothetical protein MIMGU_mgv1a022460mg                327   1e-106   Erythranthe guttata [common monkey flower]
gb|EYU42951.1|  hypothetical protein MIMGU_mgv1a027000mg                327   2e-106   Erythranthe guttata [common monkey flower]
ref|XP_006366418.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    327   2e-106   Solanum tuberosum [potatoes]
ref|XP_009770124.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    325   7e-106   Nicotiana sylvestris
ref|XP_009757207.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    324   2e-105   Nicotiana sylvestris
ref|XP_009342559.1|  PREDICTED: aspartic proteinase nepenthesin-1...    324   2e-105   Pyrus x bretschneideri [bai li]
ref|XP_007137648.1|  hypothetical protein PHAVU_009G144100g             323   2e-105   Phaseolus vulgaris [French bean]
ref|XP_009373927.1|  PREDICTED: aspartic proteinase nepenthesin-1...    323   2e-105   Pyrus x bretschneideri [bai li]
ref|XP_007222165.1|  hypothetical protein PRUPE_ppa005789mg             323   3e-105   Prunus persica
ref|XP_010272925.1|  PREDICTED: aspartic proteinase nepenthesin-1...    323   4e-105   Nelumbo nucifera [Indian lotus]
ref|XP_003522749.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    320   3e-104   Glycine max [soybeans]
ref|XP_010060093.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    320   5e-104   Eucalyptus grandis [rose gum]
ref|XP_009618058.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    320   9e-104   Nicotiana tomentosiformis
ref|XP_010266126.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    319   1e-103   Nelumbo nucifera [Indian lotus]
ref|XP_008219289.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    318   2e-103   Prunus mume [ume]
ref|XP_010107692.1|  Aspartic proteinase nepenthesin-1                  317   6e-103   Morus notabilis
ref|XP_003526531.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    317   8e-103   Glycine max [soybeans]
ref|XP_004299721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    317   9e-103   Fragaria vesca subsp. vesca
ref|XP_004252715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    316   2e-102   Solanum lycopersicum
ref|XP_003602931.1|  Aspartic proteinase nepenthesin-1                  312   8e-101   Medicago truncatula
gb|EPS72919.1|  hypothetical protein M569_01840                         310   5e-100   Genlisea aurea
ref|XP_010675271.1|  PREDICTED: aspartic proteinase nepenthesin-1       309   7e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010553675.1|  PREDICTED: aspartic proteinase nepenthesin-1       309   2e-99    Tarenaya hassleriana [spider flower]
ref|XP_006338076.1|  PREDICTED: aspartic proteinase nepenthesin-1...    307   5e-99    Solanum tuberosum [potatoes]
gb|KJB29357.1|  hypothetical protein B456_005G096500                    303   2e-97    Gossypium raimondii
ref|XP_006417541.1|  hypothetical protein EUTSA_v10007613mg             302   7e-97    Eutrema salsugineum [saltwater cress]
gb|AFK46294.1|  unknown                                                 300   2e-96    Medicago truncatula
ref|XP_003519197.1|  PREDICTED: aspartic proteinase nepenthesin-1...    301   2e-96    Glycine max [soybeans]
gb|KHN09019.1|  Aspartic proteinase nepenthesin-1                       294   7e-96    Glycine soja [wild soybean]
ref|XP_007018203.1|  Eukaryotic aspartyl protease family protein        298   9e-96    
ref|XP_009110804.1|  PREDICTED: aspartic proteinase nepenthesin-1       298   2e-95    Brassica rapa
emb|CDY31067.1|  BnaA08g26170D                                          297   7e-95    Brassica napus [oilseed rape]
ref|XP_010916666.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    296   7e-95    Elaeis guineensis
gb|KFK43273.1|  hypothetical protein AALP_AA1G102700                    297   1e-94    Arabis alpina [alpine rockcress]
ref|XP_010475821.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    296   2e-94    Camelina sativa [gold-of-pleasure]
emb|CDY20675.1|  BnaC08g13830D                                          296   2e-94    Brassica napus [oilseed rape]
ref|XP_009376250.1|  PREDICTED: aspartic proteinase nepenthesin-1...    295   3e-94    Pyrus x bretschneideri [bai li]
ref|XP_004148418.1|  PREDICTED: aspartic proteinase nepenthesin-1...    295   3e-94    Cucumis sativus [cucumbers]
ref|XP_010490295.1|  PREDICTED: aspartic proteinase nepenthesin-1...    295   3e-94    Camelina sativa [gold-of-pleasure]
gb|KHN26127.1|  Aspartic proteinase nepenthesin-1                       292   9e-94    Glycine soja [wild soybean]
ref|XP_008378576.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    293   1e-93    
ref|XP_010458274.1|  PREDICTED: aspartic proteinase nepenthesin-1...    294   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_006307264.1|  hypothetical protein CARUB_v10008880mg             295   1e-93    
emb|CAN74010.1|  hypothetical protein VITISV_003547                     293   1e-93    Vitis vinifera
ref|XP_008795166.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    292   2e-93    Phoenix dactylifera
ref|XP_007141254.1|  hypothetical protein PHAVU_008G180500g             292   7e-93    Phaseolus vulgaris [French bean]
ref|XP_002889768.1|  hypothetical protein ARALYDRAFT_471076             286   9e-91    
ref|XP_008444946.1|  PREDICTED: aspartic proteinase nepenthesin-1       284   4e-90    Cucumis melo [Oriental melon]
ref|XP_009387158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    285   4e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAK44106.2|AF370291_1  unknown protein                               281   1e-89    Arabidopsis thaliana [mouse-ear cress]
ref|NP_563851.1|  aspartyl protease-like protein                        282   4e-89    Arabidopsis thaliana [mouse-ear cress]
gb|EAY88829.1|  hypothetical protein OsI_10302                          275   1e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_003558637.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    273   6e-86    Brachypodium distachyon [annual false brome]
ref|NP_001049205.1|  Os03g0186900                                       273   6e-86    
ref|XP_006841210.1|  hypothetical protein AMTR_s00135p00030880          272   1e-85    
gb|ACN34435.1|  unknown                                                 259   2e-83    Zea mays [maize]
gb|ACF87730.1|  unknown                                                 259   2e-83    Zea mays [maize]
ref|XP_008231689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    263   4e-82    Prunus mume [ume]
gb|ACE96805.1|  aspartyl protease                                       259   1e-81    Populus tremula [European aspen]
ref|XP_010269414.1|  PREDICTED: aspartic proteinase nepenthesin-1...    262   2e-81    Nelumbo nucifera [Indian lotus]
gb|ACE96817.1|  aspartyl protease                                       258   3e-81    Populus tremula [European aspen]
ref|XP_007218027.1|  hypothetical protein PRUPE_ppa005966mg             261   3e-81    Prunus persica
gb|ACF83459.1|  unknown                                                 261   4e-81    Zea mays [maize]
ref|NP_001131154.1|  uncharacterized protein LOC100192462 precursor     261   4e-81    
ref|NP_001266543.1|  aspartic proteinase nepenthesin-1 precursor        261   4e-81    
ref|XP_002461152.1|  hypothetical protein SORBIDRAFT_02g041760          261   6e-81    Sorghum bicolor [broomcorn]
ref|XP_006649524.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    259   2e-80    Oryza brachyantha
ref|XP_010095993.1|  Aspartic proteinase nepenthesin-1                  259   2e-80    
gb|EMS48821.1|  Aspartic proteinase nepenthesin-1                       254   3e-80    Triticum urartu
dbj|BAJ92880.1|  predicted protein                                      258   1e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004511040.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    257   2e-79    Cicer arietinum [garbanzo]
ref|XP_007148927.1|  hypothetical protein PHAVU_005G025900g             256   2e-79    Phaseolus vulgaris [French bean]
ref|XP_007133749.1|  hypothetical protein PHAVU_011G206100g             256   3e-79    Phaseolus vulgaris [French bean]
gb|KHG15852.1|  Asparticase nepenthesin-1                               252   4e-79    Gossypium arboreum [tree cotton]
gb|AGV54394.1|  aspartic proteinase nepenthesin-1-like protein          256   4e-79    Phaseolus vulgaris [French bean]
ref|XP_004985428.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    256   5e-79    
ref|XP_009139245.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    255   6e-79    Brassica rapa
ref|XP_008375374.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    255   9e-79    Malus domestica [apple tree]
emb|CDX76150.1|  BnaA04g04140D                                          255   9e-79    
ref|XP_010276658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    255   9e-79    Nelumbo nucifera [Indian lotus]
gb|EMT23351.1|  Aspartic proteinase nepenthesin-1                       249   1e-78    
gb|KJB60281.1|  hypothetical protein B456_009G297800                    254   1e-78    Gossypium raimondii
emb|CDY13202.1|  BnaC04g26330D                                          254   1e-78    Brassica napus [oilseed rape]
ref|XP_002513044.1|  Aspartic proteinase nepenthesin-1 precursor,...    254   1e-78    Ricinus communis
ref|XP_002303933.2|  hypothetical protein POPTR_0003s19490g             254   1e-78    Populus trichocarpa [western balsam poplar]
ref|XP_002877976.1|  hypothetical protein ARALYDRAFT_906847             254   1e-78    Arabidopsis lyrata subsp. lyrata
ref|XP_008782021.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   1e-78    Phoenix dactylifera
ref|XP_010504244.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   2e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010032290.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   2e-78    Eucalyptus grandis [rose gum]
ref|XP_010032289.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   3e-78    Eucalyptus grandis [rose gum]
gb|AAM66983.1|  nucleoid DNA-binding-like protein                       253   3e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011020416.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    254   3e-78    Populus euphratica
ref|NP_001266528.1|  aspartic proteinase nepenthesin-1 precursor        254   3e-78    
ref|NP_191008.1|  aspartyl protease family protein                      253   3e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530469.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    253   3e-78    Tarenaya hassleriana [spider flower]
gb|EEE67743.1|  hypothetical protein OsJ_25435                          252   5e-78    Oryza sativa Japonica Group [Japonica rice]
gb|KHG09833.1|  Asparticase nepenthesin-1                               253   5e-78    Gossypium arboreum [tree cotton]
ref|NP_001130306.1|  uncharacterized protein LOC100191400 precursor     253   5e-78    Zea mays [maize]
gb|KDP40540.1|  hypothetical protein JCGZ_24539                         253   5e-78    Jatropha curcas
ref|XP_010427138.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    253   6e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010515967.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    253   6e-78    Camelina sativa [gold-of-pleasure]
gb|KHN13065.1|  Aspartic proteinase nepenthesin-1                       251   7e-78    Glycine soja [wild soybean]
ref|XP_004958568.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    253   9e-78    Setaria italica
ref|NP_001060521.1|  Os07g0658600                                       253   1e-77    
ref|XP_002468370.1|  hypothetical protein SORBIDRAFT_01g044790          251   1e-77    
ref|XP_006291188.1|  hypothetical protein CARUB_v10017317mg             251   1e-77    Capsella rubella
emb|CDY71517.1|  BnaCnng73250D                                          247   1e-77    Brassica napus [oilseed rape]
ref|XP_007010960.1|  Eukaryotic aspartyl protease family protein        251   2e-77    
ref|XP_004498691.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   2e-77    Cicer arietinum [garbanzo]
gb|KHN37680.1|  Aspartic proteinase nepenthesin-1                       251   4e-77    Glycine soja [wild soybean]
ref|XP_011000582.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    250   4e-77    Populus euphratica
ref|XP_002460277.1|  hypothetical protein SORBIDRAFT_02g025885          248   5e-77    
ref|XP_006432439.1|  hypothetical protein CICLE_v10001212mg             250   5e-77    Citrus clementina [clementine]
gb|KJB74994.1|  hypothetical protein B456_012G018300                    250   7e-77    Gossypium raimondii
emb|CDP17284.1|  unnamed protein product                                250   7e-77    Coffea canephora [robusta coffee]
ref|XP_010938557.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    250   8e-77    Elaeis guineensis
gb|ABK92955.1|  unknown                                                 249   9e-77    Populus trichocarpa [western balsam poplar]
ref|XP_002299201.1|  aspartyl protease family protein                   248   2e-76    Populus trichocarpa [western balsam poplar]
ref|XP_003598487.1|  Peptidase A1, putative                             248   2e-76    
gb|AES68738.2|  aspartic proteinase nepenthesin-like protein            248   2e-76    Medicago truncatula
ref|NP_001241567.1|  uncharacterized protein LOC100819698 precursor     248   5e-76    Glycine max [soybeans]
gb|KEH40928.1|  aspartic proteinase nepenthesin-like protein            247   7e-76    Medicago truncatula
ref|XP_004170756.1|  PREDICTED: aspartic proteinase nepenthesin-1...    245   8e-76    
ref|XP_009411751.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    247   1e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009372766.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   2e-75    Pyrus x bretschneideri [bai li]
gb|KFK34672.1|  hypothetical protein AALP_AA5G176500                    246   3e-75    Arabis alpina [alpine rockcress]
emb|CDX78233.1|  BnaA09g34280D                                          246   3e-75    
ref|XP_008348078.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   3e-75    Malus domestica [apple tree]
ref|XP_009116125.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   3e-75    Brassica rapa
ref|XP_006403580.1|  hypothetical protein EUTSA_v10010398mg             245   4e-75    Eutrema salsugineum [saltwater cress]
ref|XP_003522900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    246   4e-75    Glycine max [soybeans]
gb|KJB58890.1|  hypothetical protein B456_009G230400                    244   7e-75    Gossypium raimondii
ref|XP_004142420.1|  PREDICTED: aspartic proteinase nepenthesin-1...    244   1e-74    Cucumis sativus [cucumbers]
ref|XP_010523939.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   1e-74    Tarenaya hassleriana [spider flower]
ref|XP_008803347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   2e-74    
ref|XP_003538263.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    244   2e-74    Glycine max [soybeans]
emb|CBI35120.3|  unnamed protein product                                240   3e-74    Vitis vinifera
ref|XP_003627883.1|  Aspartic proteinase nepenthesin-1                  243   3e-74    Medicago truncatula
gb|AFK35790.1|  unknown                                                 243   3e-74    Medicago truncatula
emb|CAN69536.1|  hypothetical protein VITISV_043237                     241   3e-74    Vitis vinifera
ref|XP_010067725.1|  PREDICTED: aspartic proteinase nepenthesin-1...    243   4e-74    Eucalyptus grandis [rose gum]
ref|XP_008446966.1|  PREDICTED: aspartic proteinase nepenthesin-1       243   4e-74    Cucumis melo [Oriental melon]
emb|CBI19249.3|  unnamed protein product                                234   6e-74    Vitis vinifera
ref|XP_009380234.1|  PREDICTED: aspartic proteinase nepenthesin-1...    242   1e-73    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB73115.1|  hypothetical protein B456_011G215800                    237   2e-73    Gossypium raimondii
ref|XP_002264626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    240   4e-73    Vitis vinifera
ref|XP_010926983.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    241   4e-73    Elaeis guineensis
ref|XP_004307094.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    240   5e-73    Fragaria vesca subsp. vesca
gb|AFK39308.1|  unknown                                                 239   1e-72    Medicago truncatula
gb|KJB73114.1|  hypothetical protein B456_011G215800                    238   3e-72    Gossypium raimondii
gb|KHG22262.1|  Asparticase nepenthesin-1                               238   4e-72    Gossypium arboreum [tree cotton]
ref|XP_011091849.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    236   2e-71    Sesamum indicum [beniseed]
ref|XP_010922206.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    236   4e-71    Elaeis guineensis
ref|XP_004971304.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    235   7e-71    Setaria italica
ref|XP_010547361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    234   7e-71    Tarenaya hassleriana [spider flower]
ref|XP_006368623.1|  hypothetical protein POPTR_0001s06560g             233   2e-70    
ref|XP_010670495.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    234   2e-70    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010557871.1|  PREDICTED: aspartic proteinase nepenthesin-1...    234   2e-70    Tarenaya hassleriana [spider flower]
gb|EPS64285.1|  hypothetical protein M569_10492                         233   2e-70    Genlisea aurea
ref|XP_010495094.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    233   2e-70    
ref|XP_006645377.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    233   3e-70    Oryza brachyantha
ref|XP_010452650.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    233   4e-70    
ref|XP_010423263.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    231   1e-69    Camelina sativa [gold-of-pleasure]
ref|XP_006854820.1|  hypothetical protein AMTR_s00063p00187740          231   1e-69    Amborella trichopoda
gb|EAY77272.1|  hypothetical protein OsI_05246                          231   2e-69    Oryza sativa Indica Group [Indian rice]
ref|XP_009593615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    231   3e-69    Nicotiana tomentosiformis
ref|NP_001045434.1|  Os01g0954900                                       231   3e-69    
gb|KFK25095.1|  hypothetical protein AALP_AA8G065800                    230   5e-69    Arabis alpina [alpine rockcress]
ref|XP_009778175.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    230   5e-69    Nicotiana sylvestris
dbj|BAB11161.1|  nucleoid DNA-binding-like protein                      229   6e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873291.1|  hypothetical protein ARALYDRAFT_487523             229   1e-68    Arabidopsis lyrata subsp. lyrata
ref|NP_196320.2|  aspartyl protease family protein                      229   2e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287717.1|  hypothetical protein CARUB_v10000927mg             229   2e-68    Capsella rubella
ref|XP_008806589.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    228   3e-68    
ref|XP_006658916.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    222   5e-68    
ref|XP_006347658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    227   6e-68    Solanum tuberosum [potatoes]
ref|XP_008656859.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    227   8e-68    
emb|CDX99015.1|  BnaC09g48200D                                          226   1e-67    
ref|XP_009122387.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    226   1e-67    Brassica rapa
ref|XP_004230031.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    226   1e-67    Solanum lycopersicum
emb|CDX70001.1|  BnaA10g23500D                                          226   1e-67    
gb|EYU38286.1|  hypothetical protein MIMGU_mgv1a006610mg                225   3e-67    Erythranthe guttata [common monkey flower]
ref|XP_009130976.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    224   1e-66    Brassica rapa
emb|CDY58878.1|  BnaA03g55560D                                          223   2e-66    Brassica napus [oilseed rape]
emb|CDX81031.1|  BnaC03g02850D                                          224   2e-66    
ref|XP_006399181.1|  hypothetical protein EUTSA_v10013504mg             222   8e-66    Eutrema salsugineum [saltwater cress]
tpg|DAA49885.1|  TPA: hypothetical protein ZEAMMB73_545054              219   8e-64    
gb|AFW71790.1|  hypothetical protein ZEAMMB73_638381                    218   2e-63    
gb|AFW71789.1|  hypothetical protein ZEAMMB73_638381                    218   5e-63    
gb|KHN25061.1|  Aspartic proteinase nepenthesin-1                       202   4e-62    Glycine soja [wild soybean]
ref|XP_003559856.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    212   7e-62    Brachypodium distachyon [annual false brome]
ref|XP_003567490.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    211   2e-61    Brachypodium distachyon [annual false brome]
gb|EEE56022.1|  hypothetical protein OsJ_04800                          204   4e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011088726.1|  PREDICTED: aspartic proteinase nepenthesin-1...    201   8e-58    Sesamum indicum [beniseed]
gb|EPS70765.1|  hypothetical protein M569_03988                         197   9e-57    Genlisea aurea
gb|EEE58460.1|  hypothetical protein OsJ_09701                          178   4e-50    Oryza sativa Japonica Group [Japonica rice]
gb|KHN21324.1|  Aspartic proteinase nepenthesin-1                       168   3e-46    Glycine soja [wild soybean]
dbj|BAJ04354.1|  pollen allergen CPA63                                  166   2e-44    Cryptomeria japonica
emb|CAA06698.1|  hypothetical protein                                   154   7e-44    Cicer arietinum [garbanzo]
gb|ACU24323.1|  unknown                                                 152   2e-40    Glycine max [soybeans]
ref|XP_002459115.1|  hypothetical protein SORBIDRAFT_03g046190          143   6e-39    
gb|EMT24179.1|  Aspartic proteinase nepenthesin-2                       127   1e-32    
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg             129   3e-31    Citrus clementina [clementine]
ref|XP_006491285.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   3e-31    Citrus sinensis [apfelsine]
ref|XP_006345762.1|  PREDICTED: aspartic proteinase nepenthesin-1...    128   6e-31    Solanum tuberosum [potatoes]
gb|KEH24641.1|  eukaryotic aspartyl protease family protein             127   1e-30    Medicago truncatula
gb|ABR18297.1|  unknown                                                 127   2e-30    Picea sitchensis
emb|CDY15187.1|  BnaC05g00660D                                          126   4e-30    Brassica napus [oilseed rape]
ref|XP_004168776.1|  PREDICTED: aspartic proteinase nepenthesin-1...    125   5e-30    
gb|KGN54860.1|  hypothetical protein Csa_4G554680                       125   5e-30    Cucumis sativus [cucumbers]
ref|XP_004239638.1|  PREDICTED: aspartic proteinase nepenthesin-1       125   8e-30    Solanum lycopersicum
ref|XP_009398943.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   1e-29    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009801916.1|  PREDICTED: aspartic proteinase nepenthesin-1       125   1e-29    Nicotiana sylvestris
ref|XP_007051537.1|  Eukaryotic aspartyl protease family protein ...    125   1e-29    
emb|CDX90023.1|  BnaA10g00590D                                          124   1e-29    
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   2e-29    Brassica rapa
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   2e-29    
ref|XP_009625615.1|  PREDICTED: aspartic proteinase nepenthesin-1       124   2e-29    Nicotiana tomentosiformis
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   2e-29    
ref|XP_009106694.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   3e-29    Brassica rapa
gb|ABK24493.1|  unknown                                                 124   3e-29    Picea sitchensis
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   3e-29    Cucumis melo [Oriental melon]
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   4e-29    Solanum tuberosum [potatoes]
ref|XP_010099762.1|  Aspartic proteinase nepenthesin-1                  123   4e-29    Morus notabilis
emb|CDP08669.1|  unnamed protein product                                123   4e-29    Coffea canephora [robusta coffee]
ref|XP_004144695.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    125   4e-29    
ref|XP_008442220.1|  PREDICTED: aspartic proteinase nepenthesin-1       123   5e-29    Cucumis melo [Oriental melon]
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   5e-29    Cucumis sativus [cucumbers]
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                       123   7e-29    Cucumis sativus [cucumbers]
gb|ACN40790.1|  unknown                                                 122   7e-29    Picea sitchensis
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   9e-29    Cucumis sativus [cucumbers]
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...    122   1e-28    Ricinus communis
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   1e-28    Solanum lycopersicum
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660          122   1e-28    Amborella trichopoda
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   1e-28    Tarenaya hassleriana [spider flower]
gb|EMT01748.1|  Aspartic proteinase nepenthesin-1                       122   1e-28    
ref|XP_003523200.1|  PREDICTED: aspartic proteinase nepenthesin-1...    122   1e-28    Glycine max [soybeans]
gb|ABK24467.1|  unknown                                                 122   1e-28    Picea sitchensis
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                    122   1e-28    Arabis alpina [alpine rockcress]
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg                122   1e-28    Erythranthe guttata [common monkey flower]
gb|ACJ85276.1|  unknown                                                 115   1e-28    Medicago truncatula
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   1e-28    Glycine max [soybeans]
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   1e-28    Glycine max [soybeans]
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg             122   2e-28    Eutrema salsugineum [saltwater cress]
gb|EYU35730.1|  hypothetical protein MIMGU_mgv1a006461mg                121   2e-28    Erythranthe guttata [common monkey flower]
gb|KDP28482.1|  hypothetical protein JCGZ_14253                         121   2e-28    Jatropha curcas
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   2e-28    Camelina sativa [gold-of-pleasure]
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   2e-28    Camelina sativa [gold-of-pleasure]
gb|EMT00623.1|  Aspartic proteinase nepenthesin-1                       118   2e-28    
ref|XP_010053832.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   2e-28    Eucalyptus grandis [rose gum]
gb|KJB09627.1|  hypothetical protein B456_001G154400                    121   2e-28    Gossypium raimondii
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   2e-28    Pyrus x bretschneideri [bai li]
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg             121   3e-28    Capsella rubella
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g             121   3e-28    Phaseolus vulgaris [French bean]
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   3e-28    Populus euphratica
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   3e-28    Sesamum indicum [beniseed]
ref|XP_009775618.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   3e-28    Nicotiana sylvestris
ref|XP_010665756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   3e-28    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB09626.1|  hypothetical protein B456_001G154400                    120   3e-28    Gossypium raimondii
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   3e-28    Camelina sativa [gold-of-pleasure]
ref|XP_007048585.1|  Eukaryotic aspartyl protease family protein        120   4e-28    
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   4e-28    Nicotiana tomentosiformis
gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg                120   4e-28    Erythranthe guttata [common monkey flower]
ref|XP_008376086.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   4e-28    Malus domestica [apple tree]
ref|XP_002263964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   4e-28    Vitis vinifera
ref|XP_011045692.1|  PREDICTED: aspartic proteinase nepenthesin-1...    120   5e-28    Populus euphratica
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   6e-28    
gb|EYU42927.1|  hypothetical protein MIMGU_mgv1a0098262mg               115   6e-28    
gb|KHN09660.1|  Aspartic proteinase nepenthesin-1                       119   6e-28    
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   6e-28    
ref|XP_001784204.1|  predicted protein                                  119   6e-28    
ref|XP_007051536.1|  Eukaryotic aspartyl protease family protein ...    120   6e-28    
ref|XP_004503002.1|  PREDICTED: aspartic proteinase nepenthesin-1...    120   7e-28    
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   7e-28    
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                  120   7e-28    
ref|XP_010025709.1|  PREDICTED: aspartic proteinase nepenthesin-1       119   7e-28    
gb|ABR17085.1|  unknown                                                 120   8e-28    
ref|XP_002986620.1|  hypothetical protein SELMODRAFT_124369             119   9e-28    
ref|XP_007217966.1|  hypothetical protein PRUPE_ppa005289mg             119   1e-27    
ref|XP_002965292.1|  hypothetical protein SELMODRAFT_83230              119   1e-27    
ref|XP_002458414.1|  hypothetical protein SORBIDRAFT_03g033075          119   1e-27    
emb|CDX88562.1|  BnaC06g40060D                                          119   2e-27    
ref|XP_002302634.2|  aspartyl protease family protein                   119   2e-27    
gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg                119   2e-27    
ref|XP_002892074.1|  aspartyl protease family protein                   119   2e-27    
ref|NP_171637.1|  aspartyl protease family protein                      119   2e-27    
ref|XP_002272802.1|  PREDICTED: aspartic proteinase nepenthesin-1       118   2e-27    
ref|NP_191741.1|  aspartyl protease                                     118   2e-27    
ref|XP_002320868.1|  aspartyl protease family protein                   118   2e-27    
ref|XP_010514086.1|  PREDICTED: aspartic proteinase nepenthesin-1...    118   2e-27    
dbj|BAK03220.1|  predicted protein                                      118   3e-27    
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein          118   3e-27    
gb|EMS66780.1|  Aspartic proteinase nepenthesin-1                       117   3e-27    
ref|XP_004306664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   3e-27    
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   3e-27    
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor             118   3e-27    
ref|XP_002264056.1|  PREDICTED: aspartic proteinase nepenthesin-1       117   4e-27    
emb|CDM80984.1|  unnamed protein product                                118   4e-27    
ref|XP_001757102.1|  predicted protein                                  117   4e-27    
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   4e-27    
ref|XP_006370905.1|  aspartyl protease family protein                   117   4e-27    
emb|CAN79341.1|  hypothetical protein VITISV_006338                     117   4e-27    
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g             117   5e-27    
gb|EPS66029.1|  hypothetical protein M569_08742                         117   5e-27    
ref|XP_006658637.1|  PREDICTED: aspartic proteinase nepenthesin-1...    116   5e-27    
ref|XP_011046330.1|  PREDICTED: aspartic proteinase nepenthesin-1...    117   5e-27    
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   5e-27    
ref|XP_003526889.1|  PREDICTED: aspartic proteinase nepenthesin-1...    117   6e-27    
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   8e-27    
gb|KEH35638.1|  aspartic proteinase nepenthesin                         116   9e-27    
ref|XP_006291078.1|  hypothetical protein CARUB_v10017196mg             116   9e-27    
emb|CDX87358.1|  BnaA07g35150D                                          116   9e-27    
gb|ABR17396.1|  unknown                                                 115   9e-27    
ref|XP_002522914.1|  Aspartic proteinase nepenthesin-1 precursor,...    116   1e-26    
ref|NP_001043485.1|  Os01g0598600                                       116   1e-26    
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   1e-26    
ref|XP_010425104.1|  PREDICTED: aspartic proteinase nepenthesin-1...    116   1e-26    
ref|XP_002300215.2|  aspartyl protease family protein                   116   1e-26    
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   1e-26    
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   1e-26    
gb|KJB73116.1|  hypothetical protein B456_011G215800                    114   2e-26    
ref|XP_008777368.1|  PREDICTED: aspartic proteinase nepenthesin-2       115   2e-26    
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   2e-26    
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   2e-26    
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   2e-26    
gb|AAC34482.2|  putative chloroplast nucleoid DNA binding protein       115   2e-26    
ref|XP_010502327.1|  PREDICTED: aspartic proteinase nepenthesin-1...    115   2e-26    
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative      115   2e-26    
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   2e-26    
dbj|BAJ86414.1|  predicted protein                                      115   3e-26    
ref|XP_002876869.1|  aspartyl protease family protein                   115   3e-26    
ref|XP_010548000.1|  PREDICTED: aspartic proteinase nepenthesin-1...    115   3e-26    
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    115   3e-26    
ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   3e-26    
ref|XP_009800816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   3e-26    
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   3e-26    
gb|ABK24480.1|  unknown                                                 115   3e-26    
ref|NP_565298.2|  aspartyl protease family protein                      115   4e-26    
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   4e-26    
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   4e-26    
ref|XP_009410092.1|  PREDICTED: aspartic proteinase nepenthesin-2...    114   5e-26    
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg             114   5e-26    
ref|XP_006395734.1|  hypothetical protein EUTSA_v10004149mg             114   5e-26    
ref|XP_002878415.1|  aspartyl protease family protein                   114   5e-26    
ref|XP_006843768.1|  hypothetical protein AMTR_s00007p00241440          114   6e-26    
ref|XP_004147103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   6e-26    
gb|KJB49569.1|  hypothetical protein B456_008G125700                    114   6e-26    
ref|XP_003578209.1|  PREDICTED: aspartic proteinase nepenthesin-1...    114   6e-26    
ref|XP_008795461.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   7e-26    
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   8e-26    
ref|XP_009394177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   8e-26    
emb|CDY43952.1|  BnaC04g21580D                                          114   8e-26    
ref|XP_007137735.1|  hypothetical protein PHAVU_009G151500g             114   9e-26    
emb|CDP04617.1|  unnamed protein product                                113   1e-25    
ref|XP_008659133.1|  PREDICTED: aspartic proteinase nepenthesin-1...    113   1e-25    
dbj|BAK07248.1|  predicted protein                                      114   1e-25    
ref|XP_010918360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   1e-25    
emb|CDX89133.1|  BnaA04g00530D                                          114   1e-25    
gb|EAZ04168.1|  hypothetical protein OsI_26310                          113   1e-25    
ref|XP_009138753.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   1e-25    
emb|CDY03014.1|  BnaC07g22130D                                          113   1e-25    
ref|XP_004957916.1|  PREDICTED: aspartic proteinase nepenthesin-1...    113   1e-25    
ref|NP_001059858.1|  Os07g0533800                                       113   2e-25    
dbj|BAC15912.1|  putative nucleoid DNA-binding protein cnd41            113   2e-25    
gb|KFK35370.1|  hypothetical protein AALP_AA5G276300                    113   2e-25    
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   2e-25    
ref|XP_004956985.1|  PREDICTED: aspartic proteinase nepenthesin-1...    113   2e-25    
gb|KJB71343.1|  hypothetical protein B456_011G117400                    112   2e-25    
ref|XP_002462959.1|  hypothetical protein SORBIDRAFT_02g035310          112   2e-25    
ref|XP_010924503.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   2e-25    
ref|XP_009104505.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   2e-25    
emb|CDX67980.1|  BnaA07g20200D                                          113   2e-25    
ref|XP_008675097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   2e-25    
ref|XP_004957917.1|  PREDICTED: aspartic proteinase nepenthesin-1...    112   2e-25    
ref|XP_010472845.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   2e-25    
ref|XP_011097033.1|  PREDICTED: aspartic proteinase nepenthesin-1       112   2e-25    
gb|AFK40811.1|  unknown                                                 108   3e-25    
ref|XP_010417641.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   3e-25    
gb|AFK42325.1|  unknown                                                 109   3e-25    
ref|XP_002436674.1|  hypothetical protein SORBIDRAFT_10g006870          112   3e-25    
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966              111   3e-25    
ref|XP_008381436.1|  PREDICTED: aspartic proteinase nepenthesin-1       112   3e-25    
gb|KDP34587.1|  hypothetical protein JCGZ_12216                         112   3e-25    
emb|CDX67868.1|  BnaA07g19080D                                          112   3e-25    
emb|CDX79338.1|  BnaC06g19650D                                          112   4e-25    
ref|XP_003562987.1|  PREDICTED: aspartic proteinase nepenthesin-1...    112   4e-25    
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971              111   4e-25    
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   5e-25    
ref|XP_010907568.1|  PREDICTED: aspartic proteinase nepenthesin-2       111   5e-25    
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970          112   5e-25    
gb|KJB40511.1|  hypothetical protein B456_007G067200                    111   5e-25    
ref|XP_009152211.1|  PREDICTED: aspartic proteinase nepenthesin-1...    111   5e-25    
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   6e-25    
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   6e-25    
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g             111   6e-25    
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   6e-25    
ref|XP_010034049.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   7e-25    
gb|KDP29378.1|  hypothetical protein JCGZ_18299                         111   8e-25    
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   8e-25    
gb|KFK33485.1|  hypothetical protein AALP_AA5G019300                    111   8e-25    
ref|XP_002445452.1|  hypothetical protein SORBIDRAFT_07g019450          111   8e-25    
gb|EMT15086.1|  Aspartic proteinase nepenthesin-1                       105   9e-25    
ref|XP_002513132.1|  Aspartic proteinase nepenthesin-1 precursor,...    111   1e-24    
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630          111   1e-24    
gb|EMS57521.1|  Aspartic proteinase nepenthesin-1                       110   1e-24    
ref|XP_002460314.1|  hypothetical protein SORBIDRAFT_02g026340          110   1e-24    
gb|EAY72467.1|  hypothetical protein OsI_00323                          111   1e-24    
gb|KDO58699.1|  hypothetical protein CISIN_1g013672mg                   110   1e-24    
ref|NP_001130524.1|  uncharacterized protein LOC100191623               109   1e-24    
ref|XP_006426445.1|  hypothetical protein CICLE_v10025623mg             110   1e-24    
ref|XP_006466172.1|  PREDICTED: aspartic proteinase nepenthesin-1...    110   1e-24    
gb|EMS49734.1|  Aspartic proteinase nepenthesin-1                       109   1e-24    
ref|NP_001150925.1|  aspartic proteinase nepenthesin-1                  110   2e-24    
ref|XP_009386344.1|  PREDICTED: aspartic proteinase nepenthesin-2...    110   2e-24    
ref|XP_006389854.1|  hypothetical protein EUTSA_v10018461mg             110   2e-24    
emb|CDY45178.1|  BnaA06g33820D                                          110   2e-24    
ref|NP_001041979.1|  Os01g0140100                                       110   2e-24    
emb|CDY17408.1|  BnaC09g21290D                                          110   2e-24    
gb|ABK24255.1|  unknown                                                 110   2e-24    
emb|CBI19032.3|  unnamed protein product                                109   2e-24    
gb|EPS61272.1|  hypothetical protein M569_13524                         110   2e-24    
ref|XP_001773068.1|  predicted protein                                  109   2e-24    
emb|CDM83204.1|  unnamed protein product                                110   3e-24    
tpg|DAA40199.1|  TPA: hypothetical protein ZEAMMB73_627989              109   3e-24    
ref|XP_008668084.1|  PREDICTED: aspartic proteinase nepenthesin-1...    109   3e-24    
ref|XP_009600181.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   3e-24    
emb|CDY25081.1|  BnaC06g18230D                                          109   3e-24    
tpg|DAA41039.1|  TPA: aspartic proteinase nepenthesin-1                 109   3e-24    
ref|XP_002468182.1|  hypothetical protein SORBIDRAFT_01g041210          109   3e-24    
gb|AAF68120.1|AC010793_15  F20B17.14                                    109   3e-24    
ref|XP_002889266.1|  aspartyl protease family protein                   109   4e-24    
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g             109   4e-24    
ref|XP_006845396.1|  hypothetical protein AMTR_s00019p00061190          109   4e-24    
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504              109   5e-24    
gb|ABR16474.1|  unknown                                                 110   5e-24    
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                    109   5e-24    
ref|XP_007215297.1|  hypothetical protein PRUPE_ppa005040mg             109   5e-24    
ref|XP_010664223.1|  PREDICTED: aspartic proteinase nepenthesin-1...    108   5e-24    
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   5e-24    
ref|XP_009114173.1|  PREDICTED: aspartic proteinase nepenthesin-1       108   5e-24    
ref|XP_002315953.1|  aspartyl protease family protein                   108   6e-24    
ref|NP_001168599.1|  uncharacterized protein LOC100382383               107   6e-24    
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   6e-24    
ref|NP_001183392.1|  uncharacterized protein LOC100501808               107   6e-24    
ref|XP_004303222.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   7e-24    
ref|NP_565219.1|  eukaryotic aspartyl protease family protein           108   7e-24    
ref|XP_008228848.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   7e-24    
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   7e-24    
ref|XP_006345303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   7e-24    
ref|XP_010674342.1|  PREDICTED: aspartic proteinase nepenthesin-1       108   7e-24    
ref|XP_004972145.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   7e-24    
dbj|BAJ92327.1|  predicted protein                                      108   7e-24    
ref|XP_009375476.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   9e-24    
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   9e-24    
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   9e-24    
ref|XP_002529147.1|  Aspartic proteinase nepenthesin-1 precursor,...    108   9e-24    
ref|XP_006403579.1|  hypothetical protein EUTSA_v10010398mg             107   9e-24    
ref|XP_009363121.1|  PREDICTED: aspartic proteinase nepenthesin-1       108   1e-23    
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    108   1e-23    
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   1e-23    
ref|XP_010429875.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   1e-23    
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048              107   1e-23    
ref|XP_006362549.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   1e-23    
gb|KCW48530.1|  hypothetical protein EUGRSUZ_K02206                     108   1e-23    
ref|XP_008227834.1|  PREDICTED: aspartic proteinase nepenthesin-1       107   1e-23    
ref|NP_001142400.1|  uncharacterized protein LOC100274575               107   1e-23    
ref|XP_010258628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   2e-23    
gb|KDP20100.1|  hypothetical protein JCGZ_05869                         107   2e-23    
ref|XP_007221482.1|  hypothetical protein PRUPE_ppa005446mg             107   2e-23    
gb|AAM66069.1|  putative aspartyl protease                              107   2e-23    
ref|XP_010908060.1|  PREDICTED: aspartic proteinase nepenthesin-1...    107   2e-23    
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039              107   2e-23    
tpg|DAA62978.1|  TPA: aspartic proteinase nepenthesin-1                 107   2e-23    
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358              107   2e-23    
ref|XP_008777073.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   2e-23    
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   2e-23    
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   2e-23    
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   3e-23    
ref|XP_001759252.1|  predicted protein                                  106   3e-23    
ref|XP_002462960.1|  hypothetical protein SORBIDRAFT_02g035320          106   3e-23    
gb|AFK40245.1|  unknown                                                 107   3e-23    
gb|KEH28580.1|  eukaryotic aspartyl protease family protein             107   3e-23    
ref|XP_006302129.1|  hypothetical protein CARUB_v10020134mg             107   3e-23    
ref|XP_002890686.1|  aspartyl protease family protein                   107   3e-23    
emb|CDM84701.1|  unnamed protein product                                106   3e-23    
ref|XP_010913305.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   3e-23    
ref|XP_004241673.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   3e-23    
dbj|BAJ94496.1|  predicted protein                                      106   4e-23    



>ref|XP_011016906.1| PREDICTED: aspartic proteinase nepenthesin-1 [Populus euphratica]
Length=458

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 179/199 (90%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL+NPHRPSLYYVNLTGVSVG+I V 
Sbjct  260  GVFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRNPHRPSLYYVNLTGVSVGRIKVP  319

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            IP E L FDP TGAGT+IDSGTVI+RFV+P Y AIR+EFRKQV GP SSLGAFDTCFA T
Sbjct  320  IPSEQLVFDPNTGAGTIIDSGTVITRFVQPVYNAIRDEFRKQVNGPISSLGAFDTCFAAT  379

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT HF+G++LVLPMEN+LIH+S G+LACL+MAAAPNNVNSVLNVIANLQQQNL
Sbjct  380  NEAVAPAITLHFEGLNLVLPMENSLIHSSSGSLACLSMAAAPNNVNSVLNVIANLQQQNL  439

Query  166  RVLFDTVNSRLGITHENCN  110
            R++FDT NSRLGI  E CN
Sbjct  440  RIMFDTTNSRLGIARELCN  458



>gb|ABK95290.1| unknown [Populus trichocarpa]
Length=438

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL+NPHRPSLYYVNLTGVSVG+I V 
Sbjct  240  GVFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRNPHRPSLYYVNLTGVSVGRIKVP  299

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            IP E L FDP TGAGT+IDSGTVI+RFV+P Y AIR+EFRKQV GP SSLGAFDTCFA T
Sbjct  300  IPSEQLVFDPNTGAGTIIDSGTVITRFVQPVYFAIRDEFRKQVNGPISSLGAFDTCFAAT  359

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E  AP IT HF+G++LVLPMEN+LIH+S G+LACL+MAAAPNNVNSVLNVIANLQQQNL
Sbjct  360  NEAEAPAITLHFEGLNLVLPMENSLIHSSSGSLACLSMAAAPNNVNSVLNVIANLQQQNL  419

Query  166  RVLFDTVNSRLGITHENCN  110
            R++FDT NSRLGI  E CN
Sbjct  420  RIMFDTTNSRLGIARELCN  438



>ref|XP_002302336.2| chloroplast nucleoid DNA-binding family protein [Populus trichocarpa]
 gb|EEE81609.2| chloroplast nucleoid DNA-binding family protein [Populus trichocarpa]
Length=458

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL+NPHRPSLYYVNLTGVSVG+I V 
Sbjct  260  GVFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRNPHRPSLYYVNLTGVSVGRIKVP  319

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            IP E L FDP TGAGT+IDSGTVI+RFV+P Y AIR+EFRKQV GP SSLGAFDTCFA T
Sbjct  320  IPSEQLVFDPNTGAGTIIDSGTVITRFVQPVYFAIRDEFRKQVNGPISSLGAFDTCFAAT  379

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E  AP IT HF+G++LVLPMEN+LIH+S G+LACL+MAAAPNNVNSVLNVIANLQQQNL
Sbjct  380  NEAEAPAITLHFEGLNLVLPMENSLIHSSSGSLACLSMAAAPNNVNSVLNVIANLQQQNL  439

Query  166  RVLFDTVNSRLGITHENCN  110
            R++FDT NSRLGI  E CN
Sbjct  440  RIMFDTTNSRLGIARELCN  458



>ref|XP_011091829.1| PREDICTED: aspartic proteinase nepenthesin-1 [Sesamum indicum]
Length=437

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP+GQPK I+TTPLLKNPHRPSLYYVNLTGVSVG++ V 
Sbjct  239  GVFSYCLPSFKSYYFSGSLKLGPLGQPKNIKTTPLLKNPHRPSLYYVNLTGVSVGRVNVP  298

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FDP TGAGT+IDSGTVI+RF++P Y AIR+EFRKQV GPFSSLGAFDTCFA T
Sbjct  299  IAPELLAFDPNTGAGTIIDSGTVITRFIQPVYTAIRDEFRKQVAGPFSSLGAFDTCFAAT  358

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP ITFHF G+DL LPMEN+LIH+S G+LACLAMAAAPNNVNS+LNVIANLQQQNL
Sbjct  359  NEAVAPAITFHFTGLDLKLPMENSLIHSSSGSLACLAMAAAPNNVNSMLNVIANLQQQNL  418

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDTVNSRLGI  E CN
Sbjct  419  RILFDTVNSRLGIARELCN  437



>gb|KDP41467.1| hypothetical protein JCGZ_15874 [Jatropha curcas]
Length=439

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+SYYFSGSL+LGPVGQP+ IRTTPLL+NPHRPSLYYVNLTGVSVG+++V+
Sbjct  241  GVFSYCLPSFRSYYFSGSLKLGPVGQPRAIRTTPLLRNPHRPSLYYVNLTGVSVGRVYVH  300

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FDP TGAGT+IDSGTVI+RF+EP Y AIR+EFRKQV GPFSSLGAFDTCF  T
Sbjct  301  IAPELLKFDPNTGAGTIIDSGTVITRFIEPIYTAIRDEFRKQVKGPFSSLGAFDTCFTAT  360

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT HF G++LVLPMEN+LIH+S G+LACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  361  NEALAPAITLHFTGLNLVLPMENSLIHSSAGSLACLAMAAAPNNVNSVLNVIANLQQQNL  420

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  421  RILFDVPNSRLGIARELCN  439



>ref|XP_002283889.2| PREDICTED: aspartic proteinase nepenthesin-1 [Vitis vinifera]
Length=439

 Score =   338 bits (867),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYC PSFKSYYFSGSLRLGP+GQPK IRTTPLL+NPHRP+LYYVNLTGVSVG++ V 
Sbjct  241  GVFSYCFPSFKSYYFSGSLRLGPLGQPKNIRTTPLLRNPHRPTLYYVNLTGVSVGRVLVP  300

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +  E L FDP TGAGT+IDSGTVI+RFVEP Y AIR+EFRKQV GPF+++GAFDTCFA T
Sbjct  301  VAPELLAFDPNTGAGTIIDSGTVITRFVEPVYAAIRDEFRKQVKGPFATIGAFDTCFAAT  360

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +APP+TFHF GMDL LP+ENTLIH+S G+LACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  361  NEDIAPPVTFHFTGMDLKLPLENTLIHSSAGSLACLAMAAAPNNVNSVLNVIANLQQQNL  420

Query  166  RVLFDTVNSRLGITHENCN  110
            R++FD  NSRLGI  E CN
Sbjct  421  RIMFDVTNSRLGIARELCN  439



>emb|CDP11493.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   338 bits (866),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+SYYFSGSL+LGPVGQPK+IRTTPLLKNP R SLYYVNLTG++VGK+ + 
Sbjct  251  GVFSYCLPSFRSYYFSGSLKLGPVGQPKSIRTTPLLKNPRRSSLYYVNLTGITVGKVRIP  310

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FDPATGAGT+IDSGTVI+RF+ P Y A+R+EFR QV GPFSSLGAFDTCFA T
Sbjct  311  IAPELLAFDPATGAGTIIDSGTVITRFILPIYTALRDEFRNQVKGPFSSLGAFDTCFAAT  370

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +APP+TFHFQG+DLVLP+EN+LIH+S G+LACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  371  NEDVAPPVTFHFQGLDLVLPLENSLIHSSSGSLACLAMAAAPNNVNSVLNVIANLQQQNL  430

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDT NSRLGI  E CN
Sbjct  431  RILFDTANSRLGIARELCN  449



>ref|XP_004237984.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Solanum lycopersicum]
Length=435

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP+GQPK IRTTPLLKNPHRPSLYYVNLTG+SVG++ V 
Sbjct  237  GVFSYCLPSFKSYYFSGSLKLGPLGQPKNIRTTPLLKNPHRPSLYYVNLTGISVGRVLVP  296

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FDP TGAGT+IDSGTVI+RFV+P Y AIR+EFR QV GPF+SLGAFDTCFA T
Sbjct  297  IAPELLAFDPNTGAGTIIDSGTVITRFVQPIYNAIRDEFRNQVKGPFTSLGAFDTCFAST  356

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP I  HF GMDLVLPMEN+LIH+S   LACLAMAAAP NVNSVLNVIANLQQQNL
Sbjct  357  NEAVAPAIILHFTGMDLVLPMENSLIHSSASPLACLAMAAAPTNVNSVLNVIANLQQQNL  416

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDT NSRLGI  E CN
Sbjct  417  RILFDTANSRLGIARELCN  435



>ref|XP_009588036.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
tomentosiformis]
Length=434

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP+GQPK I+ TPLLKNPHRPSLYYVNLTG+SVG++ V 
Sbjct  236  GVFSYCLPSFKSYYFSGSLKLGPLGQPKNIKFTPLLKNPHRPSLYYVNLTGISVGRVLVP  295

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FD  TGAGT+IDSGTVI+RFV+PAY A R+EFRKQV GPFSSLGAFDTCFA T
Sbjct  296  IAPELLAFDTNTGAGTIIDSGTVITRFVQPAYNATRDEFRKQVKGPFSSLGAFDTCFAST  355

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT HF GMDLVLPMENTLIH+S   +ACLAMAAAP NVNSVLNVIANLQQQNL
Sbjct  356  NEAVAPAITLHFTGMDLVLPMENTLIHSSASPVACLAMAAAPTNVNSVLNVIANLQQQNL  415

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDT NSRLGI  E CN
Sbjct  416  RILFDTANSRLGIARELCN  434



>ref|XP_002514026.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF48609.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=437

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 174/199 (87%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G+FSYCLPSFKSYYFSGSL+LGP GQPK+IR TPLL+NPHRPSLYYVNLTGVSVG+  V 
Sbjct  239  GLFSYCLPSFKSYYFSGSLKLGPAGQPKSIRYTPLLRNPHRPSLYYVNLTGVSVGRTLVP  298

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L F+P TGAGT+IDSGTVI+RFV+P Y AIR+EFRKQV GPFSSLGAFDTCFA T
Sbjct  299  IAPELLAFNPNTGAGTIIDSGTVITRFVQPIYTAIRDEFRKQVAGPFSSLGAFDTCFAAT  358

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP +T HF G++LVLPMEN+LIH+S G+LACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  359  NEAVAPAVTLHFTGLNLVLPMENSLIHSSAGSLACLAMAAAPNNVNSVLNVIANLQQQNL  418

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  419  RLLFDVPNSRLGIARELCN  437



>dbj|BAE71208.1| hypothetical protein [Trifolium pratense]
 dbj|BAE71210.1| hypothetical protein [Trifolium pratense]
Length=437

 Score =   327 bits (839),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL NPHRPSLYYVNLT +SVG+++V 
Sbjct  239  GVFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLHNPHRPSLYYVNLTAISVGRVYVP  298

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +P E L F+P+TGAGT+IDSGTVI+RFVEP Y A+R+EFRKQVTGPFSSLGAFDTCF   
Sbjct  299  LPSELLAFNPSTGAGTIIDSGTVITRFVEPIYNAVRDEFRKQVTGPFSSLGAFDTCFVKN  358

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT HF  +DL LP+EN+LIH+S G+LACLAMAAAP+NVNSVLNVIAN QQQNL
Sbjct  359  YETLAPAITLHFTDLDLKLPLENSLIHSSSGSLACLAMAAAPSNVNSVLNVIANFQQQNL  418

Query  166  RVLFDTVNSRLGITHENCN  110
            RVLFDTVN+++GI  E CN
Sbjct  419  RVLFDTVNNKVGIARELCN  437



>ref|XP_004501630.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=437

 Score =   327 bits (838),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL+NPHRPSLYYVNLTG+SVG++ V 
Sbjct  239  GVFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRNPHRPSLYYVNLTGISVGRVHVP  298

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +P E L FDP TG+GT+IDSGTVI+RFVEP Y A+R+EFRKQVTGPFSSLGAFDTCF  T
Sbjct  299  LPYEFLAFDPNTGSGTIIDSGTVITRFVEPVYNAVRDEFRKQVTGPFSSLGAFDTCFVKT  358

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT  F  ++L LPMEN+LIH+S G+LACLAMAAAP+NVNSVLNVIAN QQQNL
Sbjct  359  YETLAPAITLRFTDLNLTLPMENSLIHSSSGSLACLAMAAAPSNVNSVLNVIANFQQQNL  418

Query  166  RVLFDTVNSRLGITHENCN  110
            RVLFDTVN+++GI  E CN
Sbjct  419  RVLFDTVNNKVGIARELCN  437



>gb|EYU36857.1| hypothetical protein MIMGU_mgv1a022460mg [Erythranthe guttata]
Length=443

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP+GQPK+I+TTPLLKNPHRPSLYYVNL G+SVG++ V 
Sbjct  245  GVFSYCLPSFKSYYFSGSLKLGPLGQPKSIKTTPLLKNPHRPSLYYVNLIGISVGRVNVP  304

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L F+P++GAGTVIDSGTVI+RFV+P Y A R+EFRKQ+ GPFS+LGAFDTCFA T
Sbjct  305  IAPELLAFNPSSGAGTVIDSGTVITRFVQPVYNATRDEFRKQLAGPFSTLGAFDTCFAAT  364

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             + +AP IT HF+G+DL LP+EN+LIH+S G+LACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  365  NDEVAPVITLHFEGLDLKLPLENSLIHSSSGSLACLAMAAAPNNVNSVLNVIANLQQQNL  424

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDTVNSR+GI  E CN
Sbjct  425  RILFDTVNSRVGIAREVCN  443



>gb|EYU42951.1| hypothetical protein MIMGU_mgv1a027000mg [Erythranthe guttata]
Length=443

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP+GQPK+I+TTPLLKNPHRPSLYYVNL G+SVG++ V 
Sbjct  245  GVFSYCLPSFKSYYFSGSLKLGPLGQPKSIKTTPLLKNPHRPSLYYVNLIGISVGRVNVP  304

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L F+P++GAGT+IDSGTVI+RFV+P Y A R+EFRKQ+ GPFS+LGAFDTCFA T
Sbjct  305  IAPELLAFNPSSGAGTIIDSGTVITRFVQPIYNATRDEFRKQLAGPFSTLGAFDTCFAAT  364

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             + +AP IT HF+G+DL LP+EN+LIH+S G+LACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  365  NDEVAPVITLHFEGLDLKLPLENSLIHSSSGSLACLAMAAAPNNVNSVLNVIANLQQQNL  424

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDTVNSR+GI  E CN
Sbjct  425  RILFDTVNSRIGIAREVCN  443



>ref|XP_006366418.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=447

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/199 (78%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G+FSYCLPSFKSYYFSGSL+LGPVGQPK I+TTPLLKNP RPSLYYVNLT VSVG++ V 
Sbjct  249  GIFSYCLPSFKSYYFSGSLKLGPVGQPKNIKTTPLLKNPRRPSLYYVNLTSVSVGRVPVP  308

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  EHL FDP TGAGTVIDSGTVI+RFV+PAY AIR+EFRKQV G FSSLGAFDTCF   
Sbjct  309  IAPEHLAFDPNTGAGTVIDSGTVITRFVQPAYEAIRDEFRKQVNGTFSSLGAFDTCFVSQ  368

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E + P IT HF+GMDL LPMENTLIH+S   LACLA+A+APNNVNSVLNVIANLQQQNL
Sbjct  369  NEAVIPTITLHFEGMDLKLPMENTLIHSSATPLACLAIASAPNNVNSVLNVIANLQQQNL  428

Query  166  RVLFDTVNSRLGITHENCN  110
            R++FDT NSR+GI HE CN
Sbjct  429  RIMFDTANSRVGIAHEVCN  447



>ref|XP_009770124.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
sylvestris]
Length=434

 Score =   325 bits (832),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP+GQPK I+ TPLLKNPHRPSLYYVNLTG+SVG++ V 
Sbjct  236  GVFSYCLPSFKSYYFSGSLKLGPLGQPKNIKFTPLLKNPHRPSLYYVNLTGISVGRVLVP  295

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FD  TGAGT+IDSGTVI+RFV+PAY A R+EFRKQV GPFSSLGAFDTCFA T
Sbjct  296  IAPELLAFDTNTGAGTIIDSGTVITRFVQPAYNATRDEFRKQVKGPFSSLGAFDTCFAST  355

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT HF GMDLVLPMENTLIH+S   +ACLAMAAAP  VNSVLNVIANLQQQNL
Sbjct  356  NEAVAPAITLHFTGMDLVLPMENTLIHSSASPVACLAMAAAPTYVNSVLNVIANLQQQNL  415

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDT NSRLGI  E CN
Sbjct  416  RILFDTANSRLGIARELCN  434



>ref|XP_009757207.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=443

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP+GQPK I+TTPLLKNP RPSLYYVNLT VSVG++ V 
Sbjct  245  GVFSYCLPSFKSYYFSGSLKLGPLGQPKNIKTTPLLKNPRRPSLYYVNLTSVSVGRVQVP  304

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FD  TGAGT+IDSGTVI+RFV PAY AIR+EFRKQV GPFSSLGAFDTCFA  
Sbjct  305  IAPEQLGFDSNTGAGTIIDSGTVITRFVPPAYNAIRDEFRKQVKGPFSSLGAFDTCFASP  364

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E  AP IT HF+GMDL LPMENTLIH+S   LACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  365  NEAGAPAITLHFEGMDLKLPMENTLIHSSATPLACLAMAAAPNNVNSVLNVIANLQQQNL  424

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDT NSR+GI  E CN
Sbjct  425  RILFDTANSRVGIAREVCN  443



>ref|XP_009342559.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Pyrus x bretschneideri]
Length=442

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP GQPK+IRTTPLL+NP RPSLYYVNLTG+SVG++ V 
Sbjct  244  GVFSYCLPSFKSYYFSGSLKLGPAGQPKSIRTTPLLRNPRRPSLYYVNLTGISVGRVLVP  303

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L F+P TGAGT+IDSGTVI+RFV+P Y+A+R+EFRKQ+ GPFSSLGAFDTCF+ T
Sbjct  304  IAPELLAFNPNTGAGTIIDSGTVITRFVQPVYMALRDEFRKQLNGPFSSLGAFDTCFSAT  363

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT  F G+ L LPMEN+LIH+S G+LACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  364  NEVVAPAITLQFTGLKLTLPMENSLIHSSSGSLACLAMAAAPNNVNSVLNVIANLQQQNL  423

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NS +GI  E+CN
Sbjct  424  RILFDVANSVVGIARESCN  442



>ref|XP_007137648.1| hypothetical protein PHAVU_009G144100g [Phaseolus vulgaris]
 gb|ESW09642.1| hypothetical protein PHAVU_009G144100g [Phaseolus vulgaris]
Length=436

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 175/199 (88%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL+NPHRPSLYYVN TG+SVG++ V 
Sbjct  238  GVFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRNPHRPSLYYVNFTGISVGRVLVP  297

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
             P E+L F+P  G+GT+IDSGTVI+RFVEP Y A+REEFRKQV G FSS+GAFDTCF  T
Sbjct  298  FPSEYLEFNPYNGSGTIIDSGTVITRFVEPVYNAVREEFRKQVGGTFSSIGAFDTCFVKT  357

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +APPIT HF+ +DL LP+EN+LIH+S G+LACLAMAAAP+NVNSVLNVIAN QQQNL
Sbjct  358  YETLAPPITLHFEELDLKLPLENSLIHSSAGSLACLAMAAAPDNVNSVLNVIANFQQQNL  417

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDTVN+++GI  E CN
Sbjct  418  RILFDTVNNKVGIAREVCN  436



>ref|XP_009373927.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Pyrus x bretschneideri]
Length=442

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP GQPK+IRTTPLL+NP RPSLYYVNLTG+SVG++ V 
Sbjct  244  GVFSYCLPSFKSYYFSGSLKLGPAGQPKSIRTTPLLRNPRRPSLYYVNLTGISVGRVLVP  303

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L F+P TGAGT+IDSGTVI+RFV+P Y+A+R+EFRKQ+ GPFSSLGAFDTCF+ T
Sbjct  304  IAPELLAFNPNTGAGTIIDSGTVITRFVQPVYMALRDEFRKQLNGPFSSLGAFDTCFSAT  363

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT  F G+ L LPMEN+LIH+S G+LACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  364  NEVVAPAITLQFTGLKLTLPMENSLIHSSSGSLACLAMAAAPNNVNSVLNVIANLQQQNL  423

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NS +GI  E+CN
Sbjct  424  RILFDVANSVVGIARESCN  442



>ref|XP_007222165.1| hypothetical protein PRUPE_ppa005789mg [Prunus persica]
 gb|EMJ23364.1| hypothetical protein PRUPE_ppa005789mg [Prunus persica]
Length=443

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 173/199 (87%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP GQPK+IRTTPLL+NPHRPSLYYVNLTG++VG++ V 
Sbjct  245  GVFSYCLPSFKSYYFSGSLKLGPAGQPKSIRTTPLLRNPHRPSLYYVNLTGITVGRVPVP  304

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L F+P TGAGT+IDSGTVI+RFV+P Y A+R+EFRKQV G FSSLGAFDTCFA T
Sbjct  305  IAPELLAFNPNTGAGTIIDSGTVITRFVQPVYTALRDEFRKQVKGTFSSLGAFDTCFAAT  364

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP ITF F G+ L LP+EN+LIH+S G++ACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  365  NEAVAPTITFQFTGLKLTLPLENSLIHSSSGSVACLAMAAAPNNVNSVLNVIANLQQQNL  424

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NS +GI  ENCN
Sbjct  425  RILFDVANSVVGIARENCN  443



>ref|XP_010272925.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Nelumbo nucifera]
Length=443

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 168/199 (84%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYC PSFKSYYFSGSL+LGPVGQPK+IRTTPLL+NPHRPSLYYVNLTG+SVGK+ V 
Sbjct  245  GVFSYCFPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRNPHRPSLYYVNLTGISVGKVLVP  304

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +  E L FDP TGAGT+IDSGTVI+RFV+P Y AIR+EFRKQ+  P SSLGAFDTCF  T
Sbjct  305  VAPELLAFDPNTGAGTIIDSGTVITRFVQPVYTAIRDEFRKQINAPISSLGAFDTCFKTT  364

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E   P +T HF GMDL LP ENTLIH+S G+L CLAMAAAPNNVN+VLNVIANLQQQNL
Sbjct  365  YEAEKPAVTLHFTGMDLTLPTENTLIHSSAGSLTCLAMAAAPNNVNTVLNVIANLQQQNL  424

Query  166  RVLFDTVNSRLGITHENCN  110
            RVLFD  NSRLGI  E CN
Sbjct  425  RVLFDVPNSRLGIARELCN  443



>ref|XP_003522749.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Glycine 
max]
Length=440

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 177/200 (89%), Gaps = 1/200 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G+FSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL++PHRPSLYYVN TG+SVG++ V 
Sbjct  241  GIFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRSPHRPSLYYVNFTGISVGRVLVP  300

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG-PFSSLGAFDTCFAV  350
             P E+L F+P TG+GT+IDSGTVI+RFVEP Y A+REEFRKQV G  F+S+GAFDTCF  
Sbjct  301  FPSEYLGFNPNTGSGTIIDSGTVITRFVEPVYNAVREEFRKQVGGTTFTSIGAFDTCFVK  360

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            T E +APPIT HF+G+DL LP+EN+LIH+S G+LACLAMAAAP+NVNSVLNVIAN QQQN
Sbjct  361  TYETLAPPITLHFEGLDLKLPLENSLIHSSAGSLACLAMAAAPDNVNSVLNVIANFQQQN  420

Query  169  LRVLFDTVNSRLGITHENCN  110
            LR+LFDTVN+++GI  E CN
Sbjct  421  LRILFDTVNNKVGIAREVCN  440



>ref|XP_010060093.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
 gb|KCW66621.1| hypothetical protein EUGRSUZ_F00411 [Eucalyptus grandis]
Length=436

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+SYYFSGSL+LGPVGQPK+IRTTPLL+NP RPSLYYVNLTG+SVG++ V 
Sbjct  238  GVFSYCLPSFRSYYFSGSLKLGPVGQPKSIRTTPLLRNPRRPSLYYVNLTGISVGRVLVP  297

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +  + L FDP+TGAGT++DSGTVI+RF+EP Y AIR+EFRKQV GPFSSLGAFDTCF  +
Sbjct  298  VDPKFLAFDPSTGAGTIMDSGTVITRFMEPLYNAIRDEFRKQVPGPFSSLGAFDTCFTAS  357

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP +TFHF G+DL LP+EN+LIH+S G+LACLAMAAAP+NVNSVLNVIANLQQQNL
Sbjct  358  NEAVAPVVTFHFPGVDLKLPLENSLIHSSSGSLACLAMAAAPSNVNSVLNVIANLQQQNL  417

Query  166  RVLFDTVNSRLGITHENCN  110
            R+++D  NSR+GI  E CN
Sbjct  418  RIMYDLTNSRIGIARELCN  436



>ref|XP_009618058.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=443

 Score =   320 bits (819),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP+GQPK I+TTPLLKNP RPSLYYVNLT VSVG+I V 
Sbjct  245  GVFSYCLPSFKSYYFSGSLKLGPLGQPKNIKTTPLLKNPRRPSLYYVNLTSVSVGRIQVP  304

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FDP TGAGT+IDSGTVI+RFV  AY AIR+EFRKQV GPFSSLGAFDTCFA  
Sbjct  305  ISPEQLGFDPNTGAGTIIDSGTVITRFVPQAYNAIRDEFRKQVKGPFSSLGAFDTCFASP  364

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E  AP IT  F+GM+L LPMENTLIH+S   LACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  365  NEAGAPAITLQFEGMNLKLPMENTLIHSSATPLACLAMAAAPNNVNSVLNVIANLQQQNL  424

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDT NSR+GI  E CN
Sbjct  425  RILFDTANSRVGIARELCN  443



>ref|XP_010266126.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nelumbo 
nucifera]
Length=443

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYF+GSL+LGPVGQP++IRTTPLL+NPHRPSLYYVNLTG+SVG++ V 
Sbjct  245  GVFSYCLPSFKSYYFTGSLKLGPVGQPRSIRTTPLLRNPHRPSLYYVNLTGISVGRVLVP  304

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +  E L FDP TGAGTVIDSGTVI+RFV+P Y A+R+EFRKQ+  P SSLGAFDTCF  T
Sbjct  305  VAPELLAFDPNTGAGTVIDSGTVITRFVQPVYTAVRDEFRKQINAPISSLGAFDTCFTTT  364

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
                 P +TFHF  MDL LP ENTLIH+S G+LACLAMAAAP+NVNSVLNVIANLQQQNL
Sbjct  365  YVAQTPAVTFHFTEMDLTLPTENTLIHSSVGSLACLAMAAAPSNVNSVLNVIANLQQQNL  424

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  425  RILFDIPNSRLGIARELCN  443



>ref|XP_008219289.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=443

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP GQPK+IRTTPLL+NP RPSLYYVNLTG++VG++ V 
Sbjct  245  GVFSYCLPSFKSYYFSGSLKLGPAGQPKSIRTTPLLRNPRRPSLYYVNLTGITVGRVPVP  304

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L F+P +GAGT+IDSGTVI+RFV+P Y A+R+EFRKQV G FSSLGAFDTCFA T
Sbjct  305  IAPELLAFNPNSGAGTIIDSGTVITRFVQPVYTALRDEFRKQVQGTFSSLGAFDTCFAAT  364

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP ITF F G+ L LP+EN+LIH+S G++ACLAMAAAPNNVNSVLNVIANLQQQNL
Sbjct  365  NEAVAPTITFQFTGLKLTLPLENSLIHSSSGSVACLAMAAAPNNVNSVLNVIANLQQQNL  424

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NS +GI  ENCN
Sbjct  425  RILFDVANSVVGIARENCN  443



>ref|XP_010107692.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXC16665.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=439

 Score =   317 bits (813),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP+GQPK IRTTPLL NPHRPSLYYVNLTGV+VG++ V 
Sbjct  241  GVFSYCLPSFKSYYFSGSLKLGPLGQPKNIRTTPLLLNPHRPSLYYVNLTGVTVGRVHVP  300

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L F+P TGAGT+IDSGTVI+RFV+P Y AIR+E+RKQ+ GPFS+LGAFDTCF  +
Sbjct  301  IAPELLAFNPNTGAGTIIDSGTVITRFVQPVYEAIRDEYRKQLKGPFSTLGAFDTCFEES  360

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT H  G+DL LPMEN+LIH+S G  ACLAMAAAP+NVNSVLNVIANLQQQNL
Sbjct  361  NEELAPAITLHLTGLDLKLPMENSLIHSSAGTRACLAMAAAPSNVNSVLNVIANLQQQNL  420

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  421  RILFDVANSRLGIARELCN  439



>ref|XP_003526531.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=454

 Score =   317 bits (813),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 176/200 (88%), Gaps = 1/200 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G+FSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL++PHRPSLYYVN TG+SVG++ V 
Sbjct  255  GIFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRSPHRPSLYYVNFTGISVGRVLVP  314

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG-PFSSLGAFDTCFAV  350
             P E+L F+P TG+GT+IDSGTVI+RFVEP Y A+REEFRKQV G  F+S+GAFDTCF  
Sbjct  315  FPSEYLGFNPNTGSGTIIDSGTVITRFVEPVYNAVREEFRKQVGGTTFTSIGAFDTCFVK  374

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            T E +APPIT HF+G+DL LP+EN+LIH+S G+LACLAMAAAP+NVNSVLNVIAN QQQN
Sbjct  375  TYETLAPPITLHFEGLDLKLPLENSLIHSSAGSLACLAMAAAPDNVNSVLNVIANFQQQN  434

Query  169  LRVLFDTVNSRLGITHENCN  110
            LR+LFD VN+++GI  E CN
Sbjct  435  LRILFDIVNNKVGIAREVCN  454



>ref|XP_004299721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   317 bits (812),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 167/199 (84%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLLKNP RPSLYYVNLTG+SVGK+ V 
Sbjct  239  GVFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLKNPRRPSLYYVNLTGISVGKVLVP  298

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  + L FDP TGAGT+IDSGT I+RFV+P Y AIR+EFRKQV   FSSLGAFDTCF   
Sbjct  299  IAPQFLAFDPTTGAGTIIDSGTTITRFVQPVYDAIRDEFRKQVNTTFSSLGAFDTCFNTN  358

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP ITF F G+ L LP+EN+LIH+S G LACLAMAAAP NVNSVLNVIANLQQQNL
Sbjct  359  NEAVAPAITFRFTGLVLTLPLENSLIHSSSGTLACLAMAAAPTNVNSVLNVIANLQQQNL  418

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  419  RILFDVANSRLGIARELCN  437



>ref|XP_004252715.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=446

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LG VGQPK I+TTPLLKNP RPSLYYVNLT VSVG++ V 
Sbjct  248  GVFSYCLPSFKSYYFSGSLKLGTVGQPKNIKTTPLLKNPRRPSLYYVNLTSVSVGRVSVP  307

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FDP TGAGTVIDSGTVI+RFV+PAY AIR+EFRKQV G FSSLGAFDTCF   
Sbjct  308  IAPEDLAFDPNTGAGTVIDSGTVITRFVQPAYEAIRDEFRKQVNGTFSSLGAFDTCFVSQ  367

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E + P IT HF+GMDL LP+ENTLIH+S   LACLA+A+APNNVNSVLNVIANLQQQNL
Sbjct  368  NEAVIPTITLHFEGMDLKLPIENTLIHSSATPLACLAIASAPNNVNSVLNVIANLQQQNL  427

Query  166  RVLFDTVNSRLGITHENCN  110
            R++FDT NSR+GI  E CN
Sbjct  428  RLMFDTANSRVGIAREVCN  446



>ref|XP_003602931.1| Aspartic proteinase nepenthesin-1 [Medicago truncatula]
 gb|AES73182.1| aspartic proteinase nepenthesin-like protein [Medicago truncatula]
Length=438

 Score =   312 bits (799),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 172/200 (86%), Gaps = 1/200 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL+NP RPSLY+VNLTG++VGK+ V 
Sbjct  239  GVFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRNPRRPSLYFVNLTGITVGKVNVP  298

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
             P+E L FD  TG+GT+IDSGTVI+RFVEP Y A+R+EFRKQVTGPFSSLGAFDTCF   
Sbjct  299  FPKELLAFDVNTGSGTIIDSGTVITRFVEPVYNAVRDEFRKQVTGPFSSLGAFDTCFVKN  358

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVN-SVLNVIANLQQQN  170
             E +AP IT HF  +DL LP+EN+LIH+S G+LACLAMA+ P NVN +VLNVIAN QQQN
Sbjct  359  YETLAPAITLHFTDLDLKLPLENSLIHSSSGSLACLAMASTPKNVNYTVLNVIANYQQQN  418

Query  169  LRVLFDTVNSRLGITHENCN  110
            LRVLFDTVN+++GI  E CN
Sbjct  419  LRVLFDTVNNKVGIARELCN  438



>gb|EPS72919.1| hypothetical protein M569_01840 [Genlisea aurea]
Length=431

 Score =   310 bits (793),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 171/199 (86%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+SYYFSGSL+LG  GQP  IRTTPLL+NPHRPSLYYVNLTG+SVG++ V 
Sbjct  233  GVFSYCLPSFRSYYFSGSLKLGLTGQPTNIRTTPLLRNPHRPSLYYVNLTGISVGRVNVP  292

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  + L FDP TGAGT+IDSGTVI+RFV P Y A+R+EF+KQ+TGPF+SLGAFDTCF  T
Sbjct  293  IDPQFLAFDPNTGAGTIIDSGTVITRFVGPIYEAVRDEFKKQLTGPFTSLGAFDTCFTAT  352

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             +  AP +T HF G+DL LP+ENTLIH+S G+L CLAMA+AP+NVNSVLN+IA+LQQQNL
Sbjct  353  NQAEAPTVTLHFTGLDLKLPVENTLIHSSSGSLGCLAMASAPDNVNSVLNIIASLQQQNL  412

Query  166  RVLFDTVNSRLGITHENCN  110
            R++FDTVNS LGIT E CN
Sbjct  413  RIVFDTVNSHLGITREVCN  431



>ref|XP_010675271.1| PREDICTED: aspartic proteinase nepenthesin-1 [Beta vulgaris subsp. 
vulgaris]
Length=439

 Score =   309 bits (792),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 171/199 (86%), Gaps = 2/199 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G+FSYCLPSFKSYYFSGSL+LGP GQP++I+TTPLL+NPHRPSLYYVNL  VSVG++ V 
Sbjct  243  GIFSYCLPSFKSYYFSGSLKLGPTGQPRSIKTTPLLQNPHRPSLYYVNLVAVSVGRVQVP  302

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            IPQ+HLTFDP TG GT+IDSGT+++RFV PAY AIR+E+RKQV GPFSS+G FDTCF V 
Sbjct  303  IPQQHLTFDPNTGVGTIIDSGTLLTRFVGPAYYAIRDEYRKQVQGPFSSIGVFDTCFPVI  362

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E + P +T HF+G+DL LPMENTLIH+S GN+ACLAMAA  N+VNSV+N+IA+ QQQNL
Sbjct  363  HEQVPPTVTLHFEGLDLKLPMENTLIHSSAGNMACLAMAA--NSVNSVINIIASWQQQNL  420

Query  166  RVLFDTVNSRLGITHENCN  110
            RVL+DT NSR+G   E CN
Sbjct  421  RVLYDTANSRIGFAREICN  439



>ref|XP_010553675.1| PREDICTED: aspartic proteinase nepenthesin-1 [Tarenaya hassleriana]
Length=457

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 172/200 (86%), Gaps = 1/200 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LG  GQP +I+TTPLLKNPHRPSLYYVNLTGVSVG+  V 
Sbjct  258  GVFSYCLPSFRSFYFSGSLKLGRAGQPGSIKTTPLLKNPHRPSLYYVNLTGVSVGRTRVP  317

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCF-AV  350
            +  ++L FDP TGAGT++DSGTVI+RFV+P Y AIR+EFRKQV GPFS+LGAFDTCF A 
Sbjct  318  VDPKYLGFDPNTGAGTIVDSGTVITRFVQPVYEAIRDEFRKQVKGPFSTLGAFDTCFTAD  377

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
              +  AP IT H  G+DL LPMEN+LIH+S G+L+CL+MA+APNNV+SVLNVIANLQQQN
Sbjct  378  NADNAAPKITLHMTGLDLTLPMENSLIHSSAGSLSCLSMASAPNNVDSVLNVIANLQQQN  437

Query  169  LRVLFDTVNSRLGITHENCN  110
            LR+LFD  NSR+GI +ENCN
Sbjct  438  LRILFDVPNSRIGIAYENCN  457



>ref|XP_006338076.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Solanum tuberosum]
Length=435

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 172/199 (86%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP+GQPK IRTTPLLKNPHRPSLYYVNLTG+SVG++ V 
Sbjct  237  GVFSYCLPSFKSYYFSGSLKLGPLGQPKNIRTTPLLKNPHRPSLYYVNLTGISVGRVLVP  296

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FDP TGAGT+IDSGTVI+RFVEP Y AIR+EFR QV GPF+SLGAFDTCFA T
Sbjct  297  IAPELLAFDPNTGAGTIIDSGTVITRFVEPIYNAIRDEFRNQVKGPFTSLGAFDTCFAST  356

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP I  HF GMDLVLPMEN+LIH+S   LACLAMAAAP NVNSVLNVIANLQQQNL
Sbjct  357  NEAVAPAIILHFTGMDLVLPMENSLIHSSASPLACLAMAAAPANVNSVLNVIANLQQQNL  416

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDT NSRLGI  E CN
Sbjct  417  RILFDTANSRLGIARELCN  435



>gb|KJB29357.1| hypothetical protein B456_005G096500 [Gossypium raimondii]
Length=435

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK IRTTPLLK+PHRPSLYYVNLTG+SVG++ V 
Sbjct  237  GVFSYCLPSFKSYYFSGSLKLGPVGQPKNIRTTPLLKSPHRPSLYYVNLTGISVGRVQVP  296

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E+L F+P TGAGT+IDSGTV++RFV+P Y AIR+EF K V GPF+++G FDTCF  T
Sbjct  297  IAPEYLAFNPNTGAGTIIDSGTVVTRFVQPIYKAIRDEFVKHVKGPFTAIGVFDTCFDAT  356

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E  AP IT HF+G+ + LPMEN+ +HTS G+ ACLA+A  PNNVN+ +NVIANLQQQN 
Sbjct  357  AEAEAPLITLHFEGLSMPLPMENSFLHTSAGSRACLAIAPVPNNVNAAMNVIANLQQQNH  416

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD +NSRLGI  E CN
Sbjct  417  RILFDVINSRLGIAREACN  435



>ref|XP_006417541.1| hypothetical protein EUTSA_v10007613mg [Eutrema salsugineum]
 gb|ESQ35894.1| hypothetical protein EUTSA_v10007613mg [Eutrema salsugineum]
Length=450

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LGP GQP+++R TPLL+NP RPSLYYVNLTGVSVG + V 
Sbjct  252  GVFSYCLPSFRSFYFSGSLKLGPTGQPRSMRYTPLLRNPRRPSLYYVNLTGVSVGSVQVP  311

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +  ++LTFD  +GAGT+IDSGTVI+RF++P Y AIR EFRKQV GPFS+LGAFDTCFA  
Sbjct  312  VDLKYLTFDSNSGAGTIIDSGTVITRFIQPVYEAIRNEFRKQVKGPFSTLGAFDTCFAAD  371

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT H   +DL LPMENTLIH+S G LACL+MA  P N N+VLNVIANLQQQNL
Sbjct  372  NENVAPKITLHMTSLDLKLPMENTLIHSSAGTLACLSMAGIPQNANAVLNVIANLQQQNL  431

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  432  RILFDVPNSRLGIAPEPCN  450



>gb|AFK46294.1| unknown [Medicago truncatula]
Length=434

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 166/191 (87%), Gaps = 1/191 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL+NP RPSLY+VNLTG++VGK+ V 
Sbjct  239  GVFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRNPRRPSLYFVNLTGITVGKVNVP  298

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
             P+E L FD  TG+GT+IDSGTVI+RFVEP Y A+R+EFRKQVTGPFSSLGAFDTCF   
Sbjct  299  FPKELLAFDVNTGSGTIIDSGTVITRFVEPVYNAVRDEFRKQVTGPFSSLGAFDTCFVKN  358

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVN-SVLNVIANLQQQN  170
             E +AP IT HF  +DL LP+EN+LIH+S G+LACLAMA+ P NVN +VLNVIAN QQQN
Sbjct  359  YETLAPAITLHFTDLDLKLPLENSLIHSSSGSLACLAMASTPKNVNYTVLNVIANYQQQN  418

Query  169  LRVLFDTVNSR  137
            LRVLFDTVN++
Sbjct  419  LRVLFDTVNNK  429



>ref|XP_003519197.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Glycine max]
Length=451

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G+FSYCLPSF+S YFSGSL+LGP GQP+ IRTTPLL+NP RPSLYYVNLTGV+VG++ V 
Sbjct  253  GIFSYCLPSFQSSYFSGSLKLGPTGQPRRIRTTPLLQNPRRPSLYYVNLTGVTVGRVKVP  312

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +P E+L FDP  G+GT++DSGTVI+RFV P Y AIR+EFR QV GPF S G FDTCF  T
Sbjct  313  LPIEYLAFDPNKGSGTILDSGTVITRFVGPVYSAIRDEFRNQVKGPFFSRGGFDTCFVKT  372

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E + P I   F G+D+ LP ENTLIHT+YG +ACLAMAAAPNNVNSVLNVIAN QQQNL
Sbjct  373  YENLTPLIKLRFTGLDVTLPYENTLIHTAYGGMACLAMAAAPNNVNSVLNVIANYQQQNL  432

Query  166  RVLFDTVNSRLGITHENCN  110
            RVLFDTVN+R+GI  E CN
Sbjct  433  RVLFDTVNNRVGIARELCN  451



>gb|KHN09019.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=288

 Score =   294 bits (752),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = -3

Query  679  FKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIPQEHLTFD  500
            FKSYYFSGSL+LGPVGQPK+IRTTPLL++PHRPSLYYVN TG+SVG++ V  P E+L F+
Sbjct  84   FKSYYFSGSLKLGPVGQPKSIRTTPLLRSPHRPSLYYVNFTGISVGRVLVPFPSEYLGFN  143

Query  499  PATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG-PFSSLGAFDTCFAVTKEFMAPPI  323
            P TG+GT+IDSGTVI+RFVEP Y A+REEFRKQV G  F+S+GAFDTCF  T E +APPI
Sbjct  144  PNTGSGTIIDSGTVITRFVEPVYNAVREEFRKQVGGTTFTSIGAFDTCFVKTYETLAPPI  203

Query  322  TFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLRVLFDTVN  143
            T HF+G+DL LP+EN+LIH+S G+LACLAMAAAP+NVNSVLNVIAN QQQNLR+LFD VN
Sbjct  204  TLHFEGLDLKLPLENSLIHSSAGSLACLAMAAAPDNVNSVLNVIANFQQQNLRILFDIVN  263

Query  142  SRLGITHE  119
            +++GI  E
Sbjct  264  NKVGIARE  271



>ref|XP_007018203.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY15428.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=435

 Score =   298 bits (764),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
            VFSYCLPSFKSYYFSGSL+LGPVGQPK IRTTPLLKNPHRPSLYYVNLTGVSVG++ V I
Sbjct  238  VFSYCLPSFKSYYFSGSLKLGPVGQPKNIRTTPLLKNPHRPSLYYVNLTGVSVGRVRVPI  297

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVTK  344
              E++ F+P TGAGT+IDSGTV++RFV+P Y AIR EF K + GPFS++G FDTCF    
Sbjct  298  APEYIAFNPNTGAGTIIDSGTVVTRFVQPVYEAIRNEFVKHLKGPFSTIGVFDTCFDAAA  357

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
            E  AP IT H +G+ + LPMEN+ +H+S G+ ACLAMA  PNNVN+ LNVIANLQQQN R
Sbjct  358  ESEAPLITLHLEGLSMTLPMENSFLHSSAGSRACLAMAPVPNNVNAALNVIANLQQQNHR  417

Query  163  VLFDTVNSRLGITHENCN  110
            +LFD  NSRLGI  E CN
Sbjct  418  ILFDVANSRLGIAREVCN  435



>ref|XP_009110804.1| PREDICTED: aspartic proteinase nepenthesin-1 [Brassica rapa]
Length=452

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LGP+GQP++IR TPLL++ HRPSLYYVNLTGVSVG   V 
Sbjct  254  GVFSYCLPSFRSFYFSGSLKLGPMGQPRSIRYTPLLRSAHRPSLYYVNLTGVSVGPTQVP  313

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +   +LTFD ++GAGT+IDSGTVI+RFV+P Y AIR+EFR QV GPFS+LGAFDTCFA  
Sbjct  314  VDPTYLTFDSSSGAGTIIDSGTVITRFVQPVYEAIRDEFRSQVKGPFSTLGAFDTCFAAD  373

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             + +AP +T H   +DL LP+ENTLIH+S G LACL+MA  P N N+VLNVIANLQQQNL
Sbjct  374  SDNLAPKVTLHMTSLDLKLPVENTLIHSSAGTLACLSMAGIPLNANAVLNVIANLQQQNL  433

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  434  RILFDVANSRLGIATEACN  452



>emb|CDY31067.1| BnaA08g26170D [Brassica napus]
Length=452

 Score =   297 bits (760),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LGP+GQP++IR TPLL++ HRPSLYYVNLTGVSVG   V 
Sbjct  254  GVFSYCLPSFRSFYFSGSLKLGPMGQPRSIRYTPLLRSAHRPSLYYVNLTGVSVGPTQVP  313

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +   +LTFD ++GAGT+IDSGTVI+RFV+P Y AIR+EFR QV GPFS+LGAFDTCFA  
Sbjct  314  VDPTYLTFDSSSGAGTIIDSGTVITRFVQPVYEAIRDEFRSQVKGPFSTLGAFDTCFAAD  373

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             + +AP +T H   +DL LP+ENTLIH+S G LACL+MA  P N N+VLNVIANLQQQNL
Sbjct  374  SDNLAPKVTLHMTSLDLKLPVENTLIHSSAGTLACLSMAGIPLNANAVLNVIANLQQQNL  433

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  434  RILFDVPNSRLGIATEACN  452



>ref|XP_010916666.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Elaeis 
guineensis]
Length=430

 Score =   296 bits (758),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+SYYFSGSLRLGPVGQP++IRTTPLL NPHRPSLYYVN TG+SVG++ V 
Sbjct  230  GVFSYCLPSFRSYYFSGSLRLGPVGQPRSIRTTPLLHNPHRPSLYYVNQTGISVGRVLVA  289

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFA  353
            +P     FDPATGAGTV+DSGTVI+RFV P Y A+R+EFR+QV  +G +S+LGAFDTCF+
Sbjct  290  VPPGSFGFDPATGAGTVVDSGTVITRFVSPIYAALRDEFRRQVNASGGYSALGAFDTCFS  349

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
              +    PP+T HF G+DLV P+ENTLIH+S   LACLAMA AP NVNSV+NVIA+LQQQ
Sbjct  350  TDEVSRTPPVTLHFAGLDLVFPVENTLIHSSARPLACLAMAEAPGNVNSVVNVIASLQQQ  409

Query  172  NLRVLFDTVNSRLGITHENCN  110
            N+RV+ D  N R+G   E CN
Sbjct  410  NMRVMIDVANGRVGFAREVCN  430



>gb|KFK43273.1| hypothetical protein AALP_AA1G102700 [Arabis alpina]
Length=473

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LGP GQP++IR TPLL NP RPSLYYVNLTGVSVG + V 
Sbjct  252  GVFSYCLPSFRSFYFSGSLKLGPTGQPRSIRYTPLLSNPRRPSLYYVNLTGVSVGSVQVP  311

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +  ++LTFD  TGAGT+IDSGTVI+RF +P Y AIR+EFRKQV GPFS+LGAFDTCF   
Sbjct  312  VDFKYLTFDSTTGAGTIIDSGTVITRFAQPVYEAIRDEFRKQVKGPFSTLGAFDTCFTAD  371

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             + +AP +T H   +DL LPMENTLIH+S G LACL+MA  P N N+VLNVIANLQQQNL
Sbjct  372  NDNVAPVMTLHMTSLDLKLPMENTLIHSSAGTLACLSMAGIPQNANAVLNVIANLQQQNL  431

Query  166  RVLFDTVNSRLGITHENC  113
            R+LFD  NSRLGI  E C
Sbjct  432  RILFDVPNSRLGIATEAC  449



>ref|XP_010475821.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=445

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LG +GQPK+IR TPLL+NP RPSLYYVNLTGVSVG + V 
Sbjct  247  GVFSYCLPSFRSFYFSGSLKLGLLGQPKSIRYTPLLRNPRRPSLYYVNLTGVSVGSVQVP  306

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            + Q+ LTFD ++GAGT+IDSGTVI+RF +P Y AIR+EFRKQV G FS+LGAFDTCF   
Sbjct  307  VNQKFLTFDSSSGAGTIIDSGTVITRFAQPVYEAIRDEFRKQVNGSFSTLGAFDTCFTAD  366

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT H   +DL LP+ENTLIH+S G LACL+MA  P N N+VLNVIANLQQQNL
Sbjct  367  NENVAPKITLHMTSLDLKLPVENTLIHSSAGTLACLSMAGIPQNANAVLNVIANLQQQNL  426

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  427  RILFDVPNSRLGIAPEPCN  445



>emb|CDY20675.1| BnaC08g13830D [Brassica napus]
Length=451

 Score =   296 bits (757),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LGP+GQP++IR TPLL++ HRPSLYYVNLTGVSVG   V 
Sbjct  253  GVFSYCLPSFRSFYFSGSLKLGPMGQPRSIRYTPLLRSAHRPSLYYVNLTGVSVGPTQVP  312

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +   +LTFD  +GAGT+IDSGTVI+RFV+P Y AIR+EFR QV GPFS+LGAFDTCFA  
Sbjct  313  VDPTYLTFDSNSGAGTIIDSGTVITRFVQPVYEAIRDEFRSQVKGPFSTLGAFDTCFAAD  372

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             + +AP +T H   +DL LP+ENTLIH+S G LACL+MA  P N N+VLNVIANLQQQNL
Sbjct  373  SDSLAPKVTLHMTSLDLKLPVENTLIHSSAGTLACLSMAGIPLNANAVLNVIANLQQQNL  432

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  433  RILFDVPNSRLGIATEACN  451



>ref|XP_009376250.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Pyrus x bretschneideri]
Length=442

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGP GQPK IRTTPLL+NP RPSLYYVNLTG+SVG++ V 
Sbjct  244  GVFSYCLPSFKSYYFSGSLKLGPPGQPKAIRTTPLLRNPRRPSLYYVNLTGISVGRVLVP  303

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L F+P TGAGT+IDSGTVI+RFV P Y A+R+EFRKQV G FSSLGAFDTCF+ T
Sbjct  304  ISPELLAFNPNTGAGTIIDSGTVITRFVPPVYTALRDEFRKQVNGTFSSLGAFDTCFSAT  363

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP ITF F G+ L LP+EN+LIH+S G+LACLAMAAAPNN NSVLNVIANLQQQNL
Sbjct  364  NEVVAPAITFQFTGLKLTLPLENSLIHSSSGSLACLAMAAAPNNANSVLNVIANLQQQNL  423

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NS +GI  E+CN
Sbjct  424  RILFDVANSVVGIARESCN  442



>ref|XP_004148418.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Cucumis sativus]
 ref|XP_004166061.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Cucumis sativus]
 gb|KGN62761.1| hypothetical protein Csa_2G371100 [Cucumis sativus]
Length=436

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 166/199 (83%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G+FSYCLPSFKSYYFSGSL+LGPVGQPK IRTTPLL NPHRPSLYYVNLTG+SVG++ V 
Sbjct  238  GLFSYCLPSFKSYYFSGSLKLGPVGQPKAIRTTPLLHNPHRPSLYYVNLTGISVGRVLVP  297

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FDP TGAGT+IDSGTVI+RFV   Y A+R+EFRKQV G FS LGAFDTCFA  
Sbjct  298  ISPELLAFDPNTGAGTIIDSGTVITRFVPAIYTAVRDEFRKQVGGSFSPLGAFDTCFATN  357

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E  AP IT H  G+DL LPMEN+LIH+S G+LACLAMAAAPNNVNSV+NVIANLQQQN 
Sbjct  358  NEVSAPAITLHLSGLDLKLPMENSLIHSSAGSLACLAMAAAPNNVNSVVNVIANLQQQNH  417

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NS+LGI  E CN
Sbjct  418  RILFDINNSKLGIARELCN  436



>ref|XP_010490295.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Camelina sativa]
Length=448

 Score =   295 bits (755),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LG +GQPK+IR TPLL+NP RPSLYYVNLTGVSVG + V 
Sbjct  250  GVFSYCLPSFRSFYFSGSLKLGLLGQPKSIRYTPLLRNPRRPSLYYVNLTGVSVGSVQVP  309

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            + Q+ LTFD ++GAGT+IDSGTVI+RF +P Y AIR+EFRKQV G FS+LGAFDTCF   
Sbjct  310  VDQKFLTFDSSSGAGTIIDSGTVITRFAQPVYEAIRDEFRKQVNGSFSTLGAFDTCFTAD  369

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT H   +DL LP+ENTLIH+S G LACL+MA  P N N+VLNVIANLQQQNL
Sbjct  370  YENVAPKITLHMTSLDLKLPVENTLIHSSAGTLACLSMAGIPQNANAVLNVIANLQQQNL  429

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  430  RILFDVPNSRLGIAPEPCN  448



>gb|KHN26127.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=391

 Score =   292 bits (748),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 162/199 (81%), Gaps = 2/199 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G+FSYCLPSF+S YFSGSL+LGP GQP+ IRTTPLL+NP R  LYYVNLTGV+VG++ V 
Sbjct  195  GIFSYCLPSFQSSYFSGSLKLGPTGQPRRIRTTPLLQNPRR--LYYVNLTGVTVGRVKVP  252

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +P E+L FDP  G+GT++DSGTVI+RFV P Y AIR+EFR QV GPF S G FDTCF  T
Sbjct  253  LPIEYLAFDPNKGSGTILDSGTVITRFVGPVYSAIRDEFRNQVKGPFFSRGGFDTCFVKT  312

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E + P I   F G+D+ LP ENTLIHT+YG +ACLAMAAAPNNVNSVLNVIAN QQQNL
Sbjct  313  YENLTPLIKLRFTGLDVTLPYENTLIHTAYGGMACLAMAAAPNNVNSVLNVIANYQQQNL  372

Query  166  RVLFDTVNSRLGITHENCN  110
            RVLFDTVN+R+GI  E CN
Sbjct  373  RVLFDTVNNRVGIARELCN  391



>ref|XP_008378576.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2 [Malus domestica]
Length=424

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSG L+LGP GQPK IRTTPLL+NP R SLYYVNLTG+SVG++ V 
Sbjct  226  GVFSYCLPSFKSYYFSGXLKLGPPGQPKLIRTTPLLRNPRRRSLYYVNLTGISVGRVLVP  285

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L F+P T AGT+I+ GT I+RFV P Y A+R+EFRKQV G FSSLGAFDTCF+ T
Sbjct  286  ISPELLAFNPNTEAGTIINLGTXITRFVPPVYTALRDEFRKQVKGTFSSLGAFDTCFSAT  345

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT  F G+ L L  EN+LIH+S G+LACLAM  APNNVNSVLNVIANLQQQNL
Sbjct  346  NEVVAPTITLQFTGLKLTLSSENSLIHSSSGSLACLAMTVAPNNVNSVLNVIANLQQQNL  405

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NS +GI  E+CN
Sbjct  406  RILFDVANSVVGIARESCN  424



>ref|XP_010458274.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Camelina sativa]
Length=448

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LG +GQPK+IR TPLL+NP RPSLYYVNLTGVSVG + V 
Sbjct  250  GVFSYCLPSFRSFYFSGSLKLGLLGQPKSIRYTPLLRNPRRPSLYYVNLTGVSVGSVQVP  309

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            + Q+  TFD ++GAGT+IDSGTVI+RF +P Y AIR+EFRKQV G FS+LGAFDTCF   
Sbjct  310  VDQKFWTFDSSSGAGTIIDSGTVITRFAQPVYEAIRDEFRKQVNGSFSTLGAFDTCFTAD  369

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT H   +DL LP+ENTLIH+S G LACL+MA  P N N+VLNVIANLQQQNL
Sbjct  370  NENVAPKITLHMTSLDLKLPVENTLIHSSAGTLACLSMAGIPQNANAVLNVIANLQQQNL  429

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  430  RILFDVPNSRLGIAPEPCN  448



>ref|XP_006307264.1| hypothetical protein CARUB_v10008880mg [Capsella rubella]
 gb|EOA40162.1| hypothetical protein CARUB_v10008880mg [Capsella rubella]
Length=513

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LG +GQP++IR TPLL+NP RPSLYYVNLTGVSVG + V 
Sbjct  315  GVFSYCLPSFRSFYFSGSLKLGLLGQPRSIRYTPLLRNPRRPSLYYVNLTGVSVGSVQVP  374

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            + Q+ LTFD  +GAGT+IDSGTVI+RF +P Y AIR+EFRKQV G FS+LG+FDTCFA  
Sbjct  375  VDQKFLTFDSVSGAGTIIDSGTVITRFAQPVYEAIRDEFRKQVNGSFSTLGSFDTCFAAD  434

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP IT H   +DL LPMEN+LIH+S G LACL+MA  P N N+VLNVIANLQQQNL
Sbjct  435  NENVAPKITLHMTSLDLKLPMENSLIHSSAGTLACLSMAGIPQNANAVLNVIANLQQQNL  494

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLGI  E CN
Sbjct  495  RILFDIPNSRLGIAPEPCN  513



>emb|CAN74010.1| hypothetical protein VITISV_003547 [Vitis vinifera]
Length=429

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 155/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  640  PVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIPQEHLTFDPATGAGTVIDSGT  461
            P+GQPK IRTTPLL+NPHRP+LYYVNLTGVSVG++ V +  E L FDP TGAGT+IDSGT
Sbjct  253  PLGQPKNIRTTPLLRNPHRPTLYYVNLTGVSVGRVLVPVAPELLAFDPNTGAGTIIDSGT  312

Query  460  VISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVTKEFMAPPITFHFQGMDLVLPME  281
            VI+RFVEP Y AIR+EFRKQV GPF+++GAFDTCFA T E +APP+TFHF GMDL LP+E
Sbjct  313  VITRFVEPVYAAIRDEFRKQVKGPFATIGAFDTCFAATNEDIAPPVTFHFTGMDLKLPLE  372

Query  280  NTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLRVLFDTVNSRLGITHENCN  110
            NTLIH+S G+LACLAMAAAPNNVNSVLNVIANLQQQNLR++FD  NSRLGI  E CN
Sbjct  373  NTLIHSSAGSLACLAMAAAPNNVNSVLNVIANLQQQNLRIMFDVTNSRLGIARELCN  429



>ref|XP_008795166.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Phoenix 
dactylifera]
Length=423

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 163/201 (81%), Gaps = 2/201 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSLRLGPVGQP++IRTTPLL NPHRPSLYYVNLTG+SVG++ + 
Sbjct  223  GVFSYCLPSFKSYYFSGSLRLGPVGQPRSIRTTPLLHNPHRPSLYYVNLTGISVGRVLLA  282

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFA  353
            +P     FDP TGAGTV+DSGTVI+RFV P Y A+ ++F++QV  P  +S+LGAFDTCF+
Sbjct  283  VPPGSFRFDPTTGAGTVVDSGTVITRFVSPIYAALTDQFKRQVNAPGGYSALGAFDTCFS  342

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
              +    PP+T HF+G+DLVLP+ENTLIH+S   LACLAMA AP NVNSV+NVIA+LQQQ
Sbjct  343  TDEVSRTPPVTLHFEGLDLVLPVENTLIHSSARPLACLAMAEAPGNVNSVVNVIASLQQQ  402

Query  172  NLRVLFDTVNSRLGITHENCN  110
            N RV+ D  N R+G   E CN
Sbjct  403  NTRVMIDLANGRVGFAREVCN  423



>ref|XP_007141254.1| hypothetical protein PHAVU_008G180500g [Phaseolus vulgaris]
 gb|ESW13248.1| hypothetical protein PHAVU_008G180500g [Phaseolus vulgaris]
Length=470

 Score =   292 bits (748),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKS+YFSGSL+LGP GQP+ IR+TPLL+NP RPSLYYVNLTGV+VG++ V 
Sbjct  272  GVFSYCLPSFKSFYFSGSLKLGPTGQPRRIRSTPLLRNPRRPSLYYVNLTGVTVGRVQVP  331

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +P E+L FDP  G+GT+IDSGTVI+RFV+P Y AIR+EFR QV GPF S+G+FDTCF  T
Sbjct  332  LPTEYLAFDPNRGSGTIIDSGTVITRFVQPVYNAIRDEFRNQVKGPFVSIGSFDTCFVKT  391

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E +AP I F F G+DL LP ENTLIH++YG +ACLAMAAAPNNVNSVLNVIAN QQQNL
Sbjct  392  YETLAPLIKFRFTGLDLTLPYENTLIHSTYGAVACLAMAAAPNNVNSVLNVIANYQQQNL  451

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFDTVN+R+GI  E CN
Sbjct  452  RILFDTVNNRVGIARELCN  470



>ref|XP_002889768.1| hypothetical protein ARALYDRAFT_471076 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66027.1| hypothetical protein ARALYDRAFT_471076 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   286 bits (732),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LG +GQPK+IR TPLL+NP RPSLYYVNLTGVSVG + V 
Sbjct  251  GVFSYCLPSFRSFYFSGSLKLGLLGQPKSIRYTPLLRNPRRPSLYYVNLTGVSVGSVQVP  310

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            +   +LTFD  +GAGT+IDSGTVI+RF +P Y AIR+EFRKQV G FS+LGAFDTCF+  
Sbjct  311  VDPVYLTFDSNSGAGTIIDSGTVITRFAQPVYEAIRDEFRKQVNGSFSTLGAFDTCFSAD  370

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E + P IT H   +DL LPMENTLIH+S G L CL+MA    N N+VLNVIANLQQQNL
Sbjct  371  NENVTPKITLHMTSLDLKLPMENTLIHSSAGTLTCLSMAGIRQNANAVLNVIANLQQQNL  430

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSR+GI  E CN
Sbjct  431  RILFDVPNSRIGIAPEPCN  449



>ref|XP_008444946.1| PREDICTED: aspartic proteinase nepenthesin-1 [Cucumis melo]
Length=436

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G+FSYCLPSFKSYYFSGSL+LGPVGQPK IRTTPLL+NPHRPSLYYVNLTG+SVG++ V 
Sbjct  238  GIFSYCLPSFKSYYFSGSLKLGPVGQPKAIRTTPLLRNPHRPSLYYVNLTGISVGRVLVP  297

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            I  E L FDP TGAGT+IDSGTVI+RFV P Y AIR+EFRKQV G FS LGAFDTCFA +
Sbjct  298  ISPELLAFDPNTGAGTIIDSGTVITRFVPPVYTAIRDEFRKQVGGSFSPLGAFDTCFATS  357

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
             E  AP +T H  G+DL LPMEN+LIH+S G+LACLAMAAAPNNVN+V+NVIANLQQQN 
Sbjct  358  NEVSAPAVTLHLSGLDLRLPMENSLIHSSAGSLACLAMAAAPNNVNAVVNVIANLQQQNH  417

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  N++LGI  E CN
Sbjct  418  RILFDINNAKLGIARELCN  436



>ref|XP_009387158.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   285 bits (728),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 161/201 (80%), Gaps = 2/201 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSLRLGP+GQPK IR TPLLKNPHRPSLYYVNLT V VG+  V 
Sbjct  243  GVFSYCLPSFKSYYFSGSLRLGPLGQPKNIRFTPLLKNPHRPSLYYVNLTAVLVGRFEVP  302

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFA  353
            +P     FDP TGAGTV+DSGTVI+RFV P Y AIR+EFR+QV  +G ++SLGAFDTCF+
Sbjct  303  VPPGSFAFDPETGAGTVVDSGTVITRFVTPVYAAIRDEFRRQVNASGGYTSLGAFDTCFS  362

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
              +    P +T   +G+DLVL +ENTLIH+S   LACLAMAAAP+NVN+V+NVIA+LQQQ
Sbjct  363  TDEVASVPAVTLRMEGLDLVLRVENTLIHSSATPLACLAMAAAPDNVNAVVNVIASLQQQ  422

Query  172  NLRVLFDTVNSRLGITHENCN  110
            NLRV+ D  N+R+G   E CN
Sbjct  423  NLRVVVDAANARVGFAREVCN  443



>gb|AAK44106.2|AF370291_1 unknown protein [Arabidopsis thaliana]
Length=375

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 159/200 (80%), Gaps = 1/200 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LG +GQPK+IR TPLL+NP RPSLYYVNLTGVSVG + V 
Sbjct  176  GVFSYCLPSFRSFYFSGSLKLGLLGQPKSIRYTPLLRNPRRPSLYYVNLTGVSVGSVQVP  235

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAV  350
            +   +LTFD  +GAGT+IDSGTVI+RF +P Y AIR+EFRKQV    FS+LGAFDTCF+ 
Sbjct  236  VDPVYLTFDANSGAGTIIDSGTVITRFAQPVYEAIRDEFRKQVNVSSFSTLGAFDTCFSA  295

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
              E +AP IT H   +DL LPMENTLIH+S G L CL+MA    N N+VLNVIANLQQQN
Sbjct  296  DNENVAPKITLHMTSLDLKLPMENTLIHSSAGTLTCLSMAGIRQNANAVLNVIANLQQQN  355

Query  169  LRVLFDTVNSRLGITHENCN  110
            LR+LFD  NSR+GI  E CN
Sbjct  356  LRILFDVPNSRIGIAPEPCN  375



>ref|NP_563851.1| aspartyl protease-like protein [Arabidopsis thaliana]
 gb|AAB60729.1| F21M12.13 gene product [Arabidopsis thaliana]
 gb|AAM65914.1| nucleoid DNA-binding-like protein [Arabidopsis thaliana]
 gb|AAN86165.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28488.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=449

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 159/200 (80%), Gaps = 1/200 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSF+S+YFSGSL+LG +GQPK+IR TPLL+NP RPSLYYVNLTGVSVG + V 
Sbjct  250  GVFSYCLPSFRSFYFSGSLKLGLLGQPKSIRYTPLLRNPRRPSLYYVNLTGVSVGSVQVP  309

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT-GPFSSLGAFDTCFAV  350
            +   +LTFD  +GAGT+IDSGTVI+RF +P Y AIR+EFRKQV    FS+LGAFDTCF+ 
Sbjct  310  VDPVYLTFDANSGAGTIIDSGTVITRFAQPVYEAIRDEFRKQVNVSSFSTLGAFDTCFSA  369

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
              E +AP IT H   +DL LPMENTLIH+S G L CL+MA    N N+VLNVIANLQQQN
Sbjct  370  DNENVAPKITLHMTSLDLKLPMENTLIHSSAGTLTCLSMAGIRQNANAVLNVIANLQQQN  429

Query  169  LRVLFDTVNSRLGITHENCN  110
            LR+LFD  NSR+GI  E CN
Sbjct  430  LRILFDVPNSRIGIAPEPCN  449



>gb|EAY88829.1| hypothetical protein OsI_10302 [Oryza sativa Indica Group]
Length=440

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 161/206 (78%), Gaps = 8/206 (4%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVG-QPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWV  530
            GVFSYCLPS++SYYFSGSLRLG  G QP+++R TP+L+NPHR SLYYVN+TG+SVG+ WV
Sbjct  236  GVFSYCLPSYRSYYFSGSLRLGAGGGQPRSVRYTPMLRNPHRSSLYYVNVTGLSVGRAWV  295

Query  529  YIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCF  356
             +P     FD ATGAGTV+DSGTVI+R+  P Y A+REEFR+QV  P  ++SLGAFDTCF
Sbjct  296  KVPAGSFAFDAATGAGTVVDSGTVITRWTAPVYAALREEFRRQVAAPSGYTSLGAFDTCF  355

Query  355  AVTKEFM---APPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIA  188
              T E     AP +T H   G+DL LPMENTLIH+S   LACLAMA AP NVNSV+NVIA
Sbjct  356  N-TDEVAAGGAPAVTVHMDGGVDLALPMENTLIHSSATPLACLAMAEAPQNVNSVVNVIA  414

Query  187  NLQQQNLRVLFDTVNSRLGITHENCN  110
            NLQQQN+RV+FD  NSR+G   E+CN
Sbjct  415  NLQQQNIRVVFDVANSRIGFAKESCN  440



>ref|XP_003558637.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brachypodium 
distachyon]
Length=432

 Score =   273 bits (699),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 159/204 (78%), Gaps = 5/204 (2%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPS+KSYYFSGSLRLG  GQP+ +R TP+LKNP+R SLYYVN+TG+SVG+  V 
Sbjct  229  GVFSYCLPSYKSYYFSGSLRLGAAGQPRGVRYTPMLKNPNRSSLYYVNVTGLSVGRAPVK  288

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFA  353
            +P     FDPATGAGTV+DSGTVI+R+  P Y A+REEFR+ V  P  ++SLGAFDTCF 
Sbjct  289  VPAGSFAFDPATGAGTVVDSGTVITRWTPPVYAALREEFRRHVAAPSGYTSLGAFDTCFN  348

Query  352  VTK--EFMAPPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
              +    +AP +T H   G+DL LPMENTLIH+S   LACLAMA AP NVN+V+NV+ANL
Sbjct  349  TDEVAAGVAPAVTVHMDGGLDLALPMENTLIHSSATPLACLAMAEAPQNVNAVVNVLANL  408

Query  181  QQQNLRVLFDTVNSRLGITHENCN  110
            QQQNLRV+FD  NSR+G   E+CN
Sbjct  409  QQQNLRVVFDVANSRVGFARESCN  432



>ref|NP_001049205.1| Os03g0186900 [Oryza sativa Japonica Group]
 dbj|BAD26705.1| Radc1 [Oryza sativa Japonica Group]
 gb|ABF94364.1| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11119.1| Os03g0186900 [Oryza sativa Japonica Group]
 dbj|BAG88249.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99854.1| unnamed protein product [Oryza sativa Japonica Group]
Length=438

 Score =   273 bits (699),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 160/206 (78%), Gaps = 8/206 (4%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVG-QPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWV  530
            GVFSYCLPS++SYYFSGSLRLG  G QP+++R TP+L+NPHR SLYYVN+TG+SVG  WV
Sbjct  234  GVFSYCLPSYRSYYFSGSLRLGAGGGQPRSVRYTPMLRNPHRSSLYYVNVTGLSVGHAWV  293

Query  529  YIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCF  356
             +P     FD ATGAGTV+DSGTVI+R+  P Y A+REEFR+QV  P  ++SLGAFDTCF
Sbjct  294  KVPAGSFAFDAATGAGTVVDSGTVITRWTAPVYAALREEFRRQVAAPSGYTSLGAFDTCF  353

Query  355  AVTKEFM---APPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIA  188
              T E     AP +T H   G+DL LPMENTLIH+S   LACLAMA AP NVNSV+NVIA
Sbjct  354  N-TDEVAAGGAPAVTVHMDGGVDLALPMENTLIHSSATPLACLAMAEAPQNVNSVVNVIA  412

Query  187  NLQQQNLRVLFDTVNSRLGITHENCN  110
            NLQQQN+RV+FD  NSR+G   E+CN
Sbjct  413  NLQQQNIRVVFDVANSRVGFAKESCN  438



>ref|XP_006841210.1| hypothetical protein AMTR_s00135p00030880 [Amborella trichopoda]
 gb|ERN02885.1| hypothetical protein AMTR_s00135p00030880 [Amborella trichopoda]
Length=430

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 152/197 (77%), Gaps = 6/197 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKSYYFSGSLRLGP  QPK IRTTPLL + HRPSLYY NLT +S+G + V +P
Sbjct  240  FSYCLPSFKSYYFSGSLRLGPASQPKHIRTTPLLTSSHRPSLYYANLTAISIGALLVPVP  299

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVTKE  341
                 F+P TGAGT+IDSGTVISRFV P Y A+R+EF++ V GPFS LGAFDTCF    +
Sbjct  300  G----FNPLTGAGTIIDSGTVISRFVAPVYEAVRDEFKRVVAGPFSPLGAFDTCFPAPMD  355

Query  340  FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLRV  161
               P +T HF+G+DLVLP EN LIH S G+LACLAMAA P +VN  LNVIANLQQQN R+
Sbjct  356  V--PTVTLHFEGLDLVLPAENVLIHASEGSLACLAMAATPGDVNLALNVIANLQQQNHRL  413

Query  160  LFDTVNSRLGITHENCN  110
            LFD  N+RLGI  E CN
Sbjct  414  LFDLPNARLGIAREACN  430



>gb|ACN34435.1| unknown [Zea mays]
Length=216

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 159/205 (78%), Gaps = 7/205 (3%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPS++SYYFSGSLRLG  GQP+ +R TPLL NPHRPSLYYVN+TG+SVG+ WV 
Sbjct  13   GVFSYCLPSYRSYYFSGSLRLGAAGQPRNVRHTPLLTNPHRPSLYYVNVTGLSVGRTWVK  72

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFA  353
            +P     FDPATGAGTVIDSGTVI+R+  P Y A+REEFR+QV  P  ++SLGAFDTCF 
Sbjct  73   VPAGSFAFDPATGAGTVIDSGTVITRWTAPVYAALREEFRRQVAAPSGYTSLGAFDTCFN  132

Query  352  VTKEFM---APPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIAN  185
             T E     APP+T H   G+DL LPMENTLIH+S   LACLAMA AP NVN+V+NV+AN
Sbjct  133  -TDEVAAGGAPPVTLHMDGGVDLTLPMENTLIHSSATPLACLAMAEAPQNVNAVVNVVAN  191

Query  184  LQQQNLRVLFDTVNSRLGITHENCN  110
            LQQQN+RV+ D   SR+G   E CN
Sbjct  192  LQQQNVRVVVDVAGSRVGFAREPCN  216



>gb|ACF87730.1| unknown [Zea mays]
Length=216

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 159/205 (78%), Gaps = 7/205 (3%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPS++SYYFSGSLRLG  GQP+ +R TPLL NPHRPSLYYVN+TG+SVG+ WV 
Sbjct  13   GVFSYCLPSYRSYYFSGSLRLGAAGQPRNVRYTPLLTNPHRPSLYYVNVTGLSVGRTWVK  72

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFA  353
            +P     FDPATGAGTVIDSGTVI+R+  P Y A+REEFR+QV  P  ++SLGAFDTCF 
Sbjct  73   VPAGSFAFDPATGAGTVIDSGTVITRWTAPVYAALREEFRRQVAAPSGYTSLGAFDTCFN  132

Query  352  VTKEFM---APPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIAN  185
             T E     APP+T H   G+DL LPMENTLIH+S   LACLAMA AP NVN+V+NV+AN
Sbjct  133  -TDEVAAGGAPPVTLHMDGGVDLTLPMENTLIHSSATPLACLAMAEAPQNVNAVVNVVAN  191

Query  184  LQQQNLRVLFDTVNSRLGITHENCN  110
            LQQQN+RV+ D   SR+G   E CN
Sbjct  192  LQQQNVRVVVDVAGSRVGFAREPCN  216



>ref|XP_008231689.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Prunus 
mume]
Length=435

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 153/197 (78%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPVGQPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  240  FSYCLPSFKSLNFSGSLRLGPVGQPKRIKFTPLLKNPRRSSLYYVNLNAIRVGRRIVDIP  299

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
               L F+P TGAGT+IDSGTV +R VEPAYVA+R EFR++V   PF +LG FDTC++V  
Sbjct  300  PAALAFNPTTGAGTIIDSGTVFTRLVEPAYVAVRNEFRRRVGIYPFQTLGGFDTCYSV--  357

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F+ P ITF F GM++ LP +N +IH++ G++ CLAMAAAP+NVNSVLNVIAN+QQQN R
Sbjct  358  PFVVPTITFMFSGMNVTLPEDNIVIHSTAGSITCLAMAAAPDNVNSVLNVIANMQQQNHR  417

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLG+  E C
Sbjct  418  VLIDVPNSRLGVARERC  434



>gb|ACE96805.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96806.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96807.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96808.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96809.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96810.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96811.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96812.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96813.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96814.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96815.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96816.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96818.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96819.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96820.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96821.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96822.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96823.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96824.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96825.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96826.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96827.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96828.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96829.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96830.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96831.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96832.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96833.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96834.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96835.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96836.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96837.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96838.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96839.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96840.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96841.1| aspartyl protease, partial [Populus tremula]
 gb|ACE96842.1| aspartyl protease, partial [Populus tremula]
Length=339

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL+NPHRPSLYYVNLTGVSVG+I V 
Sbjct  187  GVFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRNPHRPSLYYVNLTGVSVGRIKVP  246

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            IP E L FDP TGAGT+IDSGTVI+RFV+P Y AIR+EFRKQV GP SSLGAFDTCFA T
Sbjct  247  IPSEQLVFDPNTGAGTIIDSGTVITRFVQPVYFAIRDEFRKQVNGPISSLGAFDTCFAAT  306

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNL  248
             E  AP +T HF+G++LVLPMEN+LIH+S G++
Sbjct  307  NEAEAPAVTLHFEGLNLVLPMENSLIHSSSGSV  339



>ref|XP_010269414.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Nelumbo nucifera]
Length=434

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 155/197 (79%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QPK I+TTPLL+NP R SLYYVN+ G+SVG+ ++ IP
Sbjct  239  FSYCLPSFKSLNFSGSLRLGPVAQPKRIKTTPLLRNPRRSSLYYVNMIGISVGRKFLDIP  298

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L ++ ATGAGT+ DSGTV +R V PAY A+R+EFR+++ G   +SLG FDTC+ V  
Sbjct  299  PSALAYNEATGAGTIFDSGTVFTRLVAPAYTALRDEFRRRIKGANVTSLGGFDTCYTV--  356

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP ITFHF GM++ LP++N LIH++ G++ CLAMAAAP+NVNSVLNVIAN+QQQN R
Sbjct  357  PIVAPAITFHFTGMNVTLPLDNMLIHSTAGSITCLAMAAAPDNVNSVLNVIANMQQQNHR  416

Query  163  VLFDTVNSRLGITHENC  113
            +L D  NSRLGI  E C
Sbjct  417  LLIDVPNSRLGIARELC  433



>gb|ACE96817.1| aspartyl protease, partial [Populus tremula]
Length=339

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPSFKSYYFSGSL+LGPVGQPK+IRTTPLL+NPHRPSLYYVNLTGVSVG+I V 
Sbjct  187  GVFSYCLPSFKSYYFSGSLKLGPVGQPKSIRTTPLLRNPHRPSLYYVNLTGVSVGRIKVP  246

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            IP E L FDP TGAGT+IDSGTVI+RFV+P Y AIR+EFRKQV GP SSLGAFDTCFA T
Sbjct  247  IPSEQLVFDPNTGAGTIIDSGTVITRFVQPVYFAIRDEFRKQVNGPISSLGAFDTCFAET  306

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNL  248
             E  AP +T HF+G++LVLPMEN+LIH+S G++
Sbjct  307  NEAEAPAVTLHFEGLNLVLPMENSLIHSSSGSV  339



>ref|XP_007218027.1| hypothetical protein PRUPE_ppa005966mg [Prunus persica]
 gb|EMJ19226.1| hypothetical protein PRUPE_ppa005966mg [Prunus persica]
Length=435

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 152/197 (77%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPVGQP  I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  240  FSYCLPSFKSLNFSGSLRLGPVGQPIRIKYTPLLKNPRRSSLYYVNLNAIRVGRRIVDIP  299

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG-PFSSLGAFDTCFAVTK  344
               L F+P TGAGT+IDSGTV +R VEPAYVA+R EFR++V   PF +LG FDTC++V  
Sbjct  300  PAALAFNPTTGAGTIIDSGTVFTRLVEPAYVAVRNEFRRRVGKYPFQTLGGFDTCYSV--  357

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F+ P ITF F GM++ LP +N +IH++ G++ CLAMAAAP+NVNSVLNVIAN+QQQN R
Sbjct  358  PFVVPTITFMFSGMNVTLPEDNIVIHSTAGSITCLAMAAAPDNVNSVLNVIANMQQQNHR  417

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLG+  E C
Sbjct  418  VLIDVPNSRLGVARERC  434



>gb|ACF83459.1| unknown [Zea mays]
 gb|ACF86066.1| unknown [Zea mays]
 gb|ACL53485.1| unknown [Zea mays]
 gb|ACL53554.1| unknown [Zea mays]
 gb|ACN29126.1| unknown [Zea mays]
 tpg|DAA43775.1| TPA: aspartic proteinase nepenthesin-1 [Zea mays]
Length=431

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 159/205 (78%), Gaps = 7/205 (3%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPS++SYYFSGSLRLG  GQP+ +R TPLL NPHRPSLYYVN+TG+SVG+ WV 
Sbjct  228  GVFSYCLPSYRSYYFSGSLRLGAAGQPRNVRYTPLLTNPHRPSLYYVNVTGLSVGRTWVK  287

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFA  353
            +P     FDPATGAGTVIDSGTVI+R+  P Y A+REEFR+QV  P  ++SLGAFDTCF 
Sbjct  288  VPAGSFAFDPATGAGTVIDSGTVITRWTAPVYAALREEFRRQVAAPSGYTSLGAFDTCFN  347

Query  352  VTKEFM---APPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIAN  185
             T E     APP+T H   G+DL LPMENTLIH+S   LACLAMA AP NVN+V+NV+AN
Sbjct  348  -TDEVAAGGAPPVTLHMDGGVDLTLPMENTLIHSSATPLACLAMAEAPQNVNAVVNVVAN  406

Query  184  LQQQNLRVLFDTVNSRLGITHENCN  110
            LQQQN+RV+ D   SR+G   E CN
Sbjct  407  LQQQNVRVVVDVAGSRVGFAREPCN  431



>ref|NP_001131154.1| uncharacterized protein LOC100192462 precursor [Zea mays]
 gb|ACF79448.1| unknown [Zea mays]
Length=431

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 159/205 (78%), Gaps = 7/205 (3%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPS++SYYFSGSLRLG  GQP+ +R TPLL NPHRPSLYYVN+TG+SVG+ WV 
Sbjct  228  GVFSYCLPSYRSYYFSGSLRLGAAGQPRNVRYTPLLTNPHRPSLYYVNVTGLSVGRTWVK  287

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFA  353
            +P     FDPATGAGTVIDSGTVI+R+  P Y A+REEFR+QV  P  ++SLGAFDTCF 
Sbjct  288  VPAGSFAFDPATGAGTVIDSGTVITRWTAPVYAALREEFRRQVAAPSGYTSLGAFDTCFN  347

Query  352  VTKEFM---APPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIAN  185
             T E     APP+T H   G+DL LPMENTLIH+S   LACLAMA AP NVN+V+NV+AN
Sbjct  348  -TDEVAAGGAPPVTLHMDGGVDLTLPMENTLIHSSATPLACLAMAEAPQNVNAVVNVVAN  406

Query  184  LQQQNLRVLFDTVNSRLGITHENCN  110
            LQQQN+RV+ D   SR+G   E CN
Sbjct  407  LQQQNVRVVVDVAGSRVGFAREPCN  431



>ref|NP_001266543.1| aspartic proteinase nepenthesin-1 precursor [Zea mays]
 gb|ACG35399.1| aspartic proteinase nepenthesin-1 precursor [Zea mays]
Length=431

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 159/205 (78%), Gaps = 7/205 (3%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPS++SYYFSGSLRLG  GQP+ +R TPLL NPHRPSLYYVN+TG+SVG+ WV 
Sbjct  228  GVFSYCLPSYRSYYFSGSLRLGAAGQPRNVRYTPLLTNPHRPSLYYVNVTGLSVGRTWVK  287

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFA  353
            +P     FDPATGAGTVIDSGTVI+R+  P Y A+REEFR+QV  P  ++SLGAFDTCF 
Sbjct  288  VPAGSFAFDPATGAGTVIDSGTVITRWTAPVYAALREEFRRQVAAPSGYTSLGAFDTCFN  347

Query  352  VTKEFM---APPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIAN  185
             T E     APP+T H   G+DL LPMENTLIH+S   LACLAMA AP NVN+V+NV+AN
Sbjct  348  -TDEVAAGGAPPVTLHMDGGVDLTLPMENTLIHSSATPLACLAMAEAPQNVNAVVNVVAN  406

Query  184  LQQQNLRVLFDTVNSRLGITHENCN  110
            LQQQN+RV+ D   SR+G   E CN
Sbjct  407  LQQQNVRVVVDVAGSRVGFAREPCN  431



>ref|XP_002461152.1| hypothetical protein SORBIDRAFT_02g041760 [Sorghum bicolor]
 gb|EER97673.1| hypothetical protein SORBIDRAFT_02g041760 [Sorghum bicolor]
Length=452

 Score =   261 bits (667),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 149/198 (75%), Gaps = 1/198 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G FSYCLPSFKS  FSG+LRLG  GQP  I+TTPLL NPHR SLYYVN+TG+ VG+  V 
Sbjct  253  GTFSYCLPSFKSLNFSGTLRLGRNGQPPRIKTTPLLANPHRSSLYYVNMTGIRVGRKVVP  312

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            IP   L FDPATGAGTV+DSGT+ +R V PAYVA+R+E R++V  P SSLG FDTCF  T
Sbjct  313  IPPPALAFDPATGAGTVLDSGTMFTRLVAPAYVAVRDEVRRRVGAPVSSLGGFDTCFNTT  372

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
                 PP+T  F GM + LP EN +IH++YG ++CLAMAAAP+ VN+VLNVIA++QQQN 
Sbjct  373  -AVAWPPVTLLFDGMQVTLPEENVVIHSTYGTISCLAMAAAPDGVNTVLNVIASMQQQNH  431

Query  166  RVLFDTVNSRLGITHENC  113
            RVLFD  N R+G   E C
Sbjct  432  RVLFDVPNGRVGFARERC  449



>ref|XP_006649524.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=429

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 161/205 (79%), Gaps = 7/205 (3%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPS+KSYYFSGSLRLG  GQP+++R TP+L+NPHR SLYYVN+TG+SVG+ WV 
Sbjct  226  GVFSYCLPSYKSYYFSGSLRLGAGGQPRSVRYTPMLRNPHRSSLYYVNVTGLSVGRAWVK  285

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFA  353
             P     FDP TGAGTV+DSGTVI+R+  P Y A+R+EFR+QV  P  ++SLGAFDTCF 
Sbjct  286  APAGSFAFDPNTGAGTVVDSGTVITRWTAPVYAALRDEFRRQVAAPSGYTSLGAFDTCFN  345

Query  352  VTKEFM---APPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIAN  185
             T E     APP+T H   G+DL LPMENTLIH+S   LACLAMA AP NVNSV+NV+AN
Sbjct  346  -TDEVAAGGAPPVTIHMDGGVDLTLPMENTLIHSSATPLACLAMAEAPQNVNSVVNVVAN  404

Query  184  LQQQNLRVLFDTVNSRLGITHENCN  110
            LQQQN+RV+FD  NSR+G   E+CN
Sbjct  405  LQQQNIRVVFDVTNSRVGFAKESCN  429



>ref|XP_010095993.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62686.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=435

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 3/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFK+  FSGSLRLGP+GQPK I+ TPLLKNP R SLYYV L G+ VG+  V IP
Sbjct  240  FSYCLPSFKALNFSGSLRLGPIGQPKRIKYTPLLKNPRRSSLYYVILRGIKVGRRTVDIP  299

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
               L F+P TGAGTVIDSGTV +R V PAY A+R+EFR+++     SSLG FDTC++V  
Sbjct  300  PSALAFNPTTGAGTVIDSGTVFTRLVAPAYTAVRDEFRRRMGKAALSSLGGFDTCYSV--  357

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              + P +TF F+GM++ LP +N LIH+S G+L CLAMAAAP NVNSVLNVIAN+QQQN R
Sbjct  358  PIVVPTLTFMFEGMNVTLPQDNFLIHSSAGSLTCLAMAAAPENVNSVLNVIANMQQQNHR  417

Query  163  VLFDTVNSRLGITHENCN  110
            VLFD  NSRLG+  E C+
Sbjct  418  VLFDLPNSRLGVARETCS  435



>gb|EMS48821.1| Aspartic proteinase nepenthesin-1 [Triticum urartu]
Length=290

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 149/199 (75%), Gaps = 3/199 (2%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G FSYCLPSFKS  FSG+LRLG  GQP  I+TTPLL NPHR SLYYV +TG+ VGK  V 
Sbjct  91   GTFSYCLPSFKSLNFSGTLRLGRKGQPLRIKTTPLLVNPHRSSLYYVGMTGIRVGKKVVP  150

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG-PFSSLGAFDTCFAV  350
            IP   L FDPATGAGTV+DSGT+ +R V PAYVA+R+E R ++ G P SSLG  DTC+  
Sbjct  151  IPPSALAFDPATGAGTVLDSGTMFTRLVAPAYVAVRDEVRHRIRGAPLSSLGGVDTCYNT  210

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            T ++  PP+TF F GM + LP +N +IH++YG  +CLAMAAAP+ VN+VLNVIA++QQQN
Sbjct  211  TVKW--PPVTFMFTGMQVTLPADNLVIHSTYGTTSCLAMAAAPDGVNTVLNVIASMQQQN  268

Query  169  LRVLFDTVNSRLGITHENC  113
             RVLFD  N R+G   E C
Sbjct  269  HRVLFDVPNGRVGFAREQC  287



>dbj|BAJ92880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 152/199 (76%), Gaps = 3/199 (2%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G FSYCLPSFKS  FSG+LRLG  GQP  I+TTPLL NPHR SLYYV++TG+ VGK  V 
Sbjct  249  GTFSYCLPSFKSLNFSGTLRLGRKGQPLRIKTTPLLVNPHRSSLYYVSMTGIRVGKKVVP  308

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG-PFSSLGAFDTCFAV  350
            IP   L FDPATGAGTV+DSGT+ +R V PAYVA+R+E R+++ G P SSLG FDTC+  
Sbjct  309  IPPAALAFDPATGAGTVLDSGTMFTRLVAPAYVAVRDEVRRRIRGAPLSSLGGFDTCYNT  368

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            T ++  PP+TF F GM + LP +N +IH++YG  +CLAMAAAP+ VN+VLNVIA++QQQN
Sbjct  369  TVKW--PPVTFMFTGMQVTLPADNLVIHSTYGTTSCLAMAAAPDGVNTVLNVIASMQQQN  426

Query  169  LRVLFDTVNSRLGITHENC  113
             R+LFD  N R+G   E C
Sbjct  427  HRILFDVPNGRVGFAREQC  445



>ref|XP_004511040.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=434

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 151/198 (76%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  238  FSYCLPSFKSLNFSGSLRLGPVAQPKRIKYTPLLKNPRRSSLYYVNLVAIKVGRRIVDIP  297

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG--PFSSLGAFDTCFAVT  347
               L F+P TGAGT+ DSGTV +R VEPAY A++ EFR++V    P ++LG FDTC+  T
Sbjct  298  PAALAFNPTTGAGTIFDSGTVFTRLVEPAYTAVKNEFRRRVGPKLPVTTLGGFDTCY--T  355

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
               +AP ITF F GM++ LP +NTLIH++ G++ CLAMAAAP+NVNSVLNVIAN+QQQN 
Sbjct  356  FPIVAPNITFMFSGMNVTLPQDNTLIHSTAGSITCLAMAAAPDNVNSVLNVIANMQQQNH  415

Query  166  RVLFDTVNSRLGITHENC  113
            RVLFD  NSRLG+  E C
Sbjct  416  RVLFDVPNSRLGVARELC  433



>ref|XP_007148927.1| hypothetical protein PHAVU_005G025900g [Phaseolus vulgaris]
 gb|ESW20921.1| hypothetical protein PHAVU_005G025900g [Phaseolus vulgaris]
Length=436

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 151/200 (76%), Gaps = 6/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QP  I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  237  FSYCLPSFKSLNFSGSLRLGPVAQPIRIKYTPLLKNPRRSSLYYVNLVAIRVGRRVVDIP  296

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP----FSSLGAFDTCFA  353
             E L F+PATGAGT+ DSGTV +R V PAYVA+R+EFR++V G      +SLG FDTC+ 
Sbjct  297  PEALGFNPATGAGTIFDSGTVFTRLVAPAYVAVRDEFRRRVGGKANLTVTSLGGFDTCYT  356

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
            V    +AP ITF F GM++ LP +N LIH+S G+  CLAMA+AP+NVNSVLNVIAN+QQQ
Sbjct  357  V--PIVAPTITFIFSGMNVTLPQDNILIHSSAGSTTCLAMASAPDNVNSVLNVIANMQQQ  414

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  NSRLG+  E C
Sbjct  415  NHRVLFDVPNSRLGVARELC  434



>ref|XP_007133749.1| hypothetical protein PHAVU_011G206100g [Phaseolus vulgaris]
 gb|ESW05743.1| hypothetical protein PHAVU_011G206100g [Phaseolus vulgaris]
Length=438

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 151/200 (76%), Gaps = 6/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFK+  FSGSLRLGPV QPK I+ TPLLKNP R SLYYVNL  V VG+  V IP
Sbjct  240  FSYCLPSFKTLNFSGSLRLGPVAQPKRIKFTPLLKNPRRSSLYYVNLVAVRVGRRIVDIP  299

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG----PFSSLGAFDTCFA  353
             E L F+P TGAGT+ DSGTV +R VEPAY A+R EFR++VT       + LG FDTC+ 
Sbjct  300  PEALAFNPTTGAGTIFDSGTVFTRLVEPAYTAVRNEFRRRVTVGKKLTVTRLGGFDTCYT  359

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
            V    +AP ITF F GM++ LP +NTLIH++ G++ CLAMAAAP+NVNSVLNVIAN+QQQ
Sbjct  360  V--PIVAPTITFMFSGMNVTLPPDNTLIHSTAGSVTCLAMAAAPDNVNSVLNVIANMQQQ  417

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVL+D  NSRLG+  E C
Sbjct  418  NHRVLYDVPNSRLGVARELC  437



>gb|KHG15852.1| Asparticase nepenthesin-1 [Gossypium arboreum]
Length=316

 Score =   252 bits (643),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 150/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+F+S  FSGSLRLGPVGQP  I+ TPLLKNP RPSLY+VNL G+ VG   V IP
Sbjct  121  FSYCLPNFRSANFSGSLRLGPVGQPVRIKYTPLLKNPRRPSLYFVNLIGIRVGNKVVDIP  180

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
               + F+P TG GT+IDSGTV +R VEPAYV +R+EFR++V     +SLG FDTC+ V  
Sbjct  181  PSAIAFNPTTGGGTIIDSGTVFTRLVEPAYVTVRDEFRRRVKVANVTSLGGFDTCYTV--  238

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP ITF F  M++ LP +N LIH++ G++ CLAMA+AP+NVNSVLNVIAN+QQQN R
Sbjct  239  PIVAPTITFLFTNMNVTLPQDNLLIHSTAGSITCLAMASAPDNVNSVLNVIANMQQQNHR  298

Query  163  VLFDTVNSRLGITHENC  113
            +LFD  NSRLG+  E C
Sbjct  299  ILFDVPNSRLGVARELC  315



>gb|AGV54394.1| aspartic proteinase nepenthesin-1-like protein [Phaseolus vulgaris]
Length=436

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 151/200 (76%), Gaps = 6/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QP  I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  237  FSYCLPSFKSLNFSGSLRLGPVAQPIRIKYTPLLKNPRRSSLYYVNLVAIRVGRRVVDIP  296

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP----FSSLGAFDTCFA  353
             E L F+PATGAGT+ DSGTV +R V PAYVA+R+EFR++V G      +SLG FDTC+ 
Sbjct  297  PEALGFNPATGAGTIFDSGTVFTRLVAPAYVAVRDEFRRRVGGKANLTVTSLGGFDTCYT  356

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
            V    +AP ITF F GM++ LP +N LIH+S G+  CLAMA+AP+NVNSVLNVIAN+QQQ
Sbjct  357  V--PIVAPTITFIFSGMNVTLPQDNILIHSSAGSTTCLAMASAPDNVNSVLNVIANMQQQ  414

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  NSRLG+  E C
Sbjct  415  NHRVLFDVPNSRLGVARELC  434



>ref|XP_004985428.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=452

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 157/205 (77%), Gaps = 7/205 (3%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPS+KSYYFSGSLRLG  GQP+  R TPLL NPHRPSLYYVN+TG+SVG+ WV 
Sbjct  249  GVFSYCLPSYKSYYFSGSLRLGAAGQPRNARYTPLLSNPHRPSLYYVNVTGLSVGRAWVK  308

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFA  353
            +P     FDPATGAGTVIDSGTVI+R+  P Y A+REEFR+QV  P  ++SLGAFDTCF 
Sbjct  309  VPAGAFAFDPATGAGTVIDSGTVITRWTAPVYAALREEFRRQVGAPSGYTSLGAFDTCFN  368

Query  352  VTKEFM---APPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIAN  185
             T E     AP +T H   G+DL LPMENTLIH+S   LACLAMA AP NVNSV+NV+AN
Sbjct  369  -TDEVAAGGAPAVTLHMDGGVDLTLPMENTLIHSSATPLACLAMAEAPQNVNSVVNVVAN  427

Query  184  LQQQNLRVLFDTVNSRLGITHENCN  110
            LQQQN+RV+ D   SR+G   E CN
Sbjct  428  LQQQNVRVVVDVAASRVGFAREPCN  452



>ref|XP_009139245.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=429

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 151/197 (77%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  234  FSYCLPNSKSSNFSGSLRLGPKFQPLRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDIP  293

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDPATGAGT+ DSGTV +R VEPAY+A+R+EFR++V     +SLG FDTC++ + 
Sbjct  294  TSALAFDPATGAGTIFDSGTVFTRLVEPAYLAVRDEFRRRVKNANATSLGGFDTCYSGSV  353

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F  PP+TF F GM++ +P +N LIH+S GN +CLAMAAAPNNVNSVLNVIA++QQQN R
Sbjct  354  VF--PPVTFMFAGMNVTIPPDNLLIHSSSGNTSCLAMAAAPNNVNSVLNVIASMQQQNHR  411

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  412  VLIDVPNSRLGISRETC  428



>ref|XP_008375374.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=434

 Score =   255 bits (651),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 152/198 (77%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPVGQPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  238  FSYCLPSFKSPNFSGSLRLGPVGQPKRIKYTPLLKNPRRSSLYYVNLNAIRVGRRIVDIP  297

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG--PFSSLGAFDTCFAVT  347
               L F+P TG+GT+ DSGTV +R V+PAY+A+R EFR++V    P +SLG FDTC++V 
Sbjct  298  PAALAFNPTTGSGTIFDSGTVFTRLVQPAYLAVRNEFRRRVGPKIPVTSLGGFDTCYSV-  356

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
              F+ P ITF F GM++ LP +N +IH++ G++ CLAMAA+P+NVNSVLNVIAN+QQQN 
Sbjct  357  -PFVVPTITFMFSGMNVTLPQDNIVIHSTAGSITCLAMAASPDNVNSVLNVIANMQQQNH  415

Query  166  RVLFDTVNSRLGITHENC  113
            RVL D  NSRLG+  E C
Sbjct  416  RVLIDVPNSRLGVAREAC  433



>emb|CDX76150.1| BnaA04g04140D [Brassica napus]
Length=429

 Score =   255 bits (651),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 151/197 (77%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  234  FSYCLPNSKSSNFSGSLRLGPKFQPLRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDIP  293

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDPATGAGT+ DSGTV +R VEPAY+A+R+EFR++V     +SLG FDTC++ + 
Sbjct  294  TSALAFDPATGAGTIFDSGTVFTRLVEPAYLAVRDEFRRRVKNANATSLGGFDTCYSGSV  353

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F  PP+TF F GM++ +P +N LIH+S GN +CLAMAAAPNNVNSVLNVIA++QQQN R
Sbjct  354  VF--PPVTFMFAGMNVTIPPDNLLIHSSSGNTSCLAMAAAPNNVNSVLNVIASMQQQNHR  411

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  412  VLIDVPNSRLGISRETC  428



>ref|XP_010276658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=440

 Score =   255 bits (651),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 150/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QP  I+TTPLL+NP R SLYYVNL G+SVG+  V+IP
Sbjct  244  FSYCLPSFKSLNFSGSLRLGPVAQPIRIKTTPLLRNPRRSSLYYVNLIGISVGRRLVHIP  303

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
                 F+  +GAGT+IDSGTV +R V PAY A+R+ FR+++ G   SSLG FDTC+ V  
Sbjct  304  PSVFAFNATSGAGTIIDSGTVFTRLVTPAYTAVRDAFRRRIKGATVSSLGGFDTCYTV--  361

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
               AP ITFHF G+++ LP +N LIH++ G++ CLAMAAAP+NVNSVLNVIAN+QQQN R
Sbjct  362  PVRAPTITFHFTGLNMSLPADNVLIHSTAGSITCLAMAAAPDNVNSVLNVIANMQQQNHR  421

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI  E C
Sbjct  422  VLIDVPNSRLGIARELC  438



>gb|EMT23351.1| Aspartic proteinase nepenthesin-1 [Aegilops tauschii]
Length=267

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 3/199 (2%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G FSYCLPSFKS  FSG+LRLG  GQP  I+TTPLL NPHR SLYYV +TG+ VGK  V 
Sbjct  68   GTFSYCLPSFKSLNFSGTLRLGRKGQPLRIKTTPLLVNPHRSSLYYVGMTGIRVGKKVVP  127

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG-PFSSLGAFDTCFAV  350
            IP   L FDPATGAGTV+DSGT+ +R V PAYVA+R+E R ++ G P SSLG FDT +  
Sbjct  128  IPPSALAFDPATGAGTVLDSGTMFTRLVAPAYVAVRDEVRHRIRGAPLSSLGGFDTWYNP  187

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            T ++  PP+TF F GM + LP +N +IH++YG  +CLAMAAAP+ VN+VLNV+A++QQQN
Sbjct  188  TVKW--PPVTFMFTGMQVTLPADNLVIHSTYGTTSCLAMAAAPDGVNTVLNVLASMQQQN  245

Query  169  LRVLFDTVNSRLGITHENC  113
             RVLFD  N R+G   E C
Sbjct  246  HRVLFDVPNGRVGFAREQC  264



>gb|KJB60281.1| hypothetical protein B456_009G297800 [Gossypium raimondii]
Length=432

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 152/199 (76%), Gaps = 3/199 (2%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
              FSYCLP+F+S  FSGSLRLGPVGQP  I+ TPLLKNP RPSLY+VNL G+ VG   V 
Sbjct  235  ATFSYCLPNFRSANFSGSLRLGPVGQPVRIKYTPLLKNPRRPSLYFVNLIGIRVGNKVVD  294

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAV  350
            IP   + F+P TGAGT+IDSGTV +R VEPAYVA+R+EFR++V     +SLG FDTC+ V
Sbjct  295  IPPSAIAFNPTTGAGTIIDSGTVFTRLVEPAYVAVRDEFRRRVKVANVTSLGGFDTCYTV  354

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
                +AP ITF F  M++ LP +N LIH++ G++ CLAMA+AP+NVNSVLNVIAN+QQQN
Sbjct  355  --PIVAPTITFMFTSMNVTLPQDNLLIHSTAGSITCLAMASAPDNVNSVLNVIANMQQQN  412

Query  169  LRVLFDTVNSRLGITHENC  113
             R+LFD  NSRLG+  E C
Sbjct  413  HRILFDVPNSRLGVARELC  431



>emb|CDY13202.1| BnaC04g26330D [Brassica napus]
Length=429

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 151/197 (77%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  234  FSYCLPNSKSSNFSGSLRLGPKFQPLRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDIP  293

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDPATGAGT+ DSGTV +R VEPAY+A+R+EFR++V     +SLG FDTC++ + 
Sbjct  294  TSALAFDPATGAGTIFDSGTVFTRLVEPAYLAVRDEFRRRVKNANATSLGGFDTCYSGSV  353

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F  PP+TF F GM++ +P +N LIH+S GN +CLAMAAAPNNVNSVLNVIA++QQQN R
Sbjct  354  VF--PPVTFMFAGMNVTIPPDNLLIHSSSGNTSCLAMAAAPNNVNSVLNVIASMQQQNHR  411

Query  163  VLFDTVNSRLGITHENC  113
            +L D  NSRLGI+ E C
Sbjct  412  ILIDLPNSRLGISRETC  428



>ref|XP_002513044.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF49547.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=431

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGPVGQPK I+TTPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  236  FSYCLPSFRSLNFSGSLRLGPVGQPKRIKTTPLLKNPRRSSLYYVNLMAIRVGRRVVDIP  295

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
               L F+P TGAGT+ DSGTV +R V PAY A+R+ FRK+V     +SLG FDTC+  T 
Sbjct  296  PSALAFNPTTGAGTIFDSGTVFTRLVAPAYTAVRDAFRKRVGNATVTSLGGFDTCY--TS  353

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP ITF F GM++ LP +N LIH++  ++ CLAMAAAP+NVNSVLNVIAN+QQQN R
Sbjct  354  PIVAPTITFMFSGMNVTLPPDNLLIHSTASSITCLAMAAAPDNVNSVLNVIANMQQQNHR  413

Query  163  VLFDTVNSRLGITHENC  113
            +LFD  NSRLG+  E C
Sbjct  414  ILFDVPNSRLGVAREPC  430



>ref|XP_002303933.2| hypothetical protein POPTR_0003s19490g [Populus trichocarpa]
 gb|EEE78912.2| hypothetical protein POPTR_0003s19490g [Populus trichocarpa]
Length=441

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 151/198 (76%), Gaps = 3/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF++  FSGSLRLGPVGQP  I+TTPLLKNP R SLYYV L G+ VG+  V IP
Sbjct  246  FSYCLPSFRTLNFSGSLRLGPVGQPPRIKTTPLLKNPRRSSLYYVKLNGIRVGRKIVDIP  305

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
            +  L F+P TGAGT+ DSGTV +R V PAY+A+R EFRK+V     SSLG FDTC++V  
Sbjct  306  RSALAFNPTTGAGTIFDSGTVFTRLVAPAYIAVRNEFRKRVGNATVSSLGGFDTCYSV--  363

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              + P ITF F GM++ +P EN LIH++ G  +CLAMAAAP+NVNSVLNVIA++QQQN R
Sbjct  364  PIVPPTITFMFSGMNVTMPPENLLIHSTAGVTSCLAMAAAPDNVNSVLNVIASMQQQNHR  423

Query  163  VLFDTVNSRLGITHENCN  110
            +LFD  NSRLG+  E C+
Sbjct  424  ILFDVPNSRLGVAREQCS  441



>ref|XP_002877976.1| hypothetical protein ARALYDRAFT_906847 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54235.1| hypothetical protein ARALYDRAFT_906847 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  230  FSYCLPNSKSSNFSGSLRLGPKNQPIRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDIP  289

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDPATGAGT+ DSGTV +R VEPAYVA+R EFR++V     +SLG FDTC++ + 
Sbjct  290  TSALAFDPATGAGTIFDSGTVYTRLVEPAYVAMRNEFRRRVKNANATSLGGFDTCYSGSV  349

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F  P +TF F GM++ LP +N LIH+S GNL+CLAMAAAP NVNSVLNVIA++QQQN R
Sbjct  350  VF--PSVTFMFAGMNVTLPPDNLLIHSSAGNLSCLAMAAAPTNVNSVLNVIASMQQQNHR  407

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  408  VLIDVPNSRLGISRETC  424



>ref|XP_008782021.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=444

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 149/197 (76%), Gaps = 2/197 (1%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSG+LRLGPVGQP  I+TTPL  NPHR SLYYV++ G+ VG+  V IP
Sbjct  249  FSYCLPSFKSLNFSGTLRLGPVGQPYRIKTTPLRSNPHRSSLYYVDMVGIRVGRKVVDIP  308

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVTKE  341
               L FD ATG GT+ DSGT+ +R V PAYVA+R+EFR++V G  +SLG FDTC+     
Sbjct  309  PAALAFDAATGGGTIFDSGTMFTRLVAPAYVAVRDEFRRRVRGKVTSLGGFDTCY--NGP  366

Query  340  FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLRV  161
            F+AP ITF F GM++ LP +N LIH++ G++ CLAMAA P+NVNSVLNVIAN+QQ N RV
Sbjct  367  FVAPAITFMFVGMNVTLPADNYLIHSTAGSITCLAMAATPDNVNSVLNVIANMQQMNHRV  426

Query  160  LFDTVNSRLGITHENCN  110
            LFD  N RLG+  E C+
Sbjct  427  LFDVPNGRLGVARERCS  443



>ref|XP_010504244.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=425

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  230  FSYCLPNSKSGNFSGSLRLGPKFQPMRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDIP  289

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDPATGAGT+ DSGTV +R VEPAYVA+R+EFR++V     +SLG FDTC+  + 
Sbjct  290  TSALAFDPATGAGTIFDSGTVYTRLVEPAYVAVRDEFRRRVKNANATSLGGFDTCY--SG  347

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              + P +TF F GM++ LP +N LIH+S GNL+CLAMAAAP NVNSVLNVIA++QQQN R
Sbjct  348  SVVYPSVTFMFAGMNVTLPTDNLLIHSSAGNLSCLAMAAAPTNVNSVLNVIASMQQQNHR  407

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  408  VLIDVPNSRLGISRETC  424



>ref|XP_010032290.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW51704.1| hypothetical protein EUGRSUZ_J01176 [Eucalyptus grandis]
Length=436

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 150/199 (75%), Gaps = 4/199 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+F+S  FSGSLRLGPVGQPK I+ TPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  239  FSYCLPNFRSTNFSGSLRLGPVGQPKKIKYTPLLKNPRRSSLYYVNLIGIRVGSKIVDIP  298

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFAVT  347
               L F+  TGAGT+ DSGTV +R VEPAYVA+R+ FRK++ G    +SLG FDTC+ V 
Sbjct  299  PSALAFNATTGAGTIFDSGTVYTRLVEPAYVAVRDAFRKRIGGSATVTSLGGFDTCYTV-  357

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
               +AP +TF F GM++ LP +N LIH++ G   CLAMA+APNNVNSVLNVIA++QQQN 
Sbjct  358  -PIVAPTMTFMFDGMNVTLPQDNLLIHSTAGTTTCLAMASAPNNVNSVLNVIASMQQQNH  416

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLG+  E C+
Sbjct  417  RLLFDVPNSRLGVAREQCS  435



>ref|XP_010032289.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Eucalyptus grandis]
Length=439

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 150/199 (75%), Gaps = 4/199 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+F+S  FSGSLRLGPVGQPK I+ TPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  242  FSYCLPNFRSTNFSGSLRLGPVGQPKKIKYTPLLKNPRRSSLYYVNLIGIRVGSKIVDIP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFAVT  347
               L F+  TGAGT+ DSGTV +R VEPAYVA+R+ FRK++ G    +SLG FDTC+ V 
Sbjct  302  PSALAFNATTGAGTIFDSGTVYTRLVEPAYVAVRDAFRKRIGGSATVTSLGGFDTCYTV-  360

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
               +AP +TF F GM++ LP +N LIH++ G   CLAMA+APNNVNSVLNVIA++QQQN 
Sbjct  361  -PIVAPTMTFMFDGMNVTLPQDNLLIHSTAGTTTCLAMASAPNNVNSVLNVIASMQQQNH  419

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSRLG+  E C+
Sbjct  420  RLLFDVPNSRLGVAREQCS  438



>gb|AAM66983.1| nucleoid DNA-binding-like protein [Arabidopsis thaliana]
Length=425

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  230  FSYCLPNSKSSNFSGSLRLGPKNQPIRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDIP  289

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDPATGAGT+ DSGTV +R VEPAYVA+R EFR++V     +SLG FDTC++ + 
Sbjct  290  TSALAFDPATGAGTIFDSGTVYTRLVEPAYVAVRNEFRRRVKNANATSLGGFDTCYSGSV  349

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F  P +TF F GM++ LP +N LIH+S GNL+CLAMAAAP NVNSVLNVIA++QQQN R
Sbjct  350  VF--PSVTFMFAGMNVTLPPDNLLIHSSAGNLSCLAMAAAPVNVNSVLNVIASMQQQNHR  407

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  408  VLIDVPNSRLGISRETC  424



>ref|XP_011020416.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=441

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 151/198 (76%), Gaps = 3/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF++  FSGSLRLGPVGQP+ I+TT LLKNP R SLYYV L G+ VG+  V IP
Sbjct  246  FSYCLPSFRTLNFSGSLRLGPVGQPRRIKTTLLLKNPRRSSLYYVKLNGIRVGRKIVDIP  305

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
            +  L F+P TGAGT+ DSGTV +R V PAY+A+R EFRK+V     SSLG FDTC++V  
Sbjct  306  RSALAFNPTTGAGTIFDSGTVFTRLVAPAYIAVRNEFRKRVGNATVSSLGGFDTCYSV--  363

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP ITF F GM++ +P EN LIH++ G  +CLAMAAAP+NVNSVLNVIA++QQQN R
Sbjct  364  PIVAPTITFMFSGMNVTMPRENLLIHSTAGVTSCLAMAAAPDNVNSVLNVIASMQQQNHR  423

Query  163  VLFDTVNSRLGITHENCN  110
            +LFD   SRLG+  E C+
Sbjct  424  ILFDVPRSRLGVAREQCS  441



>ref|NP_001266528.1| aspartic proteinase nepenthesin-1 precursor [Zea mays]
 gb|ACG35309.1| aspartic proteinase nepenthesin-1 precursor [Zea mays]
Length=450

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 148/196 (76%), Gaps = 5/196 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSG+LRLG  GQP+ I+TTPLL NPHR SLYYVN+TGV VG+  V IP
Sbjct  257  FSYCLPSFKSLNFSGTLRLGRNGQPQRIKTTPLLANPHRSSLYYVNMTGVRVGRKVVPIP  316

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVTKE  341
                 FDPATGAGTV+DSGT+ +R V PAYVA+R+E R++V  P SSLG FDTCF  T  
Sbjct  317  ----AFDPATGAGTVLDSGTMFTRLVAPAYVAVRDEVRRRVGAPVSSLGGFDTCFNTT-A  371

Query  340  FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLRV  161
               PP+T  F GM + LP EN +IH++YG ++CLAMAAAP+ VN+VLNVIA++QQQN RV
Sbjct  372  VAWPPMTLLFDGMQVTLPEENVVIHSTYGTISCLAMAAAPDGVNTVLNVIASMQQQNHRV  431

Query  160  LFDTVNSRLGITHENC  113
            LFD  N R+G   E C
Sbjct  432  LFDVPNGRVGFARERC  447



>ref|NP_191008.1| aspartyl protease family protein [Arabidopsis thaliana]
 emb|CAB81805.1| nucleoid DNA-binding-like protein [Arabidopsis thaliana]
 gb|AAL49945.1| AT3g54400/T12E18_90 [Arabidopsis thaliana]
 gb|AAM70549.1| AT3g54400/T12E18_90 [Arabidopsis thaliana]
 gb|AEE79226.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=425

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  230  FSYCLPNSKSSNFSGSLRLGPKNQPIRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDIP  289

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDPATGAGT+ DSGTV +R VEPAYVA+R EFR++V     +SLG FDTC++ + 
Sbjct  290  TSALAFDPATGAGTIFDSGTVYTRLVEPAYVAVRNEFRRRVKNANATSLGGFDTCYSGSV  349

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F  P +TF F GM++ LP +N LIH+S GNL+CLAMAAAP NVNSVLNVIA++QQQN R
Sbjct  350  VF--PSVTFMFAGMNVTLPPDNLLIHSSAGNLSCLAMAAAPVNVNSVLNVIASMQQQNHR  407

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  408  VLIDVPNSRLGISRETC  424



>ref|XP_010530469.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=433

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 150/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+F+S  FSGSLRLGPVGQP +I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  238  FSYCLPNFRSQNFSGSLRLGPVGQPVSIKTTPLLKNPRRSSLYYVNLVGIRVGNKVVDIP  297

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDP TGAGTVIDSGTV +R VEPAYVA+R+EFR+++     +SLG FDTCF    
Sbjct  298  PSALAFDPVTGAGTVIDSGTVFTRLVEPAYVAVRDEFRRRIKNANVTSLGGFDTCF--NG  355

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP ITF F GM++ LP +N LI ++ G+  CLAMAAAP+NVNSVLNVIA++QQQN R
Sbjct  356  PIVAPTITFMFAGMNVTLPQDNFLIRSTAGSTTCLAMAAAPDNVNSVLNVIASMQQQNHR  415

Query  163  VLFDTVNSRLGITHENC  113
            +L D  N+RLG+  E C
Sbjct  416  ILIDGTNNRLGVARELC  432



>gb|EEE67743.1| hypothetical protein OsJ_25435 [Oryza sativa Japonica Group]
Length=396

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 148/199 (74%), Gaps = 5/199 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSG+LRLG  GQP+ I+TTPLL NPHR SLYYVN+TG+ VGK  V IP
Sbjct  197  FSYCLPSFKSLNFSGTLRLGRNGQPRRIKTTPLLANPHRSSLYYVNMTGIRVGKKVVSIP  256

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               L FDPATGAGTV+DSGT+ +R V P Y+A+R+E R++V       SSLG FDTC+  
Sbjct  257  ASALAFDPATGAGTVLDSGTMFTRLVAPVYLALRDEVRRRVGAGAAAVSSLGGFDTCYNT  316

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            T  +  PP+T  F GM + LP EN +IHT+YG  +CLAMAAAP+ VN+VLNVIA++QQQN
Sbjct  317  TVAW--PPVTLLFDGMQVTLPEENVVIHTTYGTTSCLAMAAAPDGVNTVLNVIASMQQQN  374

Query  169  LRVLFDTVNSRLGITHENC  113
             RVLFD  N R+G   E+C
Sbjct  375  HRVLFDVPNGRVGFARESC  393



>gb|KHG09833.1| Asparticase nepenthesin-1 [Gossypium arboreum]
Length=429

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 151/197 (77%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP GQP  I+ T LLKNP RPSLY+VNL G+ VG+  V IP
Sbjct  234  FSYCLPSFRSPNFSGSLRLGPKGQPIRIKYTQLLKNPRRPSLYFVNLIGIRVGRRVVDIP  293

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
             + L F+P+TGAGT+ DSGTV +R VEPAY+A+R  FR++V     +SLG FDTC+ V  
Sbjct  294  PKALAFNPSTGAGTIFDSGTVFTRLVEPAYIAVRNAFRRRVKVANVTSLGGFDTCYTV--  351

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP ITF F GM++ LP EN LIH++ G++ CLAMA+AP+NVNSVLNVIAN+QQQN R
Sbjct  352  PIVAPTITFMFTGMNVTLPQENLLIHSTAGSITCLAMASAPDNVNSVLNVIANMQQQNHR  411

Query  163  VLFDTVNSRLGITHENC  113
            VLFD  NSRLG+  E C
Sbjct  412  VLFDVPNSRLGVARERC  428



>ref|NP_001130306.1| uncharacterized protein LOC100191400 precursor [Zea mays]
 gb|ACF78483.1| unknown [Zea mays]
 gb|ACF85799.1| unknown [Zea mays]
 gb|ACF87680.1| unknown [Zea mays]
 gb|ACN26383.1| unknown [Zea mays]
 gb|ACN28417.1| unknown [Zea mays]
 tpg|DAA63976.1| TPA: aspartic proteinase nepenthesin-1 [Zea mays]
Length=450

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 148/196 (76%), Gaps = 5/196 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSG+LRLG  GQP+ I+TTPLL NPHR SLYYVN+TG+ VG+  V IP
Sbjct  257  FSYCLPSFKSLNFSGTLRLGRNGQPQRIKTTPLLANPHRSSLYYVNMTGIRVGRKVVPIP  316

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVTKE  341
                 FDPATGAGTV+DSGT+ +R V PAYVA+R+E R++V  P SSLG FDTCF  T  
Sbjct  317  ----AFDPATGAGTVLDSGTMFTRLVAPAYVAVRDEVRRRVGAPVSSLGGFDTCFNTT-A  371

Query  340  FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLRV  161
               PP+T  F GM + LP EN +IH++YG ++CLAMAAAP+ VN+VLNVIA++QQQN RV
Sbjct  372  VAWPPVTLLFDGMQVTLPEENVVIHSTYGTISCLAMAAAPDGVNTVLNVIASMQQQNHRV  431

Query  160  LFDTVNSRLGITHENC  113
            LFD  N R+G   E C
Sbjct  432  LFDVPNGRVGFARERC  447



>gb|KDP40540.1| hypothetical protein JCGZ_24539 [Jatropha curcas]
Length=431

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 150/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSG+LRLGP GQPK I+TTPLL+NP R SLYYVNL  + VG+  V IP
Sbjct  236  FSYCLPSFRSLNFSGTLRLGPNGQPKRIKTTPLLRNPRRSSLYYVNLVAIRVGRRVVDIP  295

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
               L F+P TGAGT+ DSGTV +R V PAY A+R+ FRK+V     +SLG FDTC++V  
Sbjct  296  PSALAFNPTTGAGTIFDSGTVFTRLVTPAYTAVRDAFRKRVGNATVTSLGGFDTCYSV--  353

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP ITF F GM++ LP EN LIH++ G+ +CLA+AAAP+NVNSVLNVIAN+QQQN R
Sbjct  354  PIVAPTITFMFSGMNVTLPPENLLIHSTAGSTSCLAIAAAPDNVNSVLNVIANMQQQNHR  413

Query  163  VLFDTVNSRLGITHENC  113
            +LFD  NSRLG+  E C
Sbjct  414  ILFDVPNSRLGVAREQC  430



>ref|XP_010427138.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=425

 Score =   253 bits (645),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  230  FSYCLPNSKSGNFSGSLRLGPKFQPMRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDIP  289

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDPATGAGT+ DSGTV +R VEPAY+A+R+EFR++V     +SLG FDTC+  + 
Sbjct  290  TSALAFDPATGAGTIFDSGTVYTRLVEPAYLAVRDEFRRRVKNANATSLGGFDTCY--SG  347

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              + P +TF F GM++ LP +N LIH+S GNL+CLAMAAAP NVNSVLNVIA++QQQN R
Sbjct  348  SVVYPSVTFMFAGMNVTLPTDNLLIHSSAGNLSCLAMAAAPTNVNSVLNVIASMQQQNHR  407

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  408  VLIDVPNSRLGISRETC  424



>ref|XP_010515967.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=425

 Score =   253 bits (645),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  230  FSYCLPNSKSGNFSGSLRLGPKFQPMRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDIP  289

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDPATGAGT+ DSGTV +R VEPAY+A+R+EFR++V     +SLG FDTC+  + 
Sbjct  290  TSALAFDPATGAGTIFDSGTVYTRLVEPAYLAVRDEFRRRVKNANATSLGGFDTCY--SG  347

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              + P +TF F GM++ LP +N LIH+S GNL+CLAMAAAP NVNSVLNVIA++QQQN R
Sbjct  348  SVVYPSVTFMFAGMNVTLPTDNLLIHSSAGNLSCLAMAAAPTNVNSVLNVIASMQQQNHR  407

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  408  VLIDVPNSRLGISRETC  424



>gb|KHN13065.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=384

 Score =   251 bits (641),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 149/200 (75%), Gaps = 6/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFK+  FSGSLRLGPV QPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  186  FSYCLPSFKTLNFSGSLRLGPVAQPKRIKFTPLLKNPRRSSLYYVNLVAIRVGRRIVDIP  245

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG----PFSSLGAFDTCFA  353
             E L F+P TGAGTV DSGTV +R VEPAY A+R EFR+++        +SLG FDTC+ 
Sbjct  246  PEALAFNPNTGAGTVFDSGTVFTRLVEPAYNAVRNEFRRRIAVHKKLTVTSLGGFDTCYT  305

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
            V    +AP ITF F GM++ LP +N LIH++ G++ CLAMA AP+NVNSVLNVIAN+QQQ
Sbjct  306  V--PIVAPTITFMFSGMNVTLPPDNILIHSTAGSVTCLAMAPAPDNVNSVLNVIANMQQQ  363

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  NSRLG+  E C
Sbjct  364  NHRVLFDVPNSRLGVARELC  383



>ref|XP_004958568.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=446

 Score =   253 bits (645),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 145/196 (74%), Gaps = 1/196 (1%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSG+LRLG  GQP+ I+TTPLL NPHR SLYYVN+TG+ VG+  V IP
Sbjct  249  FSYCLPSFKSMNFSGTLRLGRNGQPQRIKTTPLLANPHRSSLYYVNMTGIRVGRKVVPIP  308

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVTKE  341
               L FDPATGAGTV+DSGT+ +R V PAY A+R+E R++V  P SSLG FDTCF     
Sbjct  309  AAALAFDPATGAGTVLDSGTMFTRLVAPAYAAVRDEVRRRVGAPVSSLGGFDTCFN-DPA  367

Query  340  FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLRV  161
               P +T  F GM + LP EN +IH++YG  +CLAMAAAP+ VN+VLNVIA++QQQN RV
Sbjct  368  VKWPAVTLLFDGMQVTLPEENVVIHSTYGTTSCLAMAAAPDGVNTVLNVIASMQQQNHRV  427

Query  160  LFDTVNSRLGITHENC  113
            LFD  N R+G   E C
Sbjct  428  LFDVPNGRVGFARERC  443



>ref|NP_001060521.1| Os07g0658600 [Oryza sativa Japonica Group]
 dbj|BAC15479.1| nucleoid DNA-binding-like protein [Oryza sativa Japonica Group]
 dbj|BAD31106.1| nucleoid DNA-binding-like protein [Oryza sativa Japonica Group]
 dbj|BAF22435.1| Os07g0658600 [Oryza sativa Japonica Group]
Length=449

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 148/199 (74%), Gaps = 5/199 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSG+LRLG  GQP+ I+TTPLL NPHR SLYYVN+TG+ VGK  V IP
Sbjct  250  FSYCLPSFKSLNFSGTLRLGRNGQPRRIKTTPLLANPHRSSLYYVNMTGIRVGKKVVSIP  309

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               L FDPATGAGTV+DSGT+ +R V P Y+A+R+E R++V       SSLG FDTC+  
Sbjct  310  ASALAFDPATGAGTVLDSGTMFTRLVAPVYLALRDEVRRRVGAGAAAVSSLGGFDTCYNT  369

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            T  +  PP+T  F GM + LP EN +IHT+YG  +CLAMAAAP+ VN+VLNVIA++QQQN
Sbjct  370  TVAW--PPVTLLFDGMQVTLPEENVVIHTTYGTTSCLAMAAAPDGVNTVLNVIASMQQQN  427

Query  169  LRVLFDTVNSRLGITHENC  113
             RVLFD  N R+G   E+C
Sbjct  428  HRVLFDVPNGRVGFARESC  446



>ref|XP_002468370.1| hypothetical protein SORBIDRAFT_01g044790 [Sorghum bicolor]
 gb|EER95368.1| hypothetical protein SORBIDRAFT_01g044790 [Sorghum bicolor]
Length=408

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 157/205 (77%), Gaps = 7/205 (3%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPS++SYYFSGSLRLG  GQP+ +R TPLL NPHRPSLYYVN+TG+SVG+  V 
Sbjct  205  GVFSYCLPSYRSYYFSGSLRLGAAGQPRNVRYTPLLTNPHRPSLYYVNVTGLSVGRALVK  264

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFA  353
             P     FDP+TGAGTVIDSGTVI+R+  P Y A+R+EFR+QV  P  ++SLGAFDTCF 
Sbjct  265  APAGSFAFDPSTGAGTVIDSGTVITRWTAPVYAALRDEFRRQVAAPSGYTSLGAFDTCFN  324

Query  352  VTKEFM---APPITFHF-QGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIAN  185
             T E     APP+T H   G+DL LPMENTLIH+S   LACLAMA AP NVNSV+NV+AN
Sbjct  325  -TDEVAAGGAPPVTLHMGGGVDLTLPMENTLIHSSATPLACLAMAEAPQNVNSVVNVVAN  383

Query  184  LQQQNLRVLFDTVNSRLGITHENCN  110
            LQQQN+RV+ D   SR+G   E CN
Sbjct  384  LQQQNVRVVVDVAGSRVGFAREPCN  408



>ref|XP_006291188.1| hypothetical protein CARUB_v10017317mg [Capsella rubella]
 gb|EOA24086.1| hypothetical protein CARUB_v10017317mg [Capsella rubella]
Length=425

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 148/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  230  FSYCLPNSKSGNFSGSLRLGPKFQPIRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDIP  289

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDPATGAGT+ DSGTV +R VEPAY+A+R EFR++V     +SLG FDTC+  T 
Sbjct  290  PSALAFDPATGAGTIFDSGTVYTRLVEPAYLAVRNEFRRRVKNANATSLGGFDTCY--TG  347

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              + P +TF F GM++ LP +N LIH+S GNL+CLAMAAAP NVNSVLNVIA++QQQN R
Sbjct  348  SVVYPSVTFMFAGMNVTLPTDNLLIHSSAGNLSCLAMAAAPANVNSVLNVIASMQQQNHR  407

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  408  VLIDVPNSRLGISRETC  424



>emb|CDY71517.1| BnaCnng73250D, partial [Brassica napus]
Length=277

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSG+LRLGP  QP  I+TTPLLKNP R SLYYVN+ G+ VG   V IP
Sbjct  82   FSYCLPNSKSSSFSGTLRLGPKFQPVRIKTTPLLKNPRRSSLYYVNMVGIRVGNKIVDIP  141

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L F+PATGAGT+ DSGTV +R VEPAYVA+R EFR++V     +SLG FDTC++ + 
Sbjct  142  PSALAFNPATGAGTIFDSGTVYTRLVEPAYVAVRNEFRRRVKNANATSLGGFDTCYSGSV  201

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F  P +TF F GM++ LP +N LIH+S G+ +CLAMAAAPNNVNSVLNVIA++QQQN R
Sbjct  202  VF--PSVTFMFAGMNVTLPPDNLLIHSSSGSTSCLAMAAAPNNVNSVLNVIASMQQQNHR  259

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  260  VLIDLPNSRLGISRETC  276



>ref|XP_007010960.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY19770.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=429

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 151/197 (77%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGPVGQP  I+ TPLLKNP RPSLY+VNL G+ VG+  V IP
Sbjct  234  FSYCLPSFRSLNFSGSLRLGPVGQPLRIKYTPLLKNPRRPSLYFVNLIGIRVGRKIVDIP  293

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
               L F+P TG+GT+IDSGTV +R V  AYVA+R+EFR++V     +SLG FDTC+  T 
Sbjct  294  PSDLAFNPTTGSGTIIDSGTVFTRLVATAYVAVRDEFRRRVRVTNVTSLGGFDTCY--TG  351

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP ITF F GM++ LP +N LIH++ G++ CLAMA+AP N+NSVLNVIAN+QQQN R
Sbjct  352  PIVAPTITFMFAGMNVTLPQDNLLIHSTAGSITCLAMASAPENMNSVLNVIANMQQQNHR  411

Query  163  VLFDTVNSRLGITHENC  113
            VLFD  NSRLG+  E C
Sbjct  412  VLFDVPNSRLGVARELC  428



>ref|XP_004498691.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=429

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  233  FSYCLPSFKSLNFSGSLRLGPVAQPKRIKFTPLLKNPRRSSLYYVNLDAIRVGRRVVDIP  292

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFDTCFAVT  347
               L F+P TGAGT+ DSGTV +R VEPAYVA+R+EFR++V      +SLG FDTC+ V 
Sbjct  293  PAALAFNPTTGAGTIFDSGTVFTRLVEPAYVAVRDEFRRRVGANLTVTSLGGFDTCYNV-  351

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
               + P ITF F GM++ LP +N LIH++ G+  CLAMAAAP NVNSVLNVIAN+QQQN 
Sbjct  352  -PIVVPTITFMFSGMNVTLPQDNILIHSTAGSTTCLAMAAAPTNVNSVLNVIANMQQQNH  410

Query  166  RVLFDTVNSRLGITHENC  113
            R+LFD  NSR+G+  E C
Sbjct  411  RLLFDIPNSRVGVARELC  428



>gb|KHN37680.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=437

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 149/200 (75%), Gaps = 6/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFK+  FSGSLRLGPV QPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  239  FSYCLPSFKTLNFSGSLRLGPVAQPKRIKFTPLLKNPRRSSLYYVNLVAIRVGRRIVDIP  298

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG----PFSSLGAFDTCFA  353
             E L F+P TGAGTV DSGTV +R VEPAY A+R EFR+++        +SLG FDTC+ 
Sbjct  299  PEALAFNPNTGAGTVFDSGTVFTRLVEPAYNAVRNEFRRRIAVHKKLTVTSLGGFDTCYT  358

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
            V    +AP ITF F GM++ LP +N LIH++ G++ CLAMA AP+NVNSVLNVIAN+QQQ
Sbjct  359  V--PIVAPTITFMFSGMNVTLPPDNILIHSTAGSVTCLAMAPAPDNVNSVLNVIANMQQQ  416

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  NSRLG+  E C
Sbjct  417  NHRVLFDVPNSRLGVARELC  436



>ref|XP_011000582.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=425

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 150/198 (76%), Gaps = 3/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF++  FSG+LRLGP GQP  I+TTPLLKNP R SLYYVNL G+ VG+  V IP
Sbjct  230  FSYCLPSFRTLNFSGTLRLGPAGQPLRIKTTPLLKNPRRSSLYYVNLIGIRVGRRIVDIP  289

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
               L F+P TGAGT+ DSGTV +R V PAY A+R+EFRK+V     SSLG FDTC+  T 
Sbjct  290  ASALAFNPTTGAGTIFDSGTVFTRLVAPAYTAVRDEFRKRVGNATVSSLGGFDTCY--TG  347

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP +TF F GM++ LP +N LI ++ G+ +CLAMAAAP+NVNSVLNVIAN+QQQN R
Sbjct  348  PIVAPTMTFMFSGMNVTLPPDNLLIRSTAGSTSCLAMAAAPDNVNSVLNVIANMQQQNHR  407

Query  163  VLFDTVNSRLGITHENCN  110
            +LFD  NSR+G+  E C+
Sbjct  408  ILFDVPNSRIGVAREPCS  425



>ref|XP_002460277.1| hypothetical protein SORBIDRAFT_02g025885 [Sorghum bicolor]
 gb|EER96798.1| hypothetical protein SORBIDRAFT_02g025885 [Sorghum bicolor]
Length=369

 Score =   248 bits (634),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 147/200 (74%), Gaps = 3/200 (2%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGS--LRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIW  533
            G    CLPSFKS  FSGS  LRLG  GQP+ I+TTPLL NPHR SLYYVN+TG+ VG+  
Sbjct  168  GHLLVCLPSFKSLNFSGSGTLRLGRNGQPQRIKTTPLLANPHRSSLYYVNMTGIRVGRKV  227

Query  532  VYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFA  353
            V IP   L FDPATGAGTV+DSGT+ +R V PAYVA+R+E R++V  P SSLG FDTCF 
Sbjct  228  VPIPPPALAFDPATGAGTVLDSGTMFTRLVAPAYVAVRDEVRRRVGAPVSSLGGFDTCFN  287

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
             T     PP+T  F GM + LP EN +IH++YG ++CLAMAAAP+ VN+VLNVIA++QQQ
Sbjct  288  TT-AVAWPPVTLLFDGMQVTLPEENVVIHSTYGTISCLAMAAAPDGVNTVLNVIASMQQQ  346

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  N R+G   E C
Sbjct  347  NHRVLFDVPNGRVGFARERC  366



>ref|XP_006432439.1| hypothetical protein CICLE_v10001212mg [Citrus clementina]
 ref|XP_006465750.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|ESR45679.1| hypothetical protein CICLE_v10001212mg [Citrus clementina]
 gb|KDO58854.1| hypothetical protein CISIN_1g039412mg [Citrus sinensis]
Length=433

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 150/198 (76%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFK+  FSGSLRLGP+GQPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  237  FSYCLPSFKALSFSGSLRLGPIGQPKRIKYTPLLKNPRRSSLYYVNLLAIRVGRRVVDIP  296

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFDTCFAVT  347
               L F+P TGAGT+IDSGTV +R V PAY A+R+ FR++V      +SLG FDTC++V 
Sbjct  297  PGALQFNPTTGAGTIIDSGTVFTRLVAPAYTAVRDVFRRRVGSNLTVTSLGGFDTCYSV-  355

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
               +AP IT  F GM++ LP +N LIH++ G++ CLAMAAAP+NVNSVLNVIAN+QQQN 
Sbjct  356  -PIVAPTITLMFSGMNVTLPQDNLLIHSTAGSITCLAMAAAPDNVNSVLNVIANMQQQNH  414

Query  166  RVLFDTVNSRLGITHENC  113
            R+L+D  NSRLG+  E C
Sbjct  415  RILYDVPNSRLGVARELC  432



>gb|KJB74994.1| hypothetical protein B456_012G018300 [Gossypium raimondii]
Length=429

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 150/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP GQP  I+ T LLKNP RPSLY+VNL G+ VG+  V IP
Sbjct  234  FSYCLPSFRSPNFSGSLRLGPKGQPIRIKYTQLLKNPRRPSLYFVNLIGIRVGRRVVDIP  293

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
             + L F+P+TGAGT+ DSGTV +R VEPAYVA+R  FR++V     +SLG FDTC+ V  
Sbjct  294  PKALAFNPSTGAGTIFDSGTVFTRLVEPAYVAVRNAFRRRVRVANVTSLGGFDTCYTV--  351

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP ITF F GM++ LP EN LIH++ G++ CLAMA+AP+NVNSVLNVIAN+QQ N R
Sbjct  352  PIVAPTITFMFTGMNVTLPQENLLIHSTAGSITCLAMASAPDNVNSVLNVIANMQQLNHR  411

Query  163  VLFDTVNSRLGITHENC  113
            VLFD  NSRLG+  E C
Sbjct  412  VLFDVPNSRLGVARERC  428



>emb|CDP17284.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 148/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QPK I+ T LL+NP R SLYYVNL G+ VG+  V IP
Sbjct  243  FSYCLPSFRSLNFSGSLRLGPNSQPKNIKYTQLLRNPRRSSLYYVNLIGIKVGRRVVGIP  302

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
             E L F+P TGAGTVIDSGTV +R V+PAY+A+R+EFR+++     SSLG FDTC+ V  
Sbjct  303  PEALAFNPTTGAGTVIDSGTVFTRLVQPAYIAVRDEFRRRMGNAVVSSLGGFDTCYTV--  360

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
                P +TF F GM++ LP +N LIH++ G++ CLAMA AP NVNSVLNVIANLQQQN R
Sbjct  361  PVTVPTLTFMFSGMNVTLPQDNFLIHSTAGSITCLAMAEAPTNVNSVLNVIANLQQQNHR  420

Query  163  VLFDTVNSRLGITHENC  113
            +LFD  NSRLG+  E C
Sbjct  421  ILFDVPNSRLGVARETC  437



>ref|XP_010938557.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=447

 Score =   250 bits (639),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSG+LRLGP GQP  I+TTPL  NPHR SLYYV++ G+ VG   V IP
Sbjct  250  FSYCLPSFKSLNFSGTLRLGPAGQPYRIKTTPLHSNPHRSSLYYVDMVGIRVGPKVVDIP  309

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFAVT  347
               LTFD ATG GT+ DSGT+ +R V PAYVA+R+EFR++V   G  +SLG FDTC+   
Sbjct  310  PAALTFDAATGGGTIFDSGTMFTRLVAPAYVAVRDEFRRRVRGAGKVTSLGGFDTCY--N  367

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
              F+AP ITF F GM++ LP +N LIH++ G++ CLAMAAAP+NVNSVLNVIAN+QQ N 
Sbjct  368  GPFVAPGITFMFVGMNVTLPADNYLIHSTAGSITCLAMAAAPDNVNSVLNVIANMQQMNH  427

Query  166  RVLFDTVNSRLGITHENC  113
            RVLFD  N RLG+  E C
Sbjct  428  RVLFDVPNGRLGVARERC  445



>gb|ABK92955.1| unknown [Populus trichocarpa]
Length=425

 Score =   249 bits (637),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 149/198 (75%), Gaps = 3/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF++  FSG+LRLGP GQP  I+TTPLLKNP R SLYYVNL G+ VG+  V IP
Sbjct  230  FSYCLPSFRTLNFSGTLRLGPAGQPLRIKTTPLLKNPRRSSLYYVNLIGIRVGRKIVDIP  289

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF-SSLGAFDTCFAVTK  344
               L F+P TGAGT+ DSGTV +R V P Y A+R+EFRK+V     SSLG FDTC+  T 
Sbjct  290  ASALAFNPTTGAGTIFDSGTVFTRLVAPVYTAVRDEFRKRVGNAIVSSLGGFDTCY--TG  347

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP +TF F GM++ LP +N LI ++ G+ +CLAMAAAP+NVNSVLNVIAN+QQQN R
Sbjct  348  PIVAPTMTFMFSGMNVTLPTDNLLIRSTAGSTSCLAMAAAPDNVNSVLNVIANMQQQNHR  407

Query  163  VLFDTVNSRLGITHENCN  110
            +LFD  NSR+G+  E C+
Sbjct  408  ILFDVPNSRIGVAREPCS  425



>ref|XP_002299201.1| aspartyl protease family protein [Populus trichocarpa]
 gb|ABK93780.1| unknown [Populus trichocarpa]
 gb|EEE84006.1| aspartyl protease family protein [Populus trichocarpa]
Length=425

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 149/198 (75%), Gaps = 3/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF++  FSG+LRLGP GQP  I+TTPLLKNP R SLYYVNL G+ VG+  V IP
Sbjct  230  FSYCLPSFRTLNFSGTLRLGPAGQPLRIKTTPLLKNPRRSSLYYVNLIGIRVGRKIVDIP  289

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF-SSLGAFDTCFAVTK  344
               L F+P TGAGT+ DSGTV +R V P Y A+R+EFRK+V     SSLG FDTC+  T 
Sbjct  290  ASALAFNPTTGAGTIFDSGTVFTRLVAPVYTAVRDEFRKRVGNAIVSSLGGFDTCY--TG  347

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP +TF F GM++ LP +N LI ++ G+ +CLAMAAAP+NVNSVLNVIAN+QQQN R
Sbjct  348  PIVAPTMTFMFSGMNVTLPPDNLLIRSTAGSTSCLAMAAAPDNVNSVLNVIANMQQQNHR  407

Query  163  VLFDTVNSRLGITHENCN  110
            +LFD  NSR+G+  E C+
Sbjct  408  ILFDVPNSRIGVAREPCS  425



>ref|XP_003598487.1| Peptidase A1, putative [Medicago truncatula]
Length=414

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 148/199 (74%), Gaps = 6/199 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  218  FSYCLPSFKSLNFSGSLRLGPVAQPKRIKYTPLLKNPRRSSLYYVNLEAIRVGRKVVDIP  277

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP---FSSLGAFDTCFAV  350
               L F+P TGAGT+ DSGTV +R V P YVA+R+EFR++V GP    +SLG FDTC+ V
Sbjct  278  PAALAFNPTTGAGTIFDSGTVFTRLVAPVYVAVRDEFRRRV-GPKLTVTSLGGFDTCYNV  336

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
                + P ITF F GM++ LP +N LIH++ G+  CLAMA AP+NVNSVLNVIAN+QQQN
Sbjct  337  --PIVVPTITFIFTGMNVTLPQDNILIHSTAGSTTCLAMAGAPDNVNSVLNVIANMQQQN  394

Query  169  LRVLFDTVNSRLGITHENC  113
             RVL+D  NSR+G+  E C
Sbjct  395  HRVLYDVPNSRVGVARELC  413



>gb|AES68738.2| aspartic proteinase nepenthesin-like protein [Medicago truncatula]
Length=417

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 148/199 (74%), Gaps = 6/199 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  221  FSYCLPSFKSLNFSGSLRLGPVAQPKRIKYTPLLKNPRRSSLYYVNLEAIRVGRKVVDIP  280

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP---FSSLGAFDTCFAV  350
               L F+P TGAGT+ DSGTV +R V P YVA+R+EFR++V GP    +SLG FDTC+ V
Sbjct  281  PAALAFNPTTGAGTIFDSGTVFTRLVAPVYVAVRDEFRRRV-GPKLTVTSLGGFDTCYNV  339

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
                + P ITF F GM++ LP +N LIH++ G+  CLAMA AP+NVNSVLNVIAN+QQQN
Sbjct  340  --PIVVPTITFIFTGMNVTLPQDNILIHSTAGSTTCLAMAGAPDNVNSVLNVIANMQQQN  397

Query  169  LRVLFDTVNSRLGITHENC  113
             RVL+D  NSR+G+  E C
Sbjct  398  HRVLYDVPNSRVGVARELC  416



>ref|NP_001241567.1| uncharacterized protein LOC100819698 precursor [Glycine max]
 gb|ACU19388.1| unknown [Glycine max]
Length=437

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 148/200 (74%), Gaps = 6/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFK+  FSGSLRLGPV QPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  239  FSYCLPSFKTLNFSGSLRLGPVAQPKRIKFTPLLKNPRRSSLYYVNLVAIRVGRRIVDIP  298

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG----PFSSLGAFDTCFA  353
             E L F+  TGAGTV DSGTV +R VEPAY A+R EFR+++        +SLG FDTC+ 
Sbjct  299  PEALAFNANTGAGTVFDSGTVFTRLVEPAYNAVRNEFRRRIAVHKKLTVTSLGGFDTCY-  357

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
             T   +AP ITF F GM++ LP +N LIH++ G++ CLAMA AP+NVNSVLNVIAN+QQQ
Sbjct  358  -TAPIVAPTITFMFSGMNVTLPPDNILIHSTAGSVTCLAMAPAPDNVNSVLNVIANMQQQ  416

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  NSRLG+  E C
Sbjct  417  NHRVLFDVPNSRLGVARELC  436



>gb|KEH40928.1| aspartic proteinase nepenthesin-like protein [Medicago truncatula]
Length=429

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 148/199 (74%), Gaps = 6/199 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QPK I+ TPLL NP R SLYYVNL  +SVG+  V IP
Sbjct  233  FSYCLPSFKSLNFSGSLRLGPVAQPKRIKYTPLLNNPRRSSLYYVNLEAISVGRKVVDIP  292

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP---FSSLGAFDTCFAV  350
               L F+P TGAGT+ DSGTV +R V P YVA+R+EFR++V GP    +SLG FDTC+ V
Sbjct  293  PAALAFNPTTGAGTIFDSGTVFTRLVAPVYVAVRDEFRRRV-GPKLTVTSLGGFDTCYNV  351

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
                + P ITF F GM++ LP +N LIH++ G+  CLAMA AP+NVNSVLNVIAN+QQQN
Sbjct  352  --PIVVPTITFIFTGMNVTLPQDNILIHSTAGSTTCLAMAGAPDNVNSVLNVIANMQQQN  409

Query  169  LRVLFDTVNSRLGITHENC  113
             RVL+D  NSR+G+  E C
Sbjct  410  HRVLYDVPNSRVGVARELC  428



>ref|XP_004170756.1| PREDICTED: aspartic proteinase nepenthesin-1-like, partial [Cucumis 
sativus]
Length=364

 Score =   245 bits (626),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QP  I+ TPLL+NP R SLYYVNL  + VG+  V IP
Sbjct  167  FSYCLPSFKSVNFSGSLRLGPVAQPIRIKYTPLLRNPRRSSLYYVNLISIRVGRKIVDIP  226

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFAVT  347
               L F+ ATGAGTVIDSGT  +R V PAY A+R+EFR++V      SSLG FDTC+ V 
Sbjct  227  PSALAFNSATGAGTVIDSGTTFTRLVAPAYTAVRDEFRRRVGRNVTVSSLGGFDTCYTV-  285

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
               ++P ITF F GM++ LP +N LIH++ G+  CLAMAAAP+NVNSVLNVIA++QQQN 
Sbjct  286  -PIISPTITFMFAGMNVTLPPDNFLIHSTSGSTTCLAMAAAPDNVNSVLNVIASMQQQNH  344

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSR+G+  E+C+
Sbjct  345  RILFDIPNSRVGVARESCS  363



>ref|XP_009411751.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Musa 
acuminata subsp. malaccensis]
Length=447

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 151/200 (76%), Gaps = 8/200 (4%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSG+LRLGPVGQPK ++TTPLL +P R SLYYVN+ G+ VG+  + IP
Sbjct  249  FSYCLPSFKSLNFSGTLRLGPVGQPKNMKTTPLLSSPRRSSLYYVNMIGIRVGRRVLDIP  308

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCF--A  353
                TFD ATGAGT++DSGT+ +R V PAY A+R+EFR++V   GP +SLG FDTC+  A
Sbjct  309  PSAFTFDAATGAGTILDSGTMFTRLVAPAYAALRDEFRRRVKAAGPVTSLGGFDTCYNGA  368

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
            VT     P IT  F GM++ LP +N LIH++ G++ CLAMA AP+NVNSVLNV+AN+QQQ
Sbjct  369  VTP----PGITLMFTGMNVTLPPDNILIHSTAGSITCLAMAGAPDNVNSVLNVVANMQQQ  424

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  N+R+G   E C
Sbjct  425  NHRVLFDVPNARIGFAREAC  444



>ref|XP_009372766.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Pyrus x 
bretschneideri]
Length=436

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGP  QPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  240  FSYCLPSFKSPNFSGSLRLGPAVQPKRIKYTPLLKNPRRSSLYYVNLNAIRVGRRIVDIP  299

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG--PFSSLGAFDTCFAVT  347
               L F+P TG+GT+ DSGTV +R V+P Y+A+R EFR++V    P ++LG FDTC++V 
Sbjct  300  PAALAFNPITGSGTIFDSGTVFTRLVQPVYLAVRNEFRRRVGPKIPVTTLGGFDTCYSV-  358

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
              F+ P ITF F G+++ LP +N +IH++ G++ CLAMAAAP+NVNSVLNVIAN+QQQN 
Sbjct  359  -PFVVPTITFMFSGLNMTLPEDNIVIHSTAGSITCLAMAAAPDNVNSVLNVIANMQQQNH  417

Query  166  RVLFDTVNSRLGITHENC  113
            RVL D  NSRLG+  E C
Sbjct  418  RVLIDVPNSRLGVAREAC  435



>gb|KFK34672.1| hypothetical protein AALP_AA5G176500 [Arabis alpina]
Length=430

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 148/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V IP
Sbjct  235  FSYCLPNSKSNNFSGSLRLGPKFQPIRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDIP  294

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L FDPATGAGT+ DSGTV +R VEPAYVA+R EFR+++     +SLG FDTC++ + 
Sbjct  295  TSALAFDPATGAGTIFDSGTVFTRLVEPAYVAVRNEFRRRIKNANATSLGGFDTCYSGSV  354

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F  P +TF F GM++ LP +N LIH+S G+ +CLAMAAAP NVNSVLNVIA++QQQN R
Sbjct  355  VF--PSVTFMFAGMNVTLPPDNLLIHSSSGSTSCLAMAAAPINVNSVLNVIASMQQQNHR  412

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  413  VLIDLPNSRLGISRETC  429



>emb|CDX78233.1| BnaA09g34280D [Brassica napus]
Length=430

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSG+LRLGP  QP  I+TTPLLKNP R SLYYVN+ G+ VG   V IP
Sbjct  235  FSYCLPNSKSSSFSGTLRLGPKFQPVRIKTTPLLKNPRRSSLYYVNMVGIRVGNKIVDIP  294

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L F+PATGAGT+ DSGTV +R VEPAYVA+R EFR++V     +SLG FDTC++ + 
Sbjct  295  PSALAFNPATGAGTIFDSGTVYTRLVEPAYVAVRNEFRRRVKNANATSLGGFDTCYSGSV  354

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F  P +TF F GM++ LP +N LIH+S G+ +CLAMAAAPNNVNSVLNVIA++QQQN R
Sbjct  355  VF--PSVTFMFAGMNVTLPPDNLLIHSSSGSTSCLAMAAAPNNVNSVLNVIASMQQQNHR  412

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  413  VLIDLPNSRLGISRETC  429



>ref|XP_008348078.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=436

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGP  QPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  240  FSYCLPSFKSPNFSGSLRLGPAVQPKRIKYTPLLKNPRRSSLYYVNLNAIRVGRRTVDIP  299

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG--PFSSLGAFDTCFAVT  347
               L F+P TG+GT+ DSGTV +R V+P Y+A+R EFR++V    P ++LG FDTC++V 
Sbjct  300  PAALAFNPITGSGTIFDSGTVFTRLVQPVYLAVRNEFRRRVGPKIPVTTLGGFDTCYSV-  358

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
              F+ P ITF F G+++ LP +N +IH++ G++ CLAMAAAP+NVNSVLNVIAN+QQQN 
Sbjct  359  -PFVVPRITFMFSGLNMTLPEDNIVIHSTAGSITCLAMAAAPDNVNSVLNVIANMQQQNH  417

Query  166  RVLFDTVNSRLGITHENC  113
            RVL D  NSRLG+  E C
Sbjct  418  RVLIDVPNSRLGVAREAC  435



>ref|XP_009116125.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=430

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 149/197 (76%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  FSG+LRLGP  QP  I+TTPLLKNP R SLYYVN+ G+ VG   V IP
Sbjct  235  FSYCLPNSKSSSFSGTLRLGPKFQPVRIKTTPLLKNPRRSSLYYVNMVGIRVGNKIVDIP  294

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVTK  344
               L F+PATGAGT+ DSGTV +R VEPAYVA+R EFR++V     +SLG FDTC++ + 
Sbjct  295  PNALAFNPATGAGTIFDSGTVYTRLVEPAYVAVRNEFRRRVKNANATSLGGFDTCYSGSV  354

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
             F  P +TF F GM++ LP +N LIH+S G+ +CLAMAAAPNNVNSVLNVIA++QQQN R
Sbjct  355  VF--PSVTFMFAGMNVTLPPDNLLIHSSSGSTSCLAMAAAPNNVNSVLNVIASMQQQNHR  412

Query  163  VLFDTVNSRLGITHENC  113
            VL D  NSRLGI+ E C
Sbjct  413  VLIDLPNSRLGISRETC  429



>ref|XP_006403580.1| hypothetical protein EUTSA_v10010398mg [Eutrema salsugineum]
 dbj|BAJ34532.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45033.1| hypothetical protein EUTSA_v10010398mg [Eutrema salsugineum]
Length=428

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 147/198 (74%), Gaps = 3/198 (2%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
             FSYCLP+ KS  FSGSLRLGP  QP  I+TTPLLKNP R SLYYVNL G+ VG   V I
Sbjct  232  TFSYCLPNSKSSNFSGSLRLGPKYQPVRIKTTPLLKNPRRSSLYYVNLVGIRVGNKIVDI  291

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP-FSSLGAFDTCFAVT  347
            P   L FD +TGAGT+ DSGTV +R VEPAYVA+R EFR+++     +SLG FDTC+  +
Sbjct  292  PTSALAFDASTGAGTIFDSGTVFTRLVEPAYVAVRNEFRRRIKNANATSLGGFDTCY--S  349

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
               + P +TF F GM++ LP +N LIH+S G+ +CLAMAAAPNNVNSVLNVIA++QQQN 
Sbjct  350  GSVVYPSVTFMFAGMNVTLPPDNLLIHSSSGSTSCLAMAAAPNNVNSVLNVIASMQQQNH  409

Query  166  RVLFDTVNSRLGITHENC  113
            RVL D  NSRLGI+ E C
Sbjct  410  RVLIDLPNSRLGISRETC  427



>ref|XP_003522900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
 gb|KHN06647.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=439

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 148/202 (73%), Gaps = 8/202 (4%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QP  I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  238  FSYCLPSFKSLNFSGSLRLGPVAQPIRIKYTPLLKNPRRSSLYYVNLVAIRVGRKVVDIP  297

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP------FSSLGAFDTC  359
             E L F+ ATGAGTV DSGTV +R V PAY A+R+EF+++V          +SLG FDTC
Sbjct  298  PEALAFNAATGAGTVFDSGTVFTRLVAPAYTAVRDEFQRRVAIAAKANLTVTSLGGFDTC  357

Query  358  FAVTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQ  179
            + V    +AP ITF F GM++ LP +N LIH++ G+  CLAMA+AP+NVNSVLNVIAN+Q
Sbjct  358  YTV--PIVAPTITFMFSGMNVTLPEDNILIHSTAGSTTCLAMASAPDNVNSVLNVIANMQ  415

Query  178  QQNLRVLFDTVNSRLGITHENC  113
            QQN RVL+D  NSRLG+  E C
Sbjct  416  QQNHRVLYDVPNSRLGVARELC  437



>gb|KJB58890.1| hypothetical protein B456_009G230400 [Gossypium raimondii]
Length=408

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = -3

Query  619  IRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIPQEHLTFDPATGAGTVIDSGTVISRFVE  440
            IRTTPLLK+PHRPSLYYVNLTGVSVG++ V IP E L F+P TGAGT+IDSGTV++RFV 
Sbjct  239  IRTTPLLKSPHRPSLYYVNLTGVSVGRVRVPIPPECLAFNPNTGAGTIIDSGTVVTRFVR  298

Query  439  PAYVAIREEFRKQVTGPFSSLGAFDTCFAVTKEFMAPPITFHFQGMDLVLPMENTLIHTS  260
            P Y AIR EF K V GPFS++G FDTCF    E   P +T HF+G+ + LPMENT +HTS
Sbjct  299  PLYEAIRNEFVKHVKGPFSTIGLFDTCFEAKAEVELPSLTLHFEGLSMKLPMENTFLHTS  358

Query  259  YGNLACLAMAAAPNNVNSVLNVIANLQQQNLRVLFDTVNSRLGITHENCN  110
             G+ ACLA+A APNNVN+ +NVIANLQQQN R+LFD  NSRLGI  E CN
Sbjct  359  AGSHACLAIAPAPNNVNAAMNVIANLQQQNHRILFDVANSRLGIAREACN  408



>ref|XP_004142420.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Cucumis sativus]
 gb|KGN52324.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=441

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 149/201 (74%), Gaps = 4/201 (2%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
              FSYCLPSFKS  FSGSLRLGPV QP  I+ TPLL+NP R SLYYVNL  + VG+  V 
Sbjct  242  STFSYCLPSFKSVNFSGSLRLGPVAQPIRIKYTPLLRNPRRSSLYYVNLISIRVGRKIVD  301

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFA  353
            IP   L F+ ATGAGTVIDSGT  +R V PAY A+R+EFR++V      SSLG FDTC+ 
Sbjct  302  IPPSALAFNSATGAGTVIDSGTTFTRLVAPAYTAVRDEFRRRVGRNVTVSSLGGFDTCYT  361

Query  352  VTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQ  173
            V    ++P ITF F GM++ LP +N LIH++ G+  CLAMAAAP+NVNSVLNVIA++QQQ
Sbjct  362  V--PIISPTITFMFAGMNVTLPPDNFLIHSTAGSTTCLAMAAAPDNVNSVLNVIASMQQQ  419

Query  172  NLRVLFDTVNSRLGITHENCN  110
            N R+LFD  NSR+G+  E+C+
Sbjct  420  NHRILFDIPNSRVGVARESCS  440



>ref|XP_010523939.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=441

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 146/199 (73%), Gaps = 3/199 (2%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
              FSYCLP+F+S  FSGSLRLGPVGQP  I+TTPLLKNP R SLYYVNL G+ VG   + 
Sbjct  244  ATFSYCLPNFRSENFSGSLRLGPVGQPVRIKTTPLLKNPKRSSLYYVNLVGIRVGSKVLD  303

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQ-VTGPFSSLGAFDTCFAV  350
            IP     FDP TGAGTV DSGTV +R VEPAYVA+R EFR++      +SLG FDTC+  
Sbjct  304  IPASAFAFDPVTGAGTVFDSGTVFTRLVEPAYVAVRNEFRRRNKNSNVTSLGGFDTCY--  361

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            +   +AP ITF F GM++ LP +N LI ++ G+  CLAMAAAPNNVNSVLNVIA++QQQN
Sbjct  362  SGPIVAPTITFMFAGMNVTLPQDNFLIRSTAGSTTCLAMAAAPNNVNSVLNVIASMQQQN  421

Query  169  LRVLFDTVNSRLGITHENC  113
             RVL D  N+RLG+  E C
Sbjct  422  HRVLVDGSNNRLGVARELC  440



>ref|XP_008803347.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=445

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 146/200 (73%), Gaps = 4/200 (2%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
             FSYCLPSFKS  FSG+LRLGP GQPKTI+TT L  +P R SLY+V+L G+ VG+  V I
Sbjct  247  TFSYCLPSFKSLNFSGTLRLGPAGQPKTIKTTQLRSSPRRSSLYFVDLVGIRVGRKVVDI  306

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFAV  350
            P   + FD ATGAGT+ DSGT+ +R V PAY A+R+EFR+QV G    +SLG FDTC+  
Sbjct  307  PPAAIAFDAATGAGTIFDSGTMFTRLVAPAYAALRDEFRRQVRGAGNATSLGGFDTCY--  364

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
                 AP ITF F GM++ LP +N LIH++ G+L CLAMAAAP+NVNSVLNVIA++QQ N
Sbjct  365  QGSIAAPAITFMFAGMNMTLPADNYLIHSTAGSLTCLAMAAAPDNVNSVLNVIASMQQMN  424

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVLFD  + RLG+  E C 
Sbjct  425  HRVLFDAASGRLGVARELCT  444



>ref|XP_003538263.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=438

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 147/202 (73%), Gaps = 8/202 (4%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QP  I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  237  FSYCLPSFKSLNFSGSLRLGPVAQPIRIKYTPLLKNPRRSSLYYVNLFAIRVGRKIVDIP  296

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP------FSSLGAFDTC  359
               L F+ ATGAGTV DSGTV +R V P Y A+R+EFR++V          +SLG FDTC
Sbjct  297  PAALAFNAATGAGTVFDSGTVFTRLVAPVYTAVRDEFRRRVAMAAKANLTVTSLGGFDTC  356

Query  358  FAVTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQ  179
            + V    +AP ITF F GM++ LP +N LIH++ G+ +CLAMA+AP+NVNSVLNVIAN+Q
Sbjct  357  YTV--PIVAPTITFMFSGMNVTLPQDNILIHSTAGSTSCLAMASAPDNVNSVLNVIANMQ  414

Query  178  QQNLRVLFDTVNSRLGITHENC  113
            QQN RVL+D  NSRLG+  E C
Sbjct  415  QQNHRVLYDVPNSRLGVARELC  436



>emb|CBI35120.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
             FSYCLPSFKS  FSGSLRLGPVGQPK I+ TPLLKNP RPSLY+VNL  V VG+  V +
Sbjct  123  TFSYCLPSFKSLNFSGSLRLGPVGQPKRIKYTPLLKNPRRPSLYFVNLMAVRVGRRVVDV  182

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFDTCFAV  350
            P    TF+P+TGAGT+ DSGTV +R V PAY+A+R+ FR +V      +SLG FDTC+ V
Sbjct  183  PPGSFTFNPSTGAGTIFDSGTVFTRLVTPAYIAVRDAFRNRVGRNLTVTSLGGFDTCYTV  242

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
                 AP ITF F GM++ LP +N LIH++ G+  CLAMAAAP+NVNSVLNVIANLQQQN
Sbjct  243  --PIAAPTITFMFTGMNVTLPPDNLLIHSTAGSTTCLAMAAAPDNVNSVLNVIANLQQQN  300

Query  169  LRVLFDTVNSRLGITHENC  113
             R+L+D  NSRLG+  E C
Sbjct  301  HRLLYDVPNSRLGVARELC  319



>ref|XP_003627883.1| Aspartic proteinase nepenthesin-1 [Medicago truncatula]
 gb|AET02359.1| aspartic proteinase nepenthesin-like protein [Medicago truncatula]
Length=434

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QPK I+ TPLL+NP R SLYYVNL  + VG+  V IP
Sbjct  238  FSYCLPSFKSINFSGSLRLGPVYQPKRIKYTPLLRNPRRSSLYYVNLVAIKVGRKIVDIP  297

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG--PFSSLGAFDTCFAVT  347
               L F+P TGAGT+ DSGTV +R  EP Y A+R EFR++V    P ++LG FDTC+ V 
Sbjct  298  PAALAFNPTTGAGTIFDSGTVFTRLAEPVYTAVRNEFRRRVGPKLPVTTLGGFDTCYNV-  356

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
               + P ITF F GM++ LP +N +IH++ G+  CLAMA AP+NVNSVLNVIAN+QQQN 
Sbjct  357  -PIVVPTITFLFSGMNVTLPPDNIVIHSTAGSTTCLAMAGAPDNVNSVLNVIANMQQQNH  415

Query  166  RVLFDTVNSRLGITHENC  113
            RVLFD  NSR+GI  E C
Sbjct  416  RVLFDVPNSRIGIARELC  433



>gb|AFK35790.1| unknown [Medicago truncatula]
Length=434

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QPK I+ TPLL+NP R SLYYVNL  + VG+  V IP
Sbjct  238  FSYCLPSFKSINFSGSLRLGPVYQPKRIKYTPLLRNPRRSSLYYVNLVAIKVGRKIVDIP  297

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG--PFSSLGAFDTCFAVT  347
               L F+P TGAGT+ DSGTV +R  EP Y A+R EFR++V    P ++LG FDTC+ V 
Sbjct  298  PAALAFNPTTGAGTIFDSGTVFTRLAEPVYTAVRNEFRRRVGPKLPVTTLGGFDTCYNV-  356

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
               + P ITF F GM++ LP +N +IH++ G+  CLAMA AP+NVNSVLNVIAN+QQQN 
Sbjct  357  -PIVVPTITFLFSGMNVALPPDNIVIHSTAGSTTCLAMAGAPDNVNSVLNVIANMQQQNH  415

Query  166  RVLFDTVNSRLGITHENC  113
            RVLFD  NSR+GI  E C
Sbjct  416  RVLFDVPNSRIGIARELC  433



>emb|CAN69536.1| hypothetical protein VITISV_043237 [Vitis vinifera]
Length=372

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPVGQPK I+ TPLLKNP RPSLY+VNL  V VG+  V +P
Sbjct  176  FSYCLPSFKSLNFSGSLRLGPVGQPKRIKYTPLLKNPRRPSLYFVNLMAVRVGRRVVDVP  235

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFDTCFAVT  347
                TF+P+TGAGT+ DSGTV +R V PAY+A+R+ FR +V      +SLG FDTC+ V 
Sbjct  236  PGSFTFNPSTGAGTIFDSGTVFTRLVTPAYIAVRDAFRNRVGRNLTVTSLGGFDTCYTV-  294

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
                AP ITF F GM++ LP +N LIH++ G+  CLAMAAAP+NVNSVLNVIANLQQQN 
Sbjct  295  -PIAAPTITFMFTGMNVTLPPDNLLIHSTAGSTTCLAMAAAPDNVNSVLNVIANLQQQNH  353

Query  166  RVLFDTVNSRLGITHENC  113
            R+L+D  NSRLG+  E C
Sbjct  354  RLLYDVPNSRLGVARELC  371



>ref|XP_010067725.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Eucalyptus 
grandis]
 gb|KCW65904.1| hypothetical protein EUGRSUZ_G03227 [Eucalyptus grandis]
Length=439

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 149/199 (75%), Gaps = 6/199 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPVGQP+ I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  243  FSYCLPSFKSLNFSGSLRLGPVGQPQRIKFTPLLKNPRRSSLYYVNLIAIRVGRRTVDIP  302

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP---FSSLGAFDTCFAV  350
                 F+P TG+GT+ DSGTV +R V+PAY+A+R EFR++V GP    +SLG FDTC++ 
Sbjct  303  PSAFAFNPTTGSGTIFDSGTVFTRLVQPAYIAVRNEFRRRV-GPKLTVTSLGGFDTCYSA  361

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
                +AP +TF F GM++  P EN LIH++  ++ CLAMAA+P ++NSVLNVIAN+QQQN
Sbjct  362  --PIVAPAMTFMFSGMNVTFPPENLLIHSTASSITCLAMAASPGDLNSVLNVIANMQQQN  419

Query  169  LRVLFDTVNSRLGITHENC  113
             RVL+D  NSRLG+  E C
Sbjct  420  HRVLYDVPNSRLGVARELC  438



>ref|XP_008446966.1| PREDICTED: aspartic proteinase nepenthesin-1 [Cucumis melo]
Length=444

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 148/199 (74%), Gaps = 4/199 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QP  I+ TPLL+NP R SLYYVNL  + VG+  V IP
Sbjct  247  FSYCLPSFKSVNFSGSLRLGPVAQPIRIKYTPLLRNPRRSSLYYVNLIAIRVGRRIVDIP  306

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFAVT  347
               L F+ ATGAGT+IDSGT  +R V PAY A+R+EFR++V      SSLG FDTC+ V 
Sbjct  307  PSALAFNSATGAGTIIDSGTTFTRLVAPAYTAVRDEFRRRVGRNVTVSSLGGFDTCYTV-  365

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
               ++P ITF F GM++ LP +N LIH++ G+  CLAMAAAP+NVNSVLNVIA++QQQN 
Sbjct  366  -PIISPTITFMFAGMNVTLPPDNFLIHSTAGSTTCLAMAAAPDNVNSVLNVIASMQQQNH  424

Query  166  RVLFDTVNSRLGITHENCN  110
            R+LFD  NSR+G+  E C+
Sbjct  425  RILFDIPNSRVGVAREPCS  443



>emb|CBI19249.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   234 bits (598),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = -3

Query  619  IRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIPQEHLTFDPATGAGTVIDSGTVISRFVE  440
            +R TP+L  P  P  + + +    VG++ V +  E L FDP TGAGT+IDSGTVI+RFVE
Sbjct  23   LRFTPMLCAPVHPGPWPL-VPHHGVGRVLVPVAPELLAFDPNTGAGTIIDSGTVITRFVE  81

Query  439  PAYVAIREEFRKQVTGPFSSLGAFDTCFAVTKEFMAPPITFHFQGMDLVLPMENTLIHTS  260
            P Y AIR+EFRKQV GPF+++GAFDTCFA T E +APP+TFHF GMDL LP+ENTLIH+S
Sbjct  82   PVYAAIRDEFRKQVKGPFATIGAFDTCFAATNEDIAPPVTFHFTGMDLKLPLENTLIHSS  141

Query  259  YGNLACLAMAAAPNNVNSVLNVIANLQQQNLRVLFDTVNSRLGITHENCN  110
             G+LACLAMAAAPNNVNSVLNVIANLQQQNLR++FD  NSRLGI  E CN
Sbjct  142  AGSLACLAMAAAPNNVNSVLNVIANLQQQNLRIMFDVTNSRLGIARELCN  191



>ref|XP_009380234.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 145/199 (73%), Gaps = 4/199 (2%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
             FSYCLPSFKS  FSG+LRLGP+GQP  I+TT LL N  R SLYYV++ G+ VG+  + I
Sbjct  252  TFSYCLPSFKSLNFSGTLRLGPIGQPTKIKTTTLLSNARRSSLYYVSMIGIRVGRRVLDI  311

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFAV  350
            P     FDPATGAGT+IDSGT+ +R V PAY A+R+EFR++V   GP +SLG FDTC+  
Sbjct  312  PPSAFAFDPATGAGTIIDSGTMFTRLVAPAYAALRDEFRRRVKAAGPVTSLGGFDTCY--  369

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
                  P IT  F GM++ LP +N LIH++ G++ CLAMAAAP+NVNSVLNVIAN+QQQN
Sbjct  370  NGAIKPPAITLMFMGMNVTLPPDNALIHSTAGSITCLAMAAAPDNVNSVLNVIANVQQQN  429

Query  169  LRVLFDTVNSRLGITHENC  113
             RV FD  N+R+G   E C
Sbjct  430  HRVFFDVPNARVGFAREFC  448



>gb|KJB73115.1| hypothetical protein B456_011G215800 [Gossypium raimondii]
Length=308

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 147/198 (74%), Gaps = 8/198 (4%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPS +S  FSGSLRLGP GQP  I+ TPLLKNP RPSLYYVNL G+ VG+  V IP
Sbjct  118  FSYCLPSIRSPNFSGSLRLGPSGQPVRIKYTPLLKNPRRPSLYYVNLIGIRVGRRIVDIP  177

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
               + F+P+TGAGT+IDSGTV +R VEPAYVA+R+ FR++V     +SLG FDTC++V  
Sbjct  178  PSAIAFNPSTGAGTIIDSGTVFTRLVEPAYVAVRDAFRRRVRVANVTSLGGFDTCYSV--  235

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
               AP ITF F GM++ LP EN L+H++ G++ CLAMA+AP      LNVIAN+QQQN R
Sbjct  236  PINAPTITFMFSGMNVTLPQENLLLHSTAGSITCLAMASAP-----ALNVIANMQQQNHR  290

Query  163  VLFDTVNSRLGITHENCN  110
            V+FD  NSR+G+  E C+
Sbjct  291  VVFDVPNSRMGVARERCS  308



>ref|XP_002264626.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
Length=437

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPVGQPK I+ TPLLKNP RPSLY+VNL  V VG+  V +P
Sbjct  241  FSYCLPSFKSLNFSGSLRLGPVGQPKRIKYTPLLKNPRRPSLYFVNLMAVRVGRRVVDVP  300

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFDTCFAVT  347
                TF+P+TGAGT+ DSGTV +R V PAY+A+R+ FR +V      +SLG FDTC+ V 
Sbjct  301  PGSFTFNPSTGAGTIFDSGTVFTRLVTPAYIAVRDAFRNRVGRNLTVTSLGGFDTCYTV-  359

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
                AP ITF F GM++ LP +N LIH++ G+  CLAMAAAP+NVNSVLNVIANLQQQN 
Sbjct  360  -PIAAPTITFMFTGMNVTLPPDNLLIHSTAGSTTCLAMAAAPDNVNSVLNVIANLQQQNH  418

Query  166  RVLFDTVNSRLGITHENC  113
            R+L+D  NSRLG+  E C
Sbjct  419  RLLYDVPNSRLGVARELC  436



>ref|XP_010926983.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=445

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 146/198 (74%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSG+LRLGP GQPK+I+TTPL  +P R SLY+V+L G+ VG+  V IP
Sbjct  248  FSYCLPSFKSLNFSGTLRLGPAGQPKSIKTTPLRSSPRRSSLYFVDLVGIRVGRKVVDIP  307

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFAVT  347
               + FD +TGAGT+ DSGT+ +R V PAY A+R+EFR++V   G  +SLG FDTC+A  
Sbjct  308  PAAIAFDASTGAGTIFDSGTMFTRLVAPAYAAVRDEFRRRVRGAGDVTSLGGFDTCYA--  365

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
                 P ITF F GM++ LP +N LIH++ G+L CLAMAAAP+NVNSVLNVIA++QQ N 
Sbjct  366  GPINPPAITFLFAGMNVTLPADNYLIHSTAGSLTCLAMAAAPDNVNSVLNVIASMQQMNH  425

Query  166  RVLFDTVNSRLGITHENC  113
            RV FD  N RLG+  E C
Sbjct  426  RVYFDVANGRLGVARELC  443



>ref|XP_004307094.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Fragaria 
vesca subsp. vesca]
Length=440

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP +KS  FSGSLRLG VGQP  I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  244  FSYCLPGYKSLNFSGSLRLGTVGQPIKIKYTPLLKNPRRASLYYVNLNAIRVGRRIVDIP  303

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFDTCFAVT  347
               L F+P TGAGTVIDSGTV +R V PAY A+R EFR++V      ++LG FDTC+  T
Sbjct  304  PSALAFNPTTGAGTVIDSGTVFTRLVTPAYEAVRNEFRRRVGRKLLVTTLGGFDTCY--T  361

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
               + P ITF F GM++ LP +N +I ++ G+  CLAMAAAP+NVNSVLNVIAN+QQQN 
Sbjct  362  APIVVPTITFMFTGMNVTLPADNVVIRSTAGSTTCLAMAAAPDNVNSVLNVIANMQQQNH  421

Query  166  RVLFDTVNSRLGITHENC  113
            RVL D  NSRLG+  E C
Sbjct  422  RVLIDVPNSRLGVAREQC  439



>gb|AFK39308.1| unknown [Medicago truncatula]
Length=425

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 143/191 (75%), Gaps = 6/191 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGPV QPK I+ TPLLKNP R SLYYVNL  + VG+  V IP
Sbjct  233  FSYCLPSFKSLNFSGSLRLGPVAQPKRIKYTPLLKNPRRSSLYYVNLEAIRVGRKVVDIP  292

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP---FSSLGAFDTCFAV  350
               L F+P TGAGT+ DSGTV +R V P YVA+R+EFR++V GP    +SLG FDTC+ V
Sbjct  293  PAALAFNPTTGAGTIFDSGTVFTRLVAPVYVAVRDEFRRRV-GPKLTVTSLGGFDTCYNV  351

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
                + P ITF F GM++ LP +N LIH++ G+  CLAMA AP+NVNSVLNVIAN+QQQN
Sbjct  352  --PIVVPTITFIFTGMNVTLPQDNILIHSTAGSTTCLAMAGAPDNVNSVLNVIANMQQQN  409

Query  169  LRVLFDTVNSR  137
             RVL+D  NSR
Sbjct  410  HRVLYDVPNSR  420



>gb|KJB73114.1| hypothetical protein B456_011G215800 [Gossypium raimondii]
Length=425

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 147/198 (74%), Gaps = 8/198 (4%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPS +S  FSGSLRLGP GQP  I+ TPLLKNP RPSLYYVNL G+ VG+  V IP
Sbjct  235  FSYCLPSIRSPNFSGSLRLGPSGQPVRIKYTPLLKNPRRPSLYYVNLIGIRVGRRIVDIP  294

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
               + F+P+TGAGT+IDSGTV +R VEPAYVA+R+ FR++V     +SLG FDTC++V  
Sbjct  295  PSAIAFNPSTGAGTIIDSGTVFTRLVEPAYVAVRDAFRRRVRVANVTSLGGFDTCYSV--  352

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
               AP ITF F GM++ LP EN L+H++ G++ CLAMA+AP      LNVIAN+QQQN R
Sbjct  353  PINAPTITFMFSGMNVTLPQENLLLHSTAGSITCLAMASAP-----ALNVIANMQQQNHR  407

Query  163  VLFDTVNSRLGITHENCN  110
            V+FD  NSR+G+  E C+
Sbjct  408  VVFDVPNSRMGVARERCS  425



>gb|KHG22262.1| Asparticase nepenthesin-1 [Gossypium arboreum]
Length=425

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 147/198 (74%), Gaps = 8/198 (4%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPS +S  FSGSLRLGP GQP  I+ TPLLKNP RPSLYYVNL G+ VG+  V IP
Sbjct  235  FSYCLPSIRSPNFSGSLRLGPSGQPVRIKYTPLLKNPRRPSLYYVNLIGIRVGRRIVDIP  294

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
               + F+P+TGAGT+IDSGTV +R VEPAYVA+R+ FR++V     +SLG FDTC++V  
Sbjct  295  PSAIAFNPSTGAGTIIDSGTVFTRLVEPAYVAVRDAFRRRVRVANVTSLGGFDTCYSV--  352

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
               AP ITF F GM++ LP EN L+H++ G++ CLAMA+AP      LNVIAN+QQQN R
Sbjct  353  PINAPTITFMFSGMNVTLPQENLLLHSTAGSITCLAMASAP-----ALNVIANMQQQNHR  407

Query  163  VLFDTVNSRLGITHENCN  110
            V+FD  NSR+G+  E C+
Sbjct  408  VVFDVPNSRVGVARERCS  425



>ref|XP_011091849.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=432

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPS++S  FSGSLRLGP  QPK IRTTPLLKNP R S YYVNL G+ VG+  V IP
Sbjct  236  FSYCLPSYRSANFSGSLRLGPNSQPKRIRTTPLLKNPRRSSFYYVNLVGIKVGRRGVNIP  295

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
                 FDP TGAGTV DSGTV +  V+PAY A+R+EFR+Q+     SSLG FDTC+ V  
Sbjct  296  PSAFAFDPNTGAGTVFDSGTVFTMLVKPAYTAVRDEFRRQMGNATVSSLGGFDTCYTV--  353

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPN-NVNSVLNVIANLQQQNL  167
                P ITF F G+++ LP +N LI +S G+ +CLAMAAAP+ +VNSVLNVIA  QQQN 
Sbjct  354  PVTVPTITFMFPGLNMSLPQDNFLIRSSAGSTSCLAMAAAPDSSVNSVLNVIATFQQQNH  413

Query  166  RVLFDTVNSRLGITHENCN  110
            RVL D  NSRLG+  E C+
Sbjct  414  RVLIDVPNSRLGVAREPCS  432



>ref|XP_010922206.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=459

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 139/198 (70%), Gaps = 3/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPS +S  FSGSLRLGP  QP+ I +TPLL NP RPSLYYVN+ G+ VG   V IP
Sbjct  262  FSYCLPSVRSQNFSGSLRLGPAAQPRRIHSTPLLANPRRPSLYYVNMIGIRVGGRSVRIP  321

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT--GPFSSLGAFDTCFAVT  347
             E   FDP TG GT+IDSGT+ +R V PAY A+R+EFR++V   GP +SLG FDTC++  
Sbjct  322  PEAFAFDPETGGGTIIDSGTLFTRLVAPAYEAVRDEFRRRVMGGGPVTSLGGFDTCYS-G  380

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
                 P +   F+GM + LP +N +I +SYGN  CLAMAA+P N+NSVLNV+A++ QQN 
Sbjct  381  AAVKVPAVELEFEGMRVPLPEDNVVIRSSYGNTVCLAMAASPGNMNSVLNVVASMAQQNH  440

Query  166  RVLFDTVNSRLGITHENC  113
            RV+ D    RLGI  E C
Sbjct  441  RVVIDGAGGRLGIARERC  458



>ref|XP_004971304.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=443

 Score =   235 bits (599),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 146/200 (73%), Gaps = 5/200 (3%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
            VFSYCLPS+KS  FSG+LRLGP+GQPK I+TTPLL NPHRPSLYYVN+ G+ VG   V +
Sbjct  244  VFSYCLPSYKSSNFSGTLRLGPIGQPKRIKTTPLLSNPHRPSLYYVNMIGIRVGGKPVPV  303

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFS-SLGAFDTCFAVT  347
            P   LTFDPA+G+GT++D+GT+ +R   P Y A+R+ FR++V  P + SLG FDTC+ VT
Sbjct  304  PASALTFDPASGSGTIVDAGTMFTRLSAPVYAAVRDAFRRRVRAPVAGSLGGFDTCYNVT  363

Query  346  KEFMAPPITFHFQG-MDLVLPMENTLIHTSYGNLACLAMAAAP-NNVNSVLNVIANLQQQ  173
                 P ++F F G + + LP EN +I +S G +ACLAMAA P + VN+ LNV+A++QQQ
Sbjct  364  VRV--PTVSFTFTGPVTVTLPEENVMIRSSSGGIACLAMAAGPADGVNAALNVLASMQQQ  421

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  N R+G   E C
Sbjct  422  NHRVLFDVANGRVGFARERC  441



>ref|XP_010547361.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=439

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 147/200 (74%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP  ++ TPLL+NP R SLYYV L G+ VG+  V +P
Sbjct  242  FSYCLPSFRSLNFSGSLRLGPTAQPIRLKFTPLLRNPRRSSLYYVKLVGIRVGRKVVDLP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
             + + F+P TGAGT+IDSGTV +R   P Y A+R EFRK+V   +   SSLG FDTC++ 
Sbjct  302  PDAIAFNPTTGAGTIIDSGTVFTRLATPVYEAVRNEFRKRVKPRSAVVSSLGGFDTCYST  361

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            +   +AP +TF F G++L +P EN LIH++ G+  CLA+AAAP+NVNSV+NVIA++QQQN
Sbjct  362  S--IVAPTVTFVFPGVNLTIPAENLLIHSTLGSTTCLAIAAAPDNVNSVVNVIASMQQQN  419

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  NSRLG+  E C+
Sbjct  420  HRVLIDVPNSRLGLARERCS  439



>ref|XP_006368623.1| hypothetical protein POPTR_0001s06560g [Populus trichocarpa]
 gb|ERP65192.1| hypothetical protein POPTR_0001s06560g [Populus trichocarpa]
Length=418

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 144/198 (73%), Gaps = 10/198 (5%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF++  FSG+LRLGP GQP  I+TTPLLKNP R SLYYVNL G+ VG+  V IP
Sbjct  230  FSYCLPSFRTLNFSGTLRLGPAGQPLRIKTTPLLKNPRRSSLYYVNLIGIRVGRKIVDIP  289

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF-SSLGAFDTCFAVTK  344
               L F+P TGAGT+ DS       V P Y A+R+EFRK+V     SSLG FDTC+  T 
Sbjct  290  ASALAFNPTTGAGTIFDS-------VAPVYTAVRDEFRKRVGNAIVSSLGGFDTCY--TG  340

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +AP +TF F GM++ LP +N LI ++ G+ +CLAMAAAP+NVNSVLNVIAN+QQQN R
Sbjct  341  PIVAPTMTFMFSGMNVTLPPDNLLIRSTAGSTSCLAMAAAPDNVNSVLNVIANMQQQNHR  400

Query  163  VLFDTVNSRLGITHENCN  110
            +LFD  NSR+G+  E C+
Sbjct  401  ILFDVPNSRIGVAREPCS  418



>ref|XP_010670495.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Beta vulgaris 
subsp. vulgaris]
Length=434

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 145/197 (74%), Gaps = 3/197 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGS++LGPV QPK +  TPLLKNP RPSLYYVNL G+ VG   V IP
Sbjct  239  FSYCLPSFRSSNFSGSMKLGPVAQPKKMHYTPLLKNPKRPSLYYVNLIGIKVGSKTVNIP  298

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
             + L F+P  GAGTVID+GTV +R   PAY+A+R+EFR+++     +SLG F+TC++V  
Sbjct  299  ADALAFNPNNGAGTVIDTGTVYTRLATPAYIAVRDEFRRRMGKANVTSLGGFETCYSV--  356

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
                P ITF FQ M L L  +N L+ ++  +++CLA+AAAP NVNS LNVIAN+QQQN R
Sbjct  357  PITVPSITFLFQDMKLTLDQDNFLLRSTSTSISCLAIAAAPENVNSALNVIANMQQQNHR  416

Query  163  VLFDTVNSRLGITHENC  113
            V+FD  N+RLGI+ E C
Sbjct  417  VVFDLPNNRLGISRETC  433



>ref|XP_010557871.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Tarenaya hassleriana]
Length=439

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP  ++ TPLL+NP R SLYYVNL G+ VG   V +P
Sbjct  242  FSYCLPSFRSLNFSGSLRLGPTAQPIRLKFTPLLRNPRRSSLYYVNLVGIRVGPKVVDLP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               L F+P TGAGT+IDSGTV +R V+P Y A+R+EFR++V   +   +SLG FDTC+  
Sbjct  302  PGALAFNPTTGAGTIIDSGTVFTRLVKPVYEAVRDEFRRRVKPRSAVVTSLGGFDTCYMT  361

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
                +AP +TF F G+++ LP EN LIH++ G+  CLAMAAAP NVNSV+NVIAN+QQQN
Sbjct  362  --AIVAPTVTFMFAGVNMTLPEENMLIHSTAGSNTCLAMAAAPENVNSVVNVIANMQQQN  419

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  NSRLG+    C+
Sbjct  420  HRVLVDVPNSRLGLAPARCS  439



>gb|EPS64285.1| hypothetical protein M569_10492 [Genlisea aurea]
Length=423

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGP GQPK I+TTPLL+NP R SLYY +L G+ VG   V IP
Sbjct  226  FSYCLPSFKSVSFSGSLRLGPAGQPKRIKTTPLLRNPRRSSLYYADLVGIKVGGRIVDIP  285

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFAVT  347
               L F+P +GAGTVIDSGTV +  V+PAY A+R+EFR+++  +   SSLG FDTC+A  
Sbjct  286  ASALAFNPVSGAGTVIDSGTVFTTLVQPAYAAVRDEFRRRMGNSTAASSLGGFDTCYAA-  344

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAA-PNNVNSVLNVIANLQQQN  170
               + P ITF F GM++ LP EN +IH++ G ++CLAMAAA  N +N+ ++VI + QQQN
Sbjct  345  -PIVVPTITFMFAGMNVTLPQENFIIHSTAGRISCLAMAAAGENGINAGVSVIGSFQQQN  403

Query  169  LRVLFDTVNSRLGITHENCN  110
             R+L D  NS+LG+  E C+
Sbjct  404  HRILIDAANSKLGVARELCS  423



>ref|XP_010495094.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=439

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 146/200 (73%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP  ++ TPLLKNP R SLYYVNL  + VG+  V +P
Sbjct  242  FSYCLPSFRSLAFSGSLRLGPTSQPLRVKYTPLLKNPRRSSLYYVNLVAIRVGRKVVDLP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               + F+P+TGAGT+ DSGTV +R  +P Y A+R EFRK+V   T   +SLG FDTC+  
Sbjct  302  PAAIAFNPSTGAGTIFDSGTVYTRLAKPVYEAVRNEFRKRVKPHTAVVTSLGGFDTCY--  359

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            T++   P ITF F+G+++ LP +N ++H++ G+ +CLA+AAAP NVNSV+NVIA++QQQN
Sbjct  360  TEKVTVPTITFMFKGVNMTLPADNLMLHSTAGSRSCLAIAAAPENVNSVVNVIASMQQQN  419

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N RLG+  E C+
Sbjct  420  YRVLIDVPNGRLGLARERCS  439



>ref|XP_006645377.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=448

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 148/200 (74%), Gaps = 5/200 (3%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
            VFSYCLP+++S  FSG+L+LGPVGQPK I+TTPLL NPHRPSLYYVN+ G+ VG   V +
Sbjct  249  VFSYCLPNYRSSNFSGTLKLGPVGQPKKIKTTPLLYNPHRPSLYYVNMVGIRVGSKVVPV  308

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSS-LGAFDTCFAVT  347
            PQ  L F+P TG+GT+ID+GT+ +R   P Y A+R+ FR +V  P ++ LG FDTC+ V+
Sbjct  309  PQSALAFNPVTGSGTIIDAGTMFTRLAAPVYAAVRDAFRSRVRTPVAAPLGGFDTCYNVS  368

Query  346  KEFMAPPITFHFQG-MDLVLPMENTLIHTSYGNLACLAMAAAPNN-VNSVLNVIANLQQQ  173
                 P +TF F G + + LP EN +IH+S G +ACLAMAAAP++ VN+ LNV+A++QQQ
Sbjct  369  VSV--PTVTFMFAGAVTVTLPEENVMIHSSSGGIACLAMAAAPSDGVNAALNVLASMQQQ  426

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  N R+G + E C
Sbjct  427  NQRVLFDVANGRVGFSRELC  446



>ref|XP_010452650.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=439

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP  ++ TPLLKNP R SLYYVNL  + VG+  V +P
Sbjct  242  FSYCLPSFRSLAFSGSLRLGPTSQPLRVKYTPLLKNPRRSSLYYVNLVAIRVGRKVVDLP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               + F+P+TGAGT+ DSGTV +R  +P Y A+R EFRK+V   T   +SLG FDTC+  
Sbjct  302  PAAIAFNPSTGAGTIFDSGTVYTRLAKPVYEAVRNEFRKRVKPHTAVVTSLGGFDTCY--  359

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            T +   P ITF F+G+++ LP +N ++H++ G+ +CLA+AAAP NVNSV+NVIA++QQQN
Sbjct  360  TGQVTVPTITFMFKGVNMTLPADNLMLHSTAGSTSCLAIAAAPENVNSVVNVIASMQQQN  419

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N RLG+  E C+
Sbjct  420  YRVLIDVPNGRLGLARERCS  439



>ref|XP_010423263.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Camelina sativa]
 ref|XP_010423264.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Camelina sativa]
 ref|XP_010423265.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X3 [Camelina sativa]
Length=439

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 144/200 (72%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP  ++ TPLLKNP R SLYYVNL  + VG+  V +P
Sbjct  242  FSYCLPSFRSLTFSGSLRLGPTSQPLRVKYTPLLKNPRRSSLYYVNLVAIRVGRKVVDLP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               + F+P TGAGT+ DSGTV +R  +P Y A+R EFRK+V   T   +SLG FDTC+  
Sbjct  302  PAAIAFNPTTGAGTIFDSGTVYTRLAKPVYEAVRNEFRKRVKPHTAVVTSLGGFDTCY--  359

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            T +   P ITF F+G+++ +P +N ++H++ G+ +CLA+AAAP NVNSV+NVIA++QQQN
Sbjct  360  TGQVTVPTITFMFKGVNMTMPADNLMLHSTAGSTSCLAIAAAPENVNSVVNVIASMQQQN  419

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N RLG+  E C+
Sbjct  420  YRVLIDVPNGRLGLARERCS  439



>ref|XP_006854820.1| hypothetical protein AMTR_s00063p00187740 [Amborella trichopoda]
 gb|ERN16287.1| hypothetical protein AMTR_s00063p00187740 [Amborella trichopoda]
Length=417

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLP+F++  F+GSL+LGPVGQP  I+ TPLL NP R SLYYV L  + VG+  + 
Sbjct  221  GVFSYCLPNFRAPGFTGSLKLGPVGQPIRIKYTPLLTNPRRSSLYYVKLGAILVGRTKLP  280

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVT  347
            IP     FDPATG+GTV DSGT+++R V PAY A++ EFRK++    ++LG FDTC+   
Sbjct  281  IPDSAFAFDPATGSGTVFDSGTMVTRLVAPAYEALKAEFRKRINKTVTTLGGFDTCY--N  338

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
            +  + P ITF F+GM++ L  +N +I +S G + CLAMA AP NVN+V+NVIAN QQQN 
Sbjct  339  EAIVVPHITFQFEGMNMTLADDNVVIKSSAGTITCLAMAEAPANVNAVVNVIANFQQQNH  398

Query  166  RVLFDTVNSRLGITHENCN  110
            RV++D  N RLG++ E C+
Sbjct  399  RVVYDVANGRLGVSREFCS  417



>gb|EAY77272.1| hypothetical protein OsI_05246 [Oryza sativa Indica Group]
Length=426

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 146/200 (73%), Gaps = 5/200 (3%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
            VFSYCLP+++S  FSG+L+LGP+GQPK I+TTPLL NPHRPSLYYVN+ G+ VG   V +
Sbjct  227  VFSYCLPNYRSSNFSGTLKLGPIGQPKRIKTTPLLYNPHRPSLYYVNMIGIRVGSKVVQV  286

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFS-SLGAFDTCFAVT  347
            PQ  L F+P TG+GT+ID+GT+ +R   P Y A+R+ FR +V  P +  LG FDTC+ VT
Sbjct  287  PQSALAFNPVTGSGTIIDAGTMFTRLAAPVYAAVRDAFRGRVRTPVAPPLGGFDTCYNVT  346

Query  346  KEFMAPPITFHFQG-MDLVLPMENTLIHTSYGNLACLAMAAAPNN-VNSVLNVIANLQQQ  173
                 P +TF F G + + LP EN +IH+S G +ACLAMAA P++ VN+ LNV+A++QQQ
Sbjct  347  VSV--PTVTFMFAGAVAVTLPEENVMIHSSSGGVACLAMAAGPSDGVNAALNVLASMQQQ  404

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  N R+G + E C
Sbjct  405  NQRVLFDVANGRVGFSRELC  424



>ref|XP_009593615.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
tomentosiformis]
Length=438

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPS+KS  FSG+LRLGP GQPK I+TT LL+NP R S YYVNL GV VG+  V IP
Sbjct  241  FSYCLPSYKSPNFSGTLRLGPNGQPKRIKTTQLLRNPRRSSFYYVNLVGVKVGRRIVDIP  300

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFAVT  347
               L F+P+TGAGT+IDSGTV +R VEPAY A+R EFR+++      +SLG FDTC+ V 
Sbjct  301  PSALAFNPSTGAGTIIDSGTVFTRLVEPAYTAVRNEFRRRMGRNTTVTSLGGFDTCYTV-  359

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNN-VNSVLNVIANLQQQN  170
                 P IT  F GM++ LP +N LI +S  +  CLAMAA+P + VNSVLNVIAN QQQN
Sbjct  360  -PITIPTITLMFAGMNVTLPQDNFLIRSSSSSTTCLAMAASPADPVNSVLNVIANWQQQN  418

Query  169  LRVLFDTVNSRLGITHENCN  110
             R LFD  NS+LG+  E C+
Sbjct  419  HRFLFDVPNSKLGVARETCS  438



>ref|NP_001045434.1| Os01g0954900 [Oryza sativa Japonica Group]
 dbj|BAB90778.1| nucleoid DNA-binding-like protein [Oryza sativa Japonica Group]
 dbj|BAF07348.1| Os01g0954900 [Oryza sativa Japonica Group]
 dbj|BAG99095.1| unnamed protein product [Oryza sativa Japonica Group]
Length=445

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 146/200 (73%), Gaps = 5/200 (3%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
            VFSYCLP+++S  FSG+L+LGP+GQPK I+TTPLL NPHRPSLYYVN+ G+ VG   V +
Sbjct  246  VFSYCLPNYRSSNFSGTLKLGPIGQPKRIKTTPLLYNPHRPSLYYVNMIGIRVGSKVVQV  305

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFS-SLGAFDTCFAVT  347
            PQ  L F+P TG+GT+ID+GT+ +R   P Y A+R+ FR +V  P +  LG FDTC+ VT
Sbjct  306  PQSALAFNPVTGSGTIIDAGTMFTRLAAPVYAAVRDAFRGRVRTPVAPPLGGFDTCYNVT  365

Query  346  KEFMAPPITFHFQG-MDLVLPMENTLIHTSYGNLACLAMAAAPNN-VNSVLNVIANLQQQ  173
                 P +TF F G + + LP EN +IH+S G +ACLAMAA P++ VN+ LNV+A++QQQ
Sbjct  366  VSV--PTVTFMFAGAVAVTLPEENVMIHSSSGGVACLAMAAGPSDGVNAALNVLASMQQQ  423

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  N R+G + E C
Sbjct  424  NQRVLFDVANGRVGFSRELC  443



>gb|KFK25095.1| hypothetical protein AALP_AA8G065800 [Arabis alpina]
Length=441

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 143/202 (71%), Gaps = 5/202 (2%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
              FSYCLPSF+S  FSGSLRLGP  QP  ++ T LL+NP R SLYYVNL  + VG+  V 
Sbjct  242  ATFSYCLPSFRSLAFSGSLRLGPTSQPLRVKYTQLLRNPRRSSLYYVNLVAIRVGRKVVD  301

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCF  356
            +P   + F+PATGAGT+ DSGTV +R  +P Y A+R EFRK+V   T    SLG FDTC+
Sbjct  302  LPPAAIAFNPATGAGTIFDSGTVYTRLAKPVYEAVRNEFRKRVKPTTAVVKSLGGFDTCY  361

Query  355  AVTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQ  176
              T +   P ITF F+G+++ LP +N ++H++ G+ +CLA+AAAP NVNSV+NVIA++QQ
Sbjct  362  --TGQVKVPTITFMFKGVNMTLPADNLMLHSTAGSTSCLAIAAAPENVNSVVNVIASMQQ  419

Query  175  QNLRVLFDTVNSRLGITHENCN  110
            QN RVL D  N RLG+  E C+
Sbjct  420  QNYRVLIDVPNGRLGLARERCS  441



>ref|XP_009778175.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
sylvestris]
Length=442

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 143/201 (71%), Gaps = 5/201 (2%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
             FSYCLPS+KS  FSG+LRLGP GQPK I+TT LL+NP R S YYVNL GV VG+  V I
Sbjct  244  TFSYCLPSYKSPNFSGTLRLGPNGQPKRIKTTQLLRNPRRSSFYYVNLVGVKVGRRIVDI  303

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFAV  350
            P   L F+P+TGAGT+IDSGTV +R VEP Y A+R EFR+++      +SLG FDTC+ V
Sbjct  304  PPSALAFNPSTGAGTIIDSGTVFTRLVEPVYTAVRNEFRRRMGRNTTVTSLGGFDTCYTV  363

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNN-VNSVLNVIANLQQQ  173
                  P IT  F GM++ LP +N LI +S  +  CLAMAA+P + VNSVLNVIAN QQQ
Sbjct  364  --PITIPTITLMFAGMNVTLPQDNFLIRSSSSSTTCLAMAASPADPVNSVLNVIANWQQQ  421

Query  172  NLRVLFDTVNSRLGITHENCN  110
            N R LFD +NS+LG+  E C+
Sbjct  422  NHRFLFDILNSKLGVARETCS  442



>dbj|BAB11161.1| nucleoid DNA-binding-like protein [Arabidopsis thaliana]
 gb|AAM62745.1| nucleoid DNA-binding-like protein [Arabidopsis thaliana]
 gb|ABG25087.1| At5g07030 [Arabidopsis thaliana]
Length=439

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP+ ++ T LL+NP R SLYYVNL  + VG+  V +P
Sbjct  242  FSYCLPSFRSLTFSGSLRLGPTSQPQRVKYTQLLRNPRRSSLYYVNLVAIRVGRKVVDLP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               + F+P+TGAGT+ DSGTV +R  +P Y A+R EFRK+V   T   +SLG FDTC+  
Sbjct  302  PAAIAFNPSTGAGTIFDSGTVYTRLAKPVYEAVRNEFRKRVKPTTAVVTSLGGFDTCY--  359

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            + +   P ITF F+G+++ +P +N ++H++ G+ +CLAMAAAP NVNSV+NVIA++QQQN
Sbjct  360  SGQVKVPTITFMFKGVNMTMPADNLMLHSTAGSTSCLAMAAAPENVNSVVNVIASMQQQN  419

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N RLG+  E C+
Sbjct  420  HRVLIDVPNGRLGLARERCS  439



>ref|XP_002873291.1| hypothetical protein ARALYDRAFT_487523 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49550.1| hypothetical protein ARALYDRAFT_487523 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP+ ++ T LL+NP R SLYYVNL  + VG+  V +P
Sbjct  242  FSYCLPSFRSLTFSGSLRLGPTSQPQRVKYTQLLRNPRRSSLYYVNLVAIRVGRKVVDLP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP---FSSLGAFDTCFAV  350
               + F+P+TGAGT+ DSGTV +R  +P Y A+R EFRK+V  P    +SLG FDTC+  
Sbjct  302  PAAIAFNPSTGAGTIFDSGTVYTRLAKPVYEAVRNEFRKRVKPPTAVVTSLGGFDTCY--  359

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            + +   P ITF F+G+++ +P +N ++H++ G+ +CLAMA+AP NVNSV+NVIA++QQQN
Sbjct  360  SGQVKVPTITFMFKGVNMTMPADNLMLHSTAGSTSCLAMASAPENVNSVVNVIASMQQQN  419

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N RLG+  E C+
Sbjct  420  HRVLIDVPNGRLGLARERCS  439



>ref|NP_196320.2| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AED91100.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=455

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP+ ++ T LL+NP R SLYYVNL  + VG+  V +P
Sbjct  258  FSYCLPSFRSLTFSGSLRLGPTSQPQRVKYTQLLRNPRRSSLYYVNLVAIRVGRKVVDLP  317

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               + F+P+TGAGT+ DSGTV +R  +P Y A+R EFRK+V   T   +SLG FDTC+  
Sbjct  318  PAAIAFNPSTGAGTIFDSGTVYTRLAKPVYEAVRNEFRKRVKPTTAVVTSLGGFDTCY--  375

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            + +   P ITF F+G+++ +P +N ++H++ G+ +CLAMAAAP NVNSV+NVIA++QQQN
Sbjct  376  SGQVKVPTITFMFKGVNMTMPADNLMLHSTAGSTSCLAMAAAPENVNSVVNVIASMQQQN  435

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N RLG+  E C+
Sbjct  436  HRVLIDVPNGRLGLARERCS  455



>ref|XP_006287717.1| hypothetical protein CARUB_v10000927mg [Capsella rubella]
 gb|EOA20615.1| hypothetical protein CARUB_v10000927mg [Capsella rubella]
Length=457

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 146/200 (73%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP+ I+ T LL+NP R SLYYVNL  + VG+  V +P
Sbjct  260  FSYCLPSFRSLTFSGSLRLGPTSQPQRIKYTQLLRNPRRSSLYYVNLVAIRVGRKVVDLP  319

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               + F+P+TGAGT+ DSGTV +R  +P Y A+R EFRK+V   T   +SLG FDTC+  
Sbjct  320  PAAIAFNPSTGAGTIFDSGTVYTRLAKPVYEAVRNEFRKRVKPRTAVVTSLGGFDTCY--  377

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            + +   P ITF F+G+++ +P +N ++H++ G+++CLA+AAAP NVNSV+NVIA++QQQN
Sbjct  378  SGQVTVPTITFMFKGVNMTMPADNLMLHSTAGSMSCLAIAAAPENVNSVVNVIASMQQQN  437

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N RLG+  E C+
Sbjct  438  HRVLIDVPNGRLGLARERCS  457



>ref|XP_008806589.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=449

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 139/198 (70%), Gaps = 3/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+F+S  FSGSLRLGP  +P+ I +TPLL NP RPSLYYVN+T + VG   V IP
Sbjct  252  FSYCLPNFRSLNFSGSLRLGPAAKPRRIHSTPLLANPRRPSLYYVNMTRIRVGGRPVRIP  311

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT--GPFSSLGAFDTCFAVT  347
             E   FDP+TG GT+IDSGT+ +R V PAY A+R+EFR+++   G  + LG FDTC++  
Sbjct  312  PEAFAFDPSTGGGTIIDSGTMFTRLVAPAYEAVRDEFRRRIKGGGAVTFLGGFDTCYS-G  370

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNL  167
                 P +   F+GM + LP EN +I +S G+  CLAMAA+P NVNSVLNV+A++ QQN 
Sbjct  371  AAVKVPAVELEFEGMRVRLPEENVVIRSSSGSTLCLAMAASPGNVNSVLNVVASMAQQNH  430

Query  166  RVLFDTVNSRLGITHENC  113
            RV+FD    RLGI  E C
Sbjct  431  RVVFDGAGGRLGIARERC  448



>ref|XP_006658916.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Oryza 
brachyantha]
Length=271

 Score =   222 bits (566),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = -3

Query  676  KSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIPQEHLTFDP  497
            K+Y F    R    GQP+ I+TTPLL N HR SLYYVN+TG+ VGK  V +P   L FDP
Sbjct  83   KTYTFGCLQRATGKGQPQRIKTTPLLANAHRSSLYYVNMTGIRVGKKVVSVPSSALAFDP  142

Query  496  ATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGAFDTCFAVTKEFMAPPITF  317
            ATGAGTV+DSGT+ +R V P Y+++R+E R++V  P SSLG FDTC+  T  +  PP+T 
Sbjct  143  ATGAGTVLDSGTMFTRLVAPVYLSLRDEVRRRVGAPVSSLGGFDTCYNTTVAW--PPVTL  200

Query  316  HFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLRVLFDTVNSR  137
             F GM + LP EN +IH++YG  +CLAMA AP+ +N+VLNVIA++QQQN RVLFD  N R
Sbjct  201  LFDGMQVTLPEENVVIHSTYGTTSCLAMAPAPDGLNTVLNVIASMQQQNHRVLFDVPNGR  260

Query  136  LGITHENC  113
            +G + E C
Sbjct  261  VGFSRERC  268



>ref|XP_006347658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=442

 Score =   227 bits (579),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPS+KS  FSG+LRLGP GQP+ I+TTPLL+NP R S YYVNL GV VGK  V IP
Sbjct  245  FSYCLPSYKSPNFSGTLRLGPNGQPQRIKTTPLLRNPRRSSFYYVNLVGVKVGKRIVDIP  304

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFAVT  347
                +F+  TGAGT+IDSGTV +R VEPAY A+R EFR+++      +SLG FDTC+ V 
Sbjct  305  AGAFSFNSNTGAGTIIDSGTVFTRLVEPAYTAVRNEFRRRMGRNTTVTSLGGFDTCYTV-  363

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNN-VNSVLNVIANLQQQN  170
                 P IT  F GM++ LP +N LI +S  +  CLAMAA+P + VNSVLNVIA+ QQQN
Sbjct  364  -PITIPTITLMFAGMNVTLPQDNFLIKSSSSSTTCLAMAASPADPVNSVLNVIASWQQQN  422

Query  169  LRVLFDTVNSRLGITHENCN  110
             R+LFD  NSR+G+  E C+
Sbjct  423  HRILFDVPNSRVGVARETCS  442



>ref|XP_008656859.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Zea 
mays]
 gb|AFW83929.1| hypothetical protein ZEAMMB73_279135 [Zea mays]
Length=451

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 141/201 (70%), Gaps = 5/201 (2%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
            VFSYCLPS+KS  FSG+LRLGP GQPK I+TTPLL NPHRPSLYYVN+ G+ VG   V +
Sbjct  252  VFSYCLPSYKSSNFSGTLRLGPAGQPKRIKTTPLLSNPHRPSLYYVNMVGIRVGGRPVPV  311

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSS-LGAFDTCFAVT  347
            P   L FDP +G GT++D+GT+ +R   P Y A+R+ FR +V  P +  LG FDTC+ VT
Sbjct  312  PASALAFDPTSGRGTIVDAGTMFTRLSAPVYAAVRDVFRSRVRAPVAGPLGGFDTCYNVT  371

Query  346  KEFMAPPITFHFQG-MDLVLPMENTLIHTSYGNLACLAMAAA-PNNVNSVLNVIANLQQQ  173
                 P +TF F G + + LP EN +I +S G +ACLAMAA  P+ V++ LNV+A++QQQ
Sbjct  372  --ISVPTVTFSFDGRVSVTLPEENVVIRSSSGGIACLAMAAGPPDGVDAALNVLASMQQQ  429

Query  172  NLRVLFDTVNSRLGITHENCN  110
            N RVLFD  N R+G + E C 
Sbjct  430  NHRVLFDVANGRVGFSRELCT  450



>emb|CDX99015.1| BnaC09g48200D [Brassica napus]
Length=439

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP  ++ T LL+NP R SLYYVNL  + V K  V IP
Sbjct  242  FSYCLPSFRSLAFSGSLRLGPTAQPVRVKYTQLLRNPRRSSLYYVNLVAIRVAKKVVDIP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               + F+P TGAGT+ DSGTV +R  +P Y A+R EFRK+V   T   +SLG FDTC+  
Sbjct  302  PAAIAFNPTTGAGTIFDSGTVYTRLSKPVYEAVRNEFRKRVKPRTAVVTSLGGFDTCY--  359

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            + +   P ITF F+G+++ +P +N ++H+S G+L+CLA+A++P NVNSV+NVIA++QQQN
Sbjct  360  SGKITVPTITFMFKGVNMTMPADNLMLHSSAGSLSCLAIASSPENVNSVVNVIASMQQQN  419

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N RLG+  E C+
Sbjct  420  HRVLIDVPNGRLGLARERCS  439



>ref|XP_009122387.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=439

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP  ++ T LL+NP R SLYYVNL  + V K  V IP
Sbjct  242  FSYCLPSFRSLAFSGSLRLGPTAQPVRVKYTQLLRNPRRSSLYYVNLVAIRVAKKVVDIP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               + F+P TGAGT+ DSGTV +R  +P Y A+R EFRK+V   T   +SLG FDTC+  
Sbjct  302  PAAIAFNPTTGAGTIFDSGTVYTRLSKPVYEAVRNEFRKRVKPRTAVVTSLGGFDTCY--  359

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            + +   P ITF F+G+++ +P +N ++H+S G+L+CLA+A++P NVNSV+NVIA++QQQN
Sbjct  360  SGKITVPTITFMFKGVNMTMPADNLMLHSSAGSLSCLAIASSPENVNSVVNVIASMQQQN  419

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N RLG+  E C+
Sbjct  420  HRVLIDVPNGRLGLARERCS  439



>ref|XP_004230031.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=443

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPS+KS  FSG+LRLGP GQP  I+TTPLL+NP R S YYVNL GV VGK  V IP
Sbjct  246  FSYCLPSYKSPNFSGTLRLGPKGQPLRIKTTPLLRNPRRSSFYYVNLVGVKVGKRIVDIP  305

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV--TGPFSSLGAFDTCFAVT  347
                 FD  TGAGT+IDSGTV +R V+ AY A+R EFR+++      +SLG FDTC+ V 
Sbjct  306  PSAFAFDSNTGAGTIIDSGTVFTRLVDQAYTAVRNEFRRRMGRNATVTSLGGFDTCYTV-  364

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNN-VNSVLNVIANLQQQN  170
                 P ITF F GM++ LP +N LI +S  +  CLAMAA+P + VNSVLNVIA+ QQQN
Sbjct  365  -PITIPTITFMFAGMNVTLPQDNFLIKSSSSSTTCLAMAASPTDPVNSVLNVIASWQQQN  423

Query  169  LRVLFDTVNSRLGITHENCN  110
             R+LFD  NSR+G+  E C+
Sbjct  424  HRILFDVPNSRVGVARETCS  443



>emb|CDX70001.1| BnaA10g23500D [Brassica napus]
Length=439

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP  ++ T LL+NP R SLYYVNL  + V K  V IP
Sbjct  242  FSYCLPSFRSLAFSGSLRLGPTAQPVRVKYTQLLRNPRRSSLYYVNLVAIRVAKKVVDIP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               + F+P TGAGT+ DSGTV +R  +P Y A+R EFRK+V   T   +SLG FDTC+  
Sbjct  302  PAAIAFNPTTGAGTIFDSGTVYTRLSKPVYEAVRNEFRKRVKPRTAVVTSLGGFDTCY--  359

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            + +   P ITF F+G+++ +P +N ++H+S G+L+CLA+A++P NVNSV+NVIA++QQQN
Sbjct  360  SGKITVPTITFMFKGVNMTMPADNLMLHSSAGSLSCLAIASSPENVNSVVNVIASMQQQN  419

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N RLG+  E C+
Sbjct  420  HRVLIDVPNGRLGLARERCS  439



>gb|EYU38286.1| hypothetical protein MIMGU_mgv1a006610mg [Erythranthe guttata]
Length=437

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPS+KS  F+G+LRLGP  QP  I+TTPLL+NP R SLYYVNL  + VG+  V IP
Sbjct  240  FSYCLPSYKSVNFTGNLRLGPHSQPIRIKTTPLLRNPRRSSLYYVNLVAIRVGRRVVAIP  299

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
                 +DP +GAGTV DSGTV +  V PAYVA+R+E R+++     SSLG FDTC+A   
Sbjct  300  PSAFAYDPVSGAGTVFDSGTVFTSLVRPAYVAVRDEVRRRMGNATVSSLGGFDTCYA-GA  358

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPN-NVNSVLNVIANLQQQNL  167
                P +TF F GM++ LP +N +I +S G  +CLAMAAAP+ NVNSVLNVIA+ QQQN 
Sbjct  359  PISVPTVTFMFAGMNVTLPQDNFVIRSSAGTTSCLAMAAAPDGNVNSVLNVIASFQQQNH  418

Query  166  RVLFDTVNSRLGITHENCN  110
            R+L D  NSRLG+  E C+
Sbjct  419  RILIDVPNSRLGVAREACS  437



>ref|XP_009130976.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=439

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP  ++ TPLL+NP R SLYYVNL  + VG   V +P
Sbjct  242  FSYCLPSFRSLAFSGSLRLGPTSQPLRLKYTPLLRNPRRSSLYYVNLLAIRVGNKVVDLP  301

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
            QE + F+P TGAGT+ DSGTV +R  +  Y A+R+EFR++V       +SLG FDTC+  
Sbjct  302  QEAIAFNPTTGAGTIFDSGTVYTRLAKSVYEAVRDEFRRRVKPRNAVVTSLGGFDTCY--  359

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            + +   P ITF F+G+++ +P +N ++H++ G+ +CLA+A AP NVNSV+NVIA++QQQN
Sbjct  360  SGQVTVPAITFMFKGVNMTMPADNLMLHSTAGSTSCLAIAVAPENVNSVVNVIASMQQQN  419

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N R+G+  E C+
Sbjct  420  HRVLIDVPNGRIGLARELCS  439



>emb|CDY58878.1| BnaA03g55560D [Brassica napus]
Length=440

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP  ++ TPLL+NP R SLYYVNL  + VG   V +P
Sbjct  243  FSYCLPSFRSLAFSGSLRLGPTSQPLRLKYTPLLRNPRRSSLYYVNLLAIRVGNKVVDLP  302

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
            QE + F+P TGAGT+ DSGTV +R  +  Y A+R+EFR++V       +SLG FDTC+  
Sbjct  303  QEAIAFNPTTGAGTIFDSGTVYTRLAKTVYEAVRDEFRRRVKPRNAVVTSLGGFDTCY--  360

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            + +   P ITF F+G+++ +P +N ++H++ G+ +CLA+A AP NVNSV+NVIA++QQQN
Sbjct  361  SGQVTVPAITFMFKGVNMTMPADNLMLHSTAGSTSCLAIAVAPENVNSVVNVIASMQQQN  420

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N R+G+  E C+
Sbjct  421  HRVLIDVPNGRIGLARELCS  440



>emb|CDX81031.1| BnaC03g02850D [Brassica napus]
Length=454

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 143/200 (72%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSF+S  FSGSLRLGP  QP  ++ TPLL+NP R SLYYVNL  + VG   V +P
Sbjct  257  FSYCLPSFRSLAFSGSLRLGPTSQPLRLKYTPLLRNPRRSSLYYVNLLAIRVGNKVVDLP  316

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
            QE + F+P TGAGT+ DSGTV +R  +  Y A+R+EFR++V       +SLG FDTC+  
Sbjct  317  QEAIAFNPTTGAGTIFDSGTVYTRLAKSVYEAVRDEFRRRVKPRNAVVTSLGGFDTCY--  374

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            + +   P ITF F+G+++ +P +N ++H++ G+ +CLA+A AP NVNSV+NVIA++QQQN
Sbjct  375  SGQVTVPAITFMFKGVNMTMPADNLMLHSTAGSTSCLAIAVAPENVNSVVNVIASMQQQN  434

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N R+G+  E C+
Sbjct  435  HRVLIDVPNGRIGLAREVCS  454



>ref|XP_006399181.1| hypothetical protein EUTSA_v10013504mg [Eutrema salsugineum]
 gb|ESQ40634.1| hypothetical protein EUTSA_v10013504mg [Eutrema salsugineum]
Length=455

 Score =   222 bits (565),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLPSFKS  FSGSLRLGP  QP  ++ T LL+NP R SLYYV+L  + V K  V +P
Sbjct  258  FSYCLPSFKSLAFSGSLRLGPTSQPLRVKYTQLLRNPRRSSLYYVDLVAIRVAKKVVNLP  317

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV---TGPFSSLGAFDTCFAV  350
               + F+P TGAGT+ DSGTV +R  +P Y A+R+EFRK+V   T    SLG FDTC+  
Sbjct  318  PAAIAFNPTTGAGTIFDSGTVYTRLAKPVYEAVRDEFRKRVKPRTAVVKSLGGFDTCY--  375

Query  349  TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQN  170
            T +   P ITF F+G+++ +  +N ++H++ G+ +CLA+A+AP NVNSV+NVIA++QQQN
Sbjct  376  TGQIKVPTITFMFKGVNMTMTADNLMLHSTAGSTSCLAIASAPENVNSVVNVIASMQQQN  435

Query  169  LRVLFDTVNSRLGITHENCN  110
             RVL D  N RLG+  E C+
Sbjct  436  YRVLIDVPNGRLGLARERCS  455



>tpg|DAA49885.1| TPA: hypothetical protein ZEAMMB73_545054 [Zea mays]
Length=565

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 142/200 (71%), Gaps = 5/200 (3%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
            VFSYCLPS+KS  FSG+LRLGP GQPK I+TTPLL NPHRPSLYYVN+ G+ VG   V +
Sbjct  366  VFSYCLPSYKSSNFSGTLRLGPAGQPKRIKTTPLLSNPHRPSLYYVNMVGIRVGGRPVAV  425

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSS-LGAFDTCFAVT  347
            P   L FDPA+G GT++D+GT+ +R   P Y A+ + FR +V  P +  LG FDTC+ VT
Sbjct  426  PASALAFDPASGHGTIVDAGTMFTRLSAPVYAAVCDVFRSRVRAPVAGPLGGFDTCYNVT  485

Query  346  KEFMAPPITFHFQG-MDLVLPMENTLIHTSYGNLACLAMAAAP-NNVNSVLNVIANLQQQ  173
                 P +TF F G + + LP EN +I +S   +ACLAMAA P ++V++VLNV+A++QQQ
Sbjct  486  IS--VPTVTFLFDGRVSVTLPEENVVIRSSLDGIACLAMAAGPSDSVDAVLNVMASMQQQ  543

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  N R+G + E C
Sbjct  544  NHRVLFDVANGRVGFSRELC  563



>gb|AFW71790.1| hypothetical protein ZEAMMB73_638381 [Zea mays]
Length=537

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
            VFSYCLPS+KS  FS +LRLGP GQPK I+ TPLL NPHRPSLYYVN+ G+ VG   + +
Sbjct  338  VFSYCLPSYKSSNFSSTLRLGPAGQPKRIKMTPLLSNPHRPSLYYVNMVGIHVGGRPMLV  397

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSS-LGAFDTCFAVT  347
            P   L FDPA+G GT++D+GT+ +R   P Y A+R+ FR +V  P +  LG FDTC+ VT
Sbjct  398  PASALAFDPASGRGTIVDAGTMFTRLSAPVYAAVRDVFRSRVRAPVTGPLGGFDTCYNVT  457

Query  346  KEFMAPPITFHFQG-MDLVLPMENTLIHTSYGNLACLAMAAAPNN-VNSVLNVIANLQQQ  173
                 P +TF F G + + LP EN +I +S   +ACLAMAA P++ V++VLNV+A++QQQ
Sbjct  458  IS--VPTVTFSFDGRVSVTLPEENVVIRSSSDGIACLAMAAGPSDGVDAVLNVLASMQQQ  515

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  N R+G + E C
Sbjct  516  NHRVLFDVANGRVGFSRELC  535



>gb|AFW71789.1| hypothetical protein ZEAMMB73_638381 [Zea mays]
Length=598

 Score =   218 bits (555),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 141/200 (71%), Gaps = 5/200 (3%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
            VFSYCLPS+KS  FS +LRLGP GQPK I+ TPLL NPHRPSLYYVN+ G+ VG   + +
Sbjct  399  VFSYCLPSYKSSNFSSTLRLGPAGQPKRIKMTPLLSNPHRPSLYYVNMVGIHVGGRPMLV  458

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSS-LGAFDTCFAVT  347
            P   L FDPA+G GT++D+GT+ +R   P Y A+R+ FR +V  P +  LG FDTC+ VT
Sbjct  459  PASALAFDPASGRGTIVDAGTMFTRLSAPVYAAVRDVFRSRVRAPVTGPLGGFDTCYNVT  518

Query  346  KEFMAPPITFHFQG-MDLVLPMENTLIHTSYGNLACLAMAAAPNN-VNSVLNVIANLQQQ  173
                 P +TF F G + + LP EN +I +S   +ACLAMAA P++ V++VLNV+A++QQQ
Sbjct  519  IS--VPTVTFSFDGRVSVTLPEENVVIRSSSDGIACLAMAAGPSDGVDAVLNVLASMQQQ  576

Query  172  NLRVLFDTVNSRLGITHENC  113
            N RVLFD  N R+G + E C
Sbjct  577  NHRVLFDVANGRVGFSRELC  596



>gb|KHN25061.1| Aspartic proteinase nepenthesin-1, partial [Glycine soja]
Length=147

 Score =   202 bits (515),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 119/165 (72%), Gaps = 18/165 (11%)
 Frame = -3

Query  604  LLKNPHRPSLYYVNLTGVSVGKIWVYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVA  425
            LL+NP RPSLYYVNLTG++VG++ V +P ++L FDP  G+GT+IDSGTVI+RFV P Y A
Sbjct  1    LLRNPRRPSLYYVNLTGINVGRVRVSLPTDYLAFDPNKGSGTIIDSGTVITRFVGPVYNA  60

Query  424  IREEFRKQVTGPFSSLGAFDTCFAVTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLA  245
            IR+EFR QV GPF   G FDTCF  T E                LP ENTLIHT+YG +A
Sbjct  61   IRDEFRYQVKGPFFIRGGFDTCFVKTYE---------------NLPYENTLIHTAYGGMA  105

Query  244  CLAMAAAPNNVNSVLNVIANLQQQNLRVLFDTVNSRLGITHENCN  110
            CLAMAAAPNNVNS L    N QQQNLRVLFDTVN+R+GI  E CN
Sbjct  106  CLAMAAAPNNVNSAL---TNFQQQNLRVLFDTVNNRVGIARELCN  147



>ref|XP_003559856.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brachypodium 
distachyon]
Length=460

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 145/216 (67%), Gaps = 19/216 (9%)
 Frame = -3

Query  706  GVFSYCLPSF--KSYYFSGSLRLGPVGQP--KTIRTTPLLKNPHRPSLYYVNLTGVSVGK  539
            G FSYCLPS+   +  FSGSL LG  GQP  + ++TTPLL +PHRPSLYYV +TGV +GK
Sbjct  241  GTFSYCLPSYYRSAANFSGSLTLGRKGQPAPEKMKTTPLLASPHRPSLYYVAMTGVRIGK  300

Query  538  IWVYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF---------  386
              V IP   L FD ATGAGTV+DSGT+ +R  +PAY A+R+E R++V G           
Sbjct  301  KSVPIPPSALAFDAATGAGTVLDSGTMFARLAQPAYAAVRDEVRRRVAGSLRRRGGGGAS  360

Query  385  ---SSLGAFDTCFAVTKEFMAPPITFHF-QGMDLVLPMENTLIHTSYGNLACLAMAAAP-  221
               SSLG FDTC+ V+     P +T  F  GM++ LP EN +I ++YG+ +CLAMAA+P 
Sbjct  361  VSVSSLGGFDTCYNVS-TVAWPAVTLVFGGGMEVRLPEENVVIRSTYGSTSCLAMAASPA  419

Query  220  NNVNSVLNVIANLQQQNLRVLFDTVNSRLGITHENC  113
            + VN+ LNVI +LQQQN RVLFD  N+R+G   E C
Sbjct  420  DGVNAALNVIGSLQQQNHRVLFDVPNARVGFARERC  455



>ref|XP_003567490.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brachypodium 
distachyon]
Length=458

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 138/201 (69%), Gaps = 4/201 (2%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
            +FSYCLPS+KS  FSG+LRLGP GQP+ I+TTPLL NPHRPSLYYV + GV V    V I
Sbjct  255  IFSYCLPSYKSSNFSGTLRLGPAGQPRRIKTTPLLSNPHRPSLYYVAMVGVRVNGKAVPI  314

Query  523  PQEHLTFDPATG-AGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFS-SLGAFDTCFAV  350
            P   L  D ATG  GT++D+GT+ +R   PAY A+R  FR+ V+ P + +LG FDTC+ V
Sbjct  315  PASALALDAATGRGGTIVDAGTMFTRLSPPAYAALRNAFRRGVSAPAAPALGGFDTCYYV  374

Query  349  TKEFMAPPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNN-VNSVLNVIANLQQ  176
                  P + F F  G  + LP EN +I ++ G +ACLAMAA P++ VN+ LNV+A++QQ
Sbjct  375  NGTKSVPAVAFVFAGGARVTLPEENVVISSTSGGVACLAMAAGPSDGVNAGLNVLASMQQ  434

Query  175  QNLRVLFDTVNSRLGITHENC  113
            QN RV+FD  N R+G + E C
Sbjct  435  QNHRVVFDVGNGRVGFSRELC  455



>gb|EEE56022.1| hypothetical protein OsJ_04800 [Oryza sativa Japonica Group]
Length=423

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 129/181 (71%), Gaps = 5/181 (3%)
 Frame = -3

Query  646  LGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIPQEHLTFDPATGAGTVIDS  467
            LGP+GQPK I+TTPLL NPHRPSLYYVN+ G+ VG   V +PQ  L F+P TG+GT+ID+
Sbjct  243  LGPIGQPKRIKTTPLLYNPHRPSLYYVNMIGIRVGSKVVQVPQSALAFNPVTGSGTIIDA  302

Query  466  GTVISRFVEPAYVAIREEFRKQVTGPFS-SLGAFDTCFAVTKEFMAPPITFHFQG-MDLV  293
            GT+ +R   P Y A+R+ FR +V  P +  LG FDTC+ VT     P +TF F G + + 
Sbjct  303  GTMFTRLAAPVYAAVRDAFRGRVRTPVAPPLGGFDTCYNVTVSV--PTVTFMFAGAVAVT  360

Query  292  LPMENTLIHTSYGNLACLAMAAAPNN-VNSVLNVIANLQQQNLRVLFDTVNSRLGITHEN  116
            LP EN +IH+S G +ACLAMAA P++ VN+ LNV+A++QQQN RVLFD  N R+G + E 
Sbjct  361  LPEENVMIHSSSGGVACLAMAAGPSDGVNAALNVLASMQQQNQRVLFDVANGRVGFSREL  420

Query  115  C  113
            C
Sbjct  421  C  421



>ref|XP_011088726.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Sesamum indicum]
Length=444

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 133/198 (67%), Gaps = 3/198 (2%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCLP+ KS  F+GSL+LGP  QPK I  TPLL+N  R SLYY NLT + VG   V IP
Sbjct  232  FSYCLPNLKSANFTGSLKLGPENQPKKINCTPLLRNERRSSLYYANLTAIKVGGRVVCIP  291

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVTK  344
                 F+ +TG GT  DSGT+ +  V+PAY A+R+E R+++     SSLG FDTC+ V  
Sbjct  292  PTAFAFNASTGGGTFFDSGTMFTSLVKPAYTAVRDELRRRMGNATVSSLGGFDTCYTV--  349

Query  343  EFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLR  164
              +   ITF F  +D+ L  +N LI +SYG  +CLAM AAP+NV+SV+N+I + QQQN R
Sbjct  350  PIVVTTITFMFPDLDVTLHQDNFLIRSSYGTTSCLAMMAAPDNVDSVVNIIGSFQQQNQR  409

Query  163  VLFDTVNSRLGITHENCN  110
            ++ D +NSR+ ++ E C+
Sbjct  410  IVIDELNSRVCVSREPCS  427



>gb|EPS70765.1| hypothetical protein M569_03988, partial [Genlisea aurea]
Length=395

 Score =   197 bits (500),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 134/200 (67%), Gaps = 5/200 (3%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQP-KTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYI  524
            FSYCLP++KS  F+GSLRLGP  QP + +  T LL++P R S YYVNL G+ VG+  V I
Sbjct  198  FSYCLPNYKSTNFNGSLRLGPSSQPNRAMNWTQLLRSPRRLSFYYVNLVGIKVGRRGVSI  257

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV-TGPFSSLGAFDTCFAVT  347
            P   L FDP TGAGT+ DSG   +  V+PAY A+R+EFR+Q+     SSLG FDTC+ V 
Sbjct  258  PPAALAFDPNTGAGTIFDSGVTFTTLVKPAYTAVRDEFRRQMGNATVSSLGGFDTCYTV-  316

Query  346  KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPN-NVNSVLNVIANLQQQN  170
                 P +T  F G+++ L  +N LIH++ G ++CLAMAAAP  ++++ LNVI   QQQN
Sbjct  317  -PVAIPTMTLVFSGLNVSLRQDNFLIHSTAGTISCLAMAAAPEGSIDAALNVIGTFQQQN  375

Query  169  LRVLFDTVNSRLGITHENCN  110
             R++ D  NS++ +  E C+
Sbjct  376  HRIVIDVPNSKVAVAREQCS  395



>gb|EEE58460.1| hypothetical protein OsJ_09701 [Oryza sativa Japonica Group]
Length=360

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 106/144 (74%), Gaps = 7/144 (5%)
 Frame = -3

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP--FSSLGAFDTCFAV  350
            P     FD ATGAGTV+DSGTVI+R+  P Y A+REEFR+QV  P  ++SLGAFDTCF  
Sbjct  218  PAGSFAFDAATGAGTVVDSGTVITRWTAPVYAALREEFRRQVAAPSGYTSLGAFDTCFN-  276

Query  349  TKEFMA---PPITFHFQG-MDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
            T E  A   P +T H  G +DL LPMENTLIH+S   LACLAMA AP NVNSV+NVIANL
Sbjct  277  TDEVAAGGAPAVTVHMDGGVDLALPMENTLIHSSATPLACLAMAEAPQNVNSVVNVIANL  336

Query  181  QQQNLRVLFDTVNSRLGITHENCN  110
            QQQN+RV+FD  NSR+G   E+CN
Sbjct  337  QQQNIRVVFDVANSRVGFAKESCN  360



>gb|KHN21324.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=353

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 121/196 (62%), Gaps = 16/196 (8%)
 Frame = -3

Query  682  SFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIPQEHLTF  503
            +F   Y S S+    V    T+ T P+         Y       + G I V IP E L F
Sbjct  166  TFNLTYGSSSIAANVVQDTVTLATDPIPG-------YTFGCVAKTTGPI-VDIPPEALAF  217

Query  502  DPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP------FSSLGAFDTCFAVTKE  341
            + ATGAGTV DSGTV +R V P Y A+R+EFR++V          +SLG FDTC+ V   
Sbjct  218  NAATGAGTVFDSGTVFTRLVAPVYTAVRDEFRRRVAMAAKANLTVTSLGGFDTCYTV--P  275

Query  340  FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLRV  161
             +AP ITF F GM++ LP +N LIH++ G+ +CLAMA+AP+NVNSVLNVIAN+QQQN RV
Sbjct  276  IVAPTITFMFSGMNVTLPQDNILIHSTAGSTSCLAMASAPDNVNSVLNVIANMQQQNHRV  335

Query  160  LFDTVNSRLGITHENC  113
            L+D  NSRLG+  E C
Sbjct  336  LYDVPNSRLGVARELC  351



>dbj|BAJ04354.1| pollen allergen CPA63 [Cryptomeria japonica]
Length=472

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 121/204 (59%), Gaps = 6/204 (3%)
 Frame = -3

Query  703  VFSYCLPSFKSYYFSGSLRLGPVG-QPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
             FSYCLPS  S  F+GSL LG      + ++ TPLL N   PS YYV L G+SVG+  V 
Sbjct  268  TFSYCLPSLFSSAFTGSLLLGKEALSAQGLKFTPLLSNSRYPSFYYVGLNGISVGEELVS  327

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG--PFSSLGAFDTCFA  353
            IP   L+ D +TG GT+IDSGTVI+R VEPAY A+R+ FR Q++     S    FDTC+ 
Sbjct  328  IPAGTLSLDESTGRGTIIDSGTVITRLVEPAYNAMRDSFRSQLSNLTMASPTDLFDTCYN  387

Query  352  V-TKEFMAPPITFHF-QGMDLVLPMENTLI-HTSYGNLACLAMAAAPNNVNSVLNVIANL  182
              + +   P IT HF   +DL LP++N L      G++ CLA    P   + VL+   N 
Sbjct  388  RPSGDVEFPLITLHFDDNLDLTLPLDNILYPGNDDGSVLCLAFGLPPGGGDDVLSTFGNY  447

Query  181  QQQNLRVLFDTVNSRLGITHENCN  110
            QQQ LR++ D   SRLGI  ENC+
Sbjct  448  QQQKLRIVHDVAESRLGIASENCD  471



>emb|CAA06698.1| hypothetical protein [Cicer arietinum]
Length=99

 Score =   154 bits (390),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = -3

Query  406  KQVTGPFSSLGAFDTCFAVTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAA  227
            KQVTGPFSSLGAFDTCF  T E +AP IT  F  ++L LPMEN+LIH+S G+LACLAMAA
Sbjct  1    KQVTGPFSSLGAFDTCFVKTYETLAPAITLRFTDLNLTLPMENSLIHSSSGSLACLAMAA  60

Query  226  APNNVNSVLNVIANLQQQNLRVLFDTVNSRLGITHENCN  110
            AP+NVNSVLNVIAN QQQNLRVLFDTVN+++GI  E CN
Sbjct  61   APSNVNSVLNVIANFQQQNLRVLFDTVNNKVGIARELCN  99



>gb|ACU24323.1| unknown [Glycine max]
Length=334

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G+FSYCLPSFKSYYFSGSL+L PVGQPK+IRTTPLL++PHRPSLYYVN TG+SVG++ V 
Sbjct  241  GIFSYCLPSFKSYYFSGSLKLRPVGQPKSIRTTPLLRSPHRPSLYYVNFTGISVGRVLVP  300

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEP  437
             P E+L F+P TG+GT+IDSGTVI+RFVEP
Sbjct  301  FPSEYLGFNPNTGSGTIIDSGTVITRFVEP  330



>ref|XP_002459115.1| hypothetical protein SORBIDRAFT_03g046190 [Sorghum bicolor]
 gb|EES04235.1| hypothetical protein SORBIDRAFT_03g046190 [Sorghum bicolor]
Length=153

 Score =   143 bits (361),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 100/153 (65%), Gaps = 5/153 (3%)
 Frame = -3

Query  562  LTGVSVGKIWVYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFS  383
            + G+ VG   V +P   L FDP +G GT++D+GT+ +R   P Y A+R+ FR++V  P +
Sbjct  1    MVGIRVGGKPVPVPASALAFDPTSGRGTIVDAGTMFTRLSAPVYAAVRDAFRRRVRAPVA  60

Query  382  S-LGAFDTCFAVTKEFMAPPITFHFQG-MDLVLPMENTLIHTSYGNLACLAMAAA-PNNV  212
              LG FDTC+ VT     P +TF F G + + LP EN +I +S G +ACLAMAA  P+ V
Sbjct  61   GPLGGFDTCYNVTVSV--PTVTFVFDGPVSVTLPEENVVIRSSSGGIACLAMAAGPPDGV  118

Query  211  NSVLNVIANLQQQNLRVLFDTVNSRLGITHENC  113
            ++ LNV+A++QQQN RVLFD  N R+G + E C
Sbjct  119  DAALNVLASMQQQNHRVLFDVANGRVGFSRELC  151



>gb|EMT24179.1| Aspartic proteinase nepenthesin-2 [Aegilops tauschii]
Length=158

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 100/157 (64%), Gaps = 8/157 (5%)
 Frame = -3

Query  562  LTGVSVGKIWVYIPQEHL-TFDPATG-AGTVIDSGTVISRFVEPAYVAIREEFRKQVTGP  389
            + G+ VG   V +P   L +FDPATG  GT++D+GT+ +R   P Y A+R+ FR++   P
Sbjct  1    MVGIHVGGRAVAVPASALASFDPATGTGGTIVDAGTMFTRLSPPVYAAVRDAFRRKARAP  60

Query  388  FSS-LGAFDTCFAVTKEFMAPPITFHFQGMD---LVLPMENTLIHTSYGNLACLAMAAAP  221
             S+ LG FDTC+ VT     P +TF F G     + LP EN +IH+S G + CLAMA+  
Sbjct  61   VSAPLGGFDTCYNVTG-LRVPSVTFAFAGGAGAAVTLPEENVMIHSSSGGVTCLAMASGS  119

Query  220  N-NVNSVLNVIANLQQQNLRVLFDTVNSRLGITHENC  113
            +  VN+ LNV+A++QQQN RVLFD  N R+G + E C
Sbjct  120  SEGVNAGLNVLASMQQQNHRVLFDVANGRVGFSRELC  156



>ref|XP_006444833.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
 gb|ESR58073.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
Length=480

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 101/203 (50%), Gaps = 13/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY-I  524
            FSYCL    +     S+  G     +T R TPLL NP   + YYV L G+SVG   V  I
Sbjct  283  FSYCLVDRSTSAKPSSMVFGDSAVSRTARFTPLLANPKLDTFYYVELVGISVGGAHVRGI  342

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT----GPFSSLGAFDTCF  356
                   DPA   G +IDSGT ++R   PAY+A+R+ FR   +     P  SL  FDTCF
Sbjct  343  TASLFKLDPAGNGGVIIDSGTSVTRLTRPAYIALRDAFRAGASSLKRAPDFSL--FDTCF  400

Query  355  AVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++   E   P +  HF+G D+ LP  N LI        C A A       S L++I N+
Sbjct  401  DLSGKTEVKVPTVVLHFRGADVSLPATNYLIPVDSSGTFCFAFAG----TMSGLSIIGNI  456

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV++D   SR+G     C
Sbjct  457  QQQGFRVVYDLAASRIGFAPRGC  479



>ref|XP_006491285.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO86492.1| hypothetical protein CISIN_1g040810mg [Citrus sinensis]
Length=480

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 101/203 (50%), Gaps = 13/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY-I  524
            FSYCL    +     S+  G     +T R TPLL NP   + YYV L G+SVG   V  I
Sbjct  283  FSYCLVDRSTSAKPSSMVFGDSAVSRTARFTPLLANPKLDTFYYVELVGISVGGAHVRGI  342

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT----GPFSSLGAFDTCF  356
                   DPA   G +IDSGT ++R   PAY+A+R+ FR   +     P  SL  FDTCF
Sbjct  343  TASLFKLDPAGNGGVIIDSGTSVTRLTRPAYIALRDAFRAGASSLKRAPDFSL--FDTCF  400

Query  355  AVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++   E   P +  HF+G D+ LP  N LI        C A A       S L++I N+
Sbjct  401  DLSGKTEVKVPTVVLHFRGADVSLPATNYLIPVDSSGTFCFAFAG----TMSGLSIIGNI  456

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV++D   SR+G     C
Sbjct  457  QQQGFRVVYDLAASRIGFAPRGC  479



>ref|XP_006345762.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Solanum tuberosum]
Length=444

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 109/206 (53%), Gaps = 14/206 (7%)
 Frame = -3

Query  700  FSYCLPSF--KSYYFSGSLRLGPVGQPK--TIRTTPLLKNPHRPSLYYVNLTGVSVGKIW  533
            FSYCL S    +Y  S +L +G +       I TTPL+KNP +PS YY++L G+SVG   
Sbjct  242  FSYCLTSINEDAYTKSSTLLMGSMAHDDYNNIITTPLVKNPTQPSFYYLSLKGISVGDTQ  301

Query  532  VYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFDTC  359
            + I +   + +     G +IDSGT I+   E A+  +++EF  QV  P   SS    D C
Sbjct  302  LAIKKSTFSLNKDGTGGMIIDSGTTITYLEESAFSLLKKEFSSQVNLPVDDSSSTGLDLC  361

Query  358  FAV---TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIA  188
            F +   T     P + FHF+G D+ LP EN +I  S   +ACLAM ++     S +++  
Sbjct  362  FILPSNTNNIEVPKLIFHFEGADMDLPAENYMIADSRMGIACLAMGSS-----SGMSIFG  416

Query  187  NLQQQNLRVLFDTVNSRLGITHENCN  110
            N+QQQN+ V+ D     L      C+
Sbjct  417  NVQQQNMMVIHDLDKETLSFVPTQCD  442



>gb|KEH24641.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=485

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 102/204 (50%), Gaps = 13/204 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY-I  524
            FSYCL    +     S+  G     +T R TPLLKNP   + YYV L G+SVG   V  +
Sbjct  288  FSYCLVDRSATSKPSSVVFGDSAVSRTARFTPLLKNPKLDTFYYVGLLGISVGGAPVRGV  347

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT----GPFSSLGAFDTCF  356
                   D A   G +IDSGT ++R   PAY+A+R+ FR   T     P  SL  FDTCF
Sbjct  348  SASLFKLDTAGNGGVIIDSGTSVTRLTRPAYIALRDAFRLGATHLKKAPEFSL--FDTCF  405

Query  355  AVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++   E   P +  HFQG D+ LP +N LI        C A A       S L++I N+
Sbjct  406  DLSGLTEVKVPTLVLHFQGADVSLPAQNYLIPVDNSGSFCFAFAG----TMSGLSIIGNI  461

Query  181  QQQNLRVLFDTVNSRLGITHENCN  110
            QQQ  RV +D   SR+G   + C 
Sbjct  462  QQQGFRVSYDLATSRVGFAPKGCE  485



>gb|ABR18297.1| unknown [Picea sitchensis]
Length=452

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 115/201 (57%), Gaps = 13/201 (6%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G FSYCLPS  +   S  L         +++ T L+K+P  P+ Y+V L  +SVG   + 
Sbjct  258  GTFSYCLPSSSTSSGSLVLGKEAAVSSSSLKFTTLIKDPSIPTFYFVTLKAISVGNTRIS  317

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG-PFSSLGAFDTCFAV  350
            +P  ++    A+G GT+IDSGT I+  V  AY A+R+ FR+Q++    + +   DTC+ +
Sbjct  318  VPGTNI----ASGGGTIIDSGTTITHLVPSAYTALRDAFRQQLSSLQPTPVEDMDTCYDL  373

Query  349  TKEFM-APPITFHF-QGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQ  176
            +   +  P IT H  + +DLVLP EN LI    G LACLA ++  +      ++I N+QQ
Sbjct  374  SSSSVDVPTITLHLDRNVDLVLPKENILITQESG-LACLAFSSTDSR-----SIIGNVQQ  427

Query  175  QNLRVLFDTVNSRLGITHENC  113
            QN R++FD  NS++G   E C
Sbjct  428  QNWRIVFDVPNSQVGFAQEQC  448



>emb|CDY15187.1| BnaC05g00660D [Brassica napus]
Length=481

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 102/203 (50%), Gaps = 13/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWV-YI  524
            FSYCL    +     S+  G     +T + TPLL NP   + YYV L G+SVG   V  +
Sbjct  284  FSYCLVDRSASSKPSSVVFGNAAVSRTAKFTPLLSNPKLDTFYYVELLGISVGGTRVPGV  343

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV----TGPFSSLGAFDTCF  356
                   DP    G +IDSGT ++R V PAYVA+R+ FR +       P  SL  FDTCF
Sbjct  344  AASLFKLDPIGNGGVIIDSGTSVTRLVRPAYVAMRDAFRVRARSLKRAPDYSL--FDTCF  401

Query  355  AVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++   E   P +  HF+G D+ LP  N LI        C A A       S L++I N+
Sbjct  402  DLSHQNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAG----TMSGLSIIGNI  457

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV++D + SR+G     C
Sbjct  458  QQQGFRVVYDLMGSRVGFAPRGC  480



>ref|XP_004168776.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Cucumis sativus]
Length=461

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 108/208 (52%), Gaps = 17/208 (8%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQ--PKT----IRTTPLLKNPHRPSLYYVNLTGVSVGK  539
            F+YCL +      S SL LG +    PKT    ++TTPL+KNP +PS YY++L G+SVG 
Sbjct  258  FAYCLTAIDDSKPS-SLLLGSLANITPKTSKDEMKTTPLIKNPSQPSFYYLSLQGISVGG  316

Query  538  IWVYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFD  365
              + IP+           G +IDSGT I+     A+ +++ EF  Q+  P   S  G  D
Sbjct  317  TQLSIPKSTFELHDDGSGGVIIDSGTTITYVENSAFTSLKNEFIAQMNLPVDDSGTGGLD  376

Query  364  TCF---AVTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNV  194
             CF   A T +   P +TFHF+G DL LP EN +I  S   L CLA+ ++       +++
Sbjct  377  LCFNLPAGTNQVEVPKLTFHFKGADLELPGENYMIGDSKAGLLCLAIGSSRG-----MSI  431

Query  193  IANLQQQNLRVLFDTVNSRLGITHENCN  110
              NLQQQN  V+ D     L      C+
Sbjct  432  FGNLQQQNFMVVHDLQEETLSFLPTQCD  459



>gb|KGN54860.1| hypothetical protein Csa_4G554680 [Cucumis sativus]
Length=461

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 108/208 (52%), Gaps = 17/208 (8%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQ--PKT----IRTTPLLKNPHRPSLYYVNLTGVSVGK  539
            F+YCL +      S SL LG +    PKT    ++TTPL+KNP +PS YY++L G+SVG 
Sbjct  258  FAYCLTAIDDSKPS-SLLLGSLANITPKTSKDEMKTTPLIKNPSQPSFYYLSLQGISVGG  316

Query  538  IWVYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFD  365
              + IP+           G +IDSGT I+     A+ +++ EF  Q+  P   S  G  D
Sbjct  317  TQLSIPKSTFELHDDGSGGVIIDSGTTITYVENSAFTSLKNEFIAQMNLPVDDSGTGGLD  376

Query  364  TCF---AVTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNV  194
             CF   A T +   P +TFHF+G DL LP EN +I  S   L CLA+ ++       +++
Sbjct  377  LCFNLPAGTNQVEVPKLTFHFKGADLELPGENYMIGDSKAGLLCLAIGSSRG-----MSI  431

Query  193  IANLQQQNLRVLFDTVNSRLGITHENCN  110
              NLQQQN  V+ D     L      C+
Sbjct  432  FGNLQQQNFMVVHDLQEETLSFLPTQCD  459



>ref|XP_004239638.1| PREDICTED: aspartic proteinase nepenthesin-1 [Solanum lycopersicum]
Length=441

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 109/206 (53%), Gaps = 14/206 (7%)
 Frame = -3

Query  700  FSYCLPSF--KSYYFSGSLRLGPVGQPK--TIRTTPLLKNPHRPSLYYVNLTGVSVGKIW  533
            FSYCL S    +   S +L +G + +     I TTPL+KNP +PS YY++L G+SVG   
Sbjct  239  FSYCLTSINEDADSTSSTLLMGSMARDDYNNIITTPLVKNPTQPSFYYLSLKGISVGDTQ  298

Query  532  VYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFDTC  359
            + I +   + +     G +IDSGT I+   E A+  +++EF  QV      SS    D C
Sbjct  299  LAIKKSTFSLNKDGSGGMIIDSGTTITYLEESAFSLLKKEFSSQVNLAVDDSSSTGLDLC  358

Query  358  FAV---TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIA  188
            F +   T     P + FHF+G D+ LP EN +I  S   +ACLAM ++     S +++  
Sbjct  359  FKLPSNTNNIQVPKLIFHFEGADMDLPAENYMIADSRMGIACLAMGSS-----SGMSIFG  413

Query  187  NLQQQNLRVLFDTVNSRLGITHENCN  110
            N+QQQN+ V+ D     L    + C+
Sbjct  414  NVQQQNMMVIHDLDKETLSFVPKQCD  439



>ref|XP_009398943.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 101/178 (57%), Gaps = 10/178 (6%)
 Frame = -3

Query  628  PKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIPQEHLTFDPATGAGTVI-DSGTVIS  452
            P +  T PLL+NP   + YYV LTG+SVG   + IP      D +TGAG VI DSGT ++
Sbjct  349  PSSTLTAPLLRNPLLDTFYYVELTGISVGGKMLPIPPSAFAIDESTGAGGVIVDSGTSVT  408

Query  451  RFVEPAYVAIREEFRKQVTG--PFSSLGAFDTCFAVTKE--FMAPPITFHF-QGMDLVLP  287
            R  E AY  +R++F+ Q+    P   +  FDTC+ ++       P + FHF +G  L+LP
Sbjct  409  RLQEAAYATLRDDFQVQMEALPPAERMIPFDTCYNLSSRASVTVPSVAFHFPEGKALLLP  468

Query  286  MENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQQNLRVLFDTVNSRLGITHENC  113
             +N LI  +     CLA A +P       ++I N+QQQ  RV+FD VN R+G T + C
Sbjct  469  AKNYLIPVNDEGTYCLAFAPSP----VAFSIIGNVQQQGTRVIFDLVNDRVGFTPDVC  522



>ref|XP_009801916.1| PREDICTED: aspartic proteinase nepenthesin-1 [Nicotiana sylvestris]
Length=448

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 107/207 (52%), Gaps = 15/207 (7%)
 Frame = -3

Query  700  FSYCLPSFK---SYYFSGSLRLGPVGQPK--TIRTTPLLKNPHRPSLYYVNLTGVSVGKI  536
            FSYCL S     +   S +L +G +       I TTPL+KNP +PS YY++L G+SVG  
Sbjct  245  FSYCLTSINVDANNKISSTLLMGTIANDDHSNIITTPLVKNPSQPSFYYLSLEGISVGDT  304

Query  535  WVYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFDT  362
             + I +   + +     G +IDSGT I+   E A+  +++EF  QV  P   SS    D 
Sbjct  305  QLPIKKSTFSLNQDGSGGVIIDSGTTITYLEESAFSLLKKEFSSQVNLPVDDSSSTGLDL  364

Query  361  CFAV---TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVI  191
            CF +   T     P + FHF+G DL LP +N +I  S   +ACLAM  +     S +++ 
Sbjct  365  CFTLPSNTNNIEVPKLVFHFEGADLDLPADNYMIADSSMGVACLAMGGS-----SGMSIF  419

Query  190  ANLQQQNLRVLFDTVNSRLGITHENCN  110
             N+QQQN+ V+ D     L      C+
Sbjct  420  GNVQQQNMLVIHDLNKETLSFVPTQCD  446



>ref|XP_007051537.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOX95694.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=488

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 100/204 (49%), Gaps = 13/204 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWV-YI  524
            FSYCL    +     SL  G    P+    TPLL NP   + YY+ L G+SVG I V  I
Sbjct  291  FSYCLVDRSASSRPSSLVFGDAAVPRAAMLTPLLTNPKLDTFYYIELLGISVGGIRVPRI  350

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT----GPFSSLGAFDTCF  356
                   D A   G +IDSGT ++R   PAY+A+R+ FR   +     P  SL  FDTCF
Sbjct  351  TPSLFKMDQAGNGGVIIDSGTSVTRLTRPAYIAMRDAFRIGASNLKGAPDFSL--FDTCF  408

Query  355  AVTKE--FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++ +     P +  HF+G D+ LP  N LI        C A A       S L++I N+
Sbjct  409  DLSGKTSVKVPTVVLHFRGADVSLPATNYLIPVDGSGTFCFAFAG----TMSGLSIIGNI  464

Query  181  QQQNLRVLFDTVNSRLGITHENCN  110
            QQQ  RV +D   SR+G T   C 
Sbjct  465  QQQGFRVSYDLAGSRIGFTPRGCE  488



>emb|CDX90023.1| BnaA10g00590D [Brassica napus]
Length=481

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 101/203 (50%), Gaps = 13/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWV-YI  524
            FSYCL    +     S+  G     +T + TPLL NP   + YYV L G+SVG   V  +
Sbjct  284  FSYCLVDRSASSKPSSVVFGNAAVSRTAKFTPLLSNPKLDTFYYVELLGISVGGTRVPGV  343

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT----GPFSSLGAFDTCF  356
                   DP    G +IDSGT ++R V PAY+A+R+ FR         P  SL  FDTCF
Sbjct  344  AASLFKLDPIGNGGVIIDSGTSVTRLVRPAYIAMRDAFRVGAKSLKRAPDYSL--FDTCF  401

Query  355  AVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++   E   P +  HF+G D+ LP  N LI        C A A       S L++I N+
Sbjct  402  DLSHQNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAG----TMSGLSIIGNI  457

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV++D + SR+G     C
Sbjct  458  QQQGFRVVYDLMGSRVGFAPRGC  480



>ref|XP_009119684.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=481

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 101/203 (50%), Gaps = 13/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWV-YI  524
            FSYCL    +     S+  G     +T + TPLL NP   + YYV L G+SVG   V  +
Sbjct  284  FSYCLVDRSASSKPSSVVFGNAAVSRTAKFTPLLSNPKLDTFYYVELLGISVGGTRVPGV  343

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT----GPFSSLGAFDTCF  356
                   DP    G +IDSGT ++R V PAY+A+R+ FR         P  SL  FDTCF
Sbjct  344  AASLFKLDPIGNGGVIIDSGTSVTRLVRPAYIAMRDAFRVGAKSLKRAPDYSL--FDTCF  401

Query  355  AVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++   E   P +  HF+G D+ LP  N LI        C A A       S L++I N+
Sbjct  402  DLSHQNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAG----TMSGLSIIGNI  457

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV++D + SR+G     C
Sbjct  458  QQQGFRVVYDLMGSRVGFAPRGC  480



>ref|XP_004494825.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=473

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 101/203 (50%), Gaps = 13/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY-I  524
            FSYCL    +     S+  G     +T R TPLLKNP   + YY+ L G+SVG   V  +
Sbjct  276  FSYCLVDRSASAKPSSIVFGDSAVSRTARFTPLLKNPKLDTFYYLELLGISVGGAPVRGV  335

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT----GPFSSLGAFDTCF  356
                   DPA   G +IDSGT ++R   PAY+A+R+ FR   +     P  SL  FDTCF
Sbjct  336  SASLFKLDPAGNGGVIIDSGTSVTRLTRPAYIALRDAFRVGASHLKRAPEFSL--FDTCF  393

Query  355  AVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++   E   P +  HF+  D+ LP  N LI        C A A       S L++I N+
Sbjct  394  DLSGLTEVKVPTVVLHFRDSDVSLPATNYLIPVDNSGSFCFAFAG----TMSGLSIIGNI  449

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV++D   SR+G     C
Sbjct  450  QQQGFRVVYDLAGSRVGFAPRGC  472



>ref|XP_009625615.1| PREDICTED: aspartic proteinase nepenthesin-1 [Nicotiana tomentosiformis]
Length=448

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 107/207 (52%), Gaps = 15/207 (7%)
 Frame = -3

Query  700  FSYCLPSFK---SYYFSGSLRLGPVGQPK--TIRTTPLLKNPHRPSLYYVNLTGVSVGKI  536
            FSYCL S     +   S +L +G V       I TTPL KNP +PS YY++L G+SVG  
Sbjct  245  FSYCLTSINDDANSKISSALLMGSVANDDYSNIITTPLAKNPSQPSFYYLSLEGISVGDT  304

Query  535  WVYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFDT  362
             + I +   + +     G +IDSGT I+   E A+  +++EF  Q+  P   SS    D 
Sbjct  305  RLPIKKSTFSLNQDGSGGVIIDSGTTITYLEEGAFKLLKKEFSSQINLPVDDSSSTGLDL  364

Query  361  CFAV---TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVI  191
            CF +   T     P + FHF+G DL LP +N +I  S   +ACLAM ++     S +++ 
Sbjct  365  CFTLPSNTNNIEVPKLVFHFEGADLDLPADNYMIADSSMGVACLAMGSS-----SGMSIF  419

Query  190  ANLQQQNLRVLFDTVNSRLGITHENCN  110
             N+QQQN+ V+ D     L      C+
Sbjct  420  GNVQQQNMLVIHDLDKETLSFVPTQCD  446



>ref|XP_004171805.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Cucumis sativus]
Length=384

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 101/201 (50%), Gaps = 9/201 (4%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY-I  524
            FSYCL    +     S+  G     +T R TPLL NP   + YYV L G+SVG   V  I
Sbjct  187  FSYCLVDRSASSKPSSVVFGNSAVSRTARFTPLLTNPRLDTFYYVELLGISVGGTPVSGI  246

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSS--LGAFDTCFAV  350
               H   D     G +ID GT ++R  +PAY+A+R+ FR   +   S+     FDTC+ +
Sbjct  247  TASHFKLDRTGNGGVIIDCGTSVTRLNKPAYIALRDAFRAGASSLKSAPEFSLFDTCYDL  306

Query  349  TKE--FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQ  176
            + +     P +  HF+G D+ LP  N LI        C A A       S L++I N+QQ
Sbjct  307  SGKTTVKVPTVVLHFRGADVSLPASNYLIPVDGSGRFCFAFAG----TTSGLSIIGNIQQ  362

Query  175  QNLRVLFDTVNSRLGITHENC  113
            Q  RV++D  +SR+G +   C
Sbjct  363  QGFRVVYDLASSRVGFSPRGC  383



>ref|XP_009106694.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Brassica 
rapa]
Length=487

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 114/206 (55%), Gaps = 19/206 (9%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            GVFSYCLPS +    SGSL  G      ++  TPL++NP   S Y +NLTG ++G + + 
Sbjct  293  GVFSYCLPSLEDGA-SGSLSFGDYKNSTSVSYTPLVQNPQLRSFYILNLTGATIGGVELE  351

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLG--AFDTCFA  353
                     P+ G G +IDSGTVI+R     Y A++ EF KQ TG  S+ G    DTCF 
Sbjct  352  --------SPSFGRGIIIDSGTVITRLPPSIYKAVKTEFLKQFTGFSSAPGYSILDTCFN  403

Query  352  VT--KEFMAPPITFHFQGMDLVLPMENTLIH---TSYGNLACLAMAAAPNNVNSVLNVIA  188
            +T  ++   P I   FQG D VL ++ T +        +L CLA A+   +  + + +I 
Sbjct  404  LTSYEDVSIPTIKMIFQG-DAVLEVDVTGVFYYVNPDASLVCLAFASL--SYENEVGIIG  460

Query  187  NLQQQNLRVLFDTVNSRLGITHENCN  110
            N QQ+N RV++DT   +LGI  ENC+
Sbjct  461  NYQQKNQRVIYDTKQEKLGIAGENCS  486



>gb|ABK24493.1| unknown [Picea sitchensis]
Length=479

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 111/209 (53%), Gaps = 23/209 (11%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G FSYCLP F S   +GS  +G    P T    PL+ N + PS Y+V L G+SVG     
Sbjct  281  GQFSYCLPDFVSSTSTGSFSVGQGSIPATATFVPLVSNSNYPSFYFVGLNGISVGG----  336

Query  526  IPQEHLTFDPAT--GAGTVIDSGTVISRFVEPAYVAIREEFRKQV-----TGPFSSLGAF  368
               E L+  PA     GT++DSGTVI+R V  AY A++  FR +        PFS L   
Sbjct  337  ---ERLSIPPAVLGRGGTIVDSGTVITRLVPQAYDALKTSFRSKTRNLPSAKPFSIL---  390

Query  367  DTCFAVT--KEFMAPPITFHFQ-GMDLVLPMENTLIH-TSYGNLACLAMAAAPNNVNSVL  200
            DTC+ ++   +   P ITFHFQ   D+ +     L    S G+  CLA A+A  ++++  
Sbjct  391  DTCYDLSSYSQVRIPTITFHFQNNADVAVSAVGILFTIQSDGSQVCLAFASASQSIST--  448

Query  199  NVIANLQQQNLRVLFDTVNSRLGITHENC  113
            N+I N QQQ +RV FDT   R+G    +C
Sbjct  449  NIIGNFQQQRMRVAFDTGAGRIGFAPGSC  477



>ref|XP_008437888.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=474

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 101/201 (50%), Gaps = 9/201 (4%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY-I  524
            FSYCL    +     S+  G     +T R TPLL NP   + YYV L G+SVG   V  I
Sbjct  277  FSYCLVDRSASSKPSSVVFGNSAVSRTARFTPLLTNPRLDTFYYVELLGISVGGTPVSGI  336

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSS--LGAFDTCFAV  350
               H   D     G +ID GT ++R  +PAY+A+R+ FR   +   S+     FDTC+ +
Sbjct  337  SSSHFKLDRTGNGGVIIDCGTSVTRLNKPAYIALRDAFRAGASSLKSAPEFSLFDTCYDL  396

Query  349  TKE--FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQ  176
            + +     P +  HF+G D+ LP  N LI        C A A       S L++I N+QQ
Sbjct  397  SGKTTVKVPTVVLHFRGADVSLPASNYLIPVDGSGRFCFAFAG----TTSGLSIIGNIQQ  452

Query  175  QNLRVLFDTVNSRLGITHENC  113
            Q  RV++D  +SR+G +   C
Sbjct  453  QGFRVVYDLASSRVGFSPRGC  473



>ref|XP_006339720.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=480

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 98/203 (48%), Gaps = 13/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWV-YI  524
            FSYCL    +      L  G     +T   TPL+ NP   + YYV LTG+SVG   V  I
Sbjct  283  FSYCLVDRSASSRPSYLVFGESAVSRTAVFTPLVNNPKLDTFYYVELTGISVGGARVPAI  342

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV----TGPFSSLGAFDTCF  356
                   D A   G ++DSGT ++R   PAYVA+R+ FR         P  SL  FDTCF
Sbjct  343  RPSLFKLDAAGDGGVIVDSGTSVTRLTRPAYVALRDSFRMGARDLKRAPDFSL--FDTCF  400

Query  355  AVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++   E   P +  HF+G D+ LP  N LI        C A A       S L++I N+
Sbjct  401  DLSGKTEVKVPTVVMHFRGADVSLPASNYLIPVDSDGTFCFAFAG----TMSGLSIIGNI  456

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV+FD   SRLG     C
Sbjct  457  QQQGFRVVFDLAGSRLGFAPRGC  479



>ref|XP_010099762.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB80380.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=457

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 109/212 (51%), Gaps = 20/212 (9%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPV-----GQPKTI---RTTPLLKNPHRPSLYYVNLTGVSV  545
            FSYCL S      + SL +G +     G+  T    +TTPL+KNP +PS YY++L G+SV
Sbjct  249  FSYCLTSMADDSKTSSLLMGSLATKMGGKNDTSFEGKTTPLIKNPSQPSFYYLSLEGISV  308

Query  544  GKIWVYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF----SSL  377
            G   + I +   +       G +IDSGT I+      +  +++EF  Q+ G      S  
Sbjct  309  GDRLLDIEKGTFSIKEDGSGGLIIDSGTTITYLEHKGFDVLKKEFVSQMKGILSVDNSGS  368

Query  376  GAFDTCFAV---TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNS  206
             A D CF +   TK    P + FHF+G DL LP EN ++  S   + CLAM A+     S
Sbjct  369  QAMDLCFNLPKGTKTVQVPKLVFHFKGADLELPPENYILSDSDLGVLCLAMGAS-----S  423

Query  205  VLNVIANLQQQNLRVLFDTVNSRLGITHENCN  110
             +++  N+QQQNL V+ D  N RL      C+
Sbjct  424  GMSIFGNIQQQNLLVVHDLENERLSFVPTQCD  455



>emb|CDP08669.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 99/203 (49%), Gaps = 13/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWV-YI  524
            FSYCL    S     S+  G     +T   TPLL NP   + YYV L G+SVG   V  I
Sbjct  290  FSYCLVDRSSSSRPSSIVFGESSVSRTSVFTPLLTNPKLDTFYYVGLNGISVGGSRVPGI  349

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT----GPFSSLGAFDTCF  356
             + H   D A   G ++DSGT ++R   PAY+A+R+ FR   +     P  SL  FDTCF
Sbjct  350  TESHFKLDAAGNGGVIVDSGTSVTRLTRPAYIAMRDAFRAGASNLRRAPDFSL--FDTCF  407

Query  355  AVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++   E   P +  HF G D+ LP  N LI        C A A       S L++I N+
Sbjct  408  DLSGKTEVKVPTVVLHFNGADVSLPASNYLIPVDGNGRFCFAFAG----TISGLSIIGNI  463

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV FD   SR+G     C
Sbjct  464  QQQGFRVSFDLAGSRVGFAPRGC  486



>ref|XP_004144695.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase nepenthesin-1-like, 
partial [Cucumis sativus]
Length=716

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 108/208 (52%), Gaps = 17/208 (8%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQ--PKT----IRTTPLLKNPHRPSLYYVNLTGVSVGK  539
            F+YCL +      S SL LG +    PKT    ++TTPL+KNP +PS YY++L G+SVG 
Sbjct  513  FAYCLTAIDDSKPS-SLLLGSLANITPKTSKDEMKTTPLIKNPSQPSFYYLSLQGISVGG  571

Query  538  IWVYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFD  365
              + IP+           G +IDSGT I+     A+ +++ EF  Q+  P   S  G  D
Sbjct  572  TQLSIPKSTFELHDDGSGGVIIDSGTTITYVENSAFTSLKNEFIAQMNLPVDDSGTGGLD  631

Query  364  TCF---AVTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNV  194
             CF   A T +   P +TFHF+G DL LP EN +I  S   L CLA+ ++       +++
Sbjct  632  LCFNLPAGTNQVEVPKLTFHFKGADLELPGENYMIGDSKAGLLCLAIGSSRG-----MSI  686

Query  193  IANLQQQNLRVLFDTVNSRLGITHENCN  110
              NLQQQN  V+ D     L      C+
Sbjct  687  FGNLQQQNFMVVHDLQEETLSFLPTQCD  714



>ref|XP_008442220.1| PREDICTED: aspartic proteinase nepenthesin-1 [Cucumis melo]
Length=461

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 107/208 (51%), Gaps = 17/208 (8%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQ--PKT----IRTTPLLKNPHRPSLYYVNLTGVSVGK  539
            F+YCL +      S SL LG +    PKT    ++ TPL+KNP +PS YY++L G+SVG 
Sbjct  258  FAYCLTAIDDSKPS-SLLLGSLANITPKTSKDEMKATPLIKNPSQPSFYYLSLQGISVGG  316

Query  538  IWVYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFD  365
              + IP+           G +IDSGT I+     A+ +++ EF  Q+  P   S  G  D
Sbjct  317  TQLSIPKSTFELHDDGSGGVIIDSGTTITYIESTAFSSLKNEFIAQMNLPVDDSGTGGLD  376

Query  364  TCF---AVTKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNV  194
             CF   A T +   P +TFHF+G DL LP EN +I  S   L CLA+ ++       +++
Sbjct  377  LCFNLPAGTTQVEVPKLTFHFKGADLELPGENYMIGDSKTGLLCLAIGSSRG-----MSI  431

Query  193  IANLQQQNLRVLFDTVNSRLGITHENCN  110
              NLQQQN  V+ D     L      C+
Sbjct  432  FGNLQQQNFMVVHDLQEETLSFLPTQCD  459



>ref|XP_004133810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=471

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 101/201 (50%), Gaps = 9/201 (4%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY-I  524
            FSYCL    +     S+  G     +T R TPLL NP   + YYV L G+SVG   V  I
Sbjct  274  FSYCLVDRSASSKPSSVVFGNSAVSRTARFTPLLTNPRLDTFYYVELLGISVGGTPVSGI  333

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSS--LGAFDTCFAV  350
               H   D     G +ID GT ++R  +PAY+A+R+ FR   +   S+     FDTC+ +
Sbjct  334  TASHFKLDRTGNGGVIIDCGTSVTRLNKPAYIALRDAFRAGASSLKSAPEFSLFDTCYDL  393

Query  349  TKE--FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQ  176
            + +     P +  HF+G D+ LP  N LI        C A A       S L++I N+QQ
Sbjct  394  SGKTTVKVPTVVLHFRGADVSLPASNYLIPVDGSGRFCFAFAG----TTSGLSIIGNIQQ  449

Query  175  QNLRVLFDTVNSRLGITHENC  113
            Q  RV++D  +SR+G +   C
Sbjct  450  QGFRVVYDLASSRVGFSPRGC  470



>gb|KGN56421.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=512

 Score =   123 bits (308),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 101/201 (50%), Gaps = 9/201 (4%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY-I  524
            FSYCL    +     S+  G     +T R TPLL NP   + YYV L G+SVG   V  I
Sbjct  315  FSYCLVDRSASSKPSSVVFGNSAVSRTARFTPLLTNPRLDTFYYVELLGISVGGTPVSGI  374

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSS--LGAFDTCFAV  350
               H   D     G +ID GT ++R  +PAY+A+R+ FR   +   S+     FDTC+ +
Sbjct  375  TASHFKLDRTGNGGVIIDCGTSVTRLNKPAYIALRDAFRAGASSLKSAPEFSLFDTCYDL  434

Query  349  TKE--FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQ  176
            + +     P +  HF+G D+ LP  N LI        C A A       S L++I N+QQ
Sbjct  435  SGKTTVKVPTVVLHFRGADVSLPASNYLIPVDGSGRFCFAFAG----TTSGLSIIGNIQQ  490

Query  175  QNLRVLFDTVNSRLGITHENC  113
            Q  RV++D  +SR+G +   C
Sbjct  491  QGFRVVYDLASSRVGFSPRGC  511



>gb|ACN40790.1| unknown [Picea sitchensis]
Length=452

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 114/201 (57%), Gaps = 13/201 (6%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G FSYCLPS  +   S  L         +++ T L+K+P  P+ Y+V L  +SVG   + 
Sbjct  258  GTFSYCLPSSSTSSGSLVLGKEAAVSSSSLKFTTLIKDPSFPTFYFVTLKAISVGNTRIS  317

Query  526  IPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG-PFSSLGAFDTCFAV  350
            +P  ++    A+G GT+IDSGT I+  V  AY  +R+ FR+Q++    + +   DTC+ +
Sbjct  318  VPATNI----ASGGGTIIDSGTTITYLVPSAYKDLRDAFRQQLSSLQPTPVEDMDTCYDL  373

Query  349  TKEFM-APPITFHF-QGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQ  176
            +   +  P IT H  + +DLVLP EN LI    G L+CLA ++  +      ++I N+QQ
Sbjct  374  SSSSVDVPTITLHLDRNVDLVLPKENILITQESG-LSCLAFSSTDSR-----SIIGNVQQ  427

Query  175  QNLRVLFDTVNSRLGITHENC  113
            QN R++FD  NS++G   E C
Sbjct  428  QNWRIVFDVPNSQVGFAQEQC  448



>ref|XP_004139658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004154449.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN44550.1| hypothetical protein Csa_7G329350 [Cucumis sativus]
Length=453

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 73/203 (36%), Positives = 100/203 (49%), Gaps = 13/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY-I  524
            FSYCL    +     S+  G     +  R TPL++NP   + YYV L G+SVG + V  +
Sbjct  256  FSYCLVDRSASSKPSSMVFGDAAISRLARFTPLIRNPKLDTFYYVGLIGISVGGVRVRGV  315

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQV----TGPFSSLGAFDTCF  356
                   D A   G +IDSGT ++R   PAY A+R+ FR        GP  SL  FDTC+
Sbjct  316  SPSLFKLDSAGNGGVIIDSGTSVTRLTRPAYTALRDAFRVGARHLKRGPEFSL--FDTCY  373

Query  355  AVTKE--FMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++ +     P +  HF+G D+ LP  N LI        C A A       S L++I N+
Sbjct  374  DLSGQSSVKVPTVVLHFRGADMALPATNYLIPVDENGSFCFAFAG----TISGLSIIGNI  429

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV++D   SR+G     C
Sbjct  430  QQQGFRVVYDLAGSRIGFAPRGC  452



>ref|XP_002523337.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF39053.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=469

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 98/203 (48%), Gaps = 13/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWV-YI  524
            FSYCL    +     S+  G     +T R TPL+ NP   + YYV L G+SVG   V  I
Sbjct  272  FSYCLVDRSASSKPSSMVFGDSAVSRTARFTPLVSNPKLDTFYYVELLGISVGGTRVPGI  331

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT----GPFSSLGAFDTCF  356
                   D     G +IDSGT ++R   PAY+A R+ FR   +     P  SL  FDTCF
Sbjct  332  TASLFKLDQTGNGGVIIDSGTSVTRLTRPAYIAFRDAFRAGASNLKRAPQFSL--FDTCF  389

Query  355  AVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++   E   P +  HF+G D+ LP  N LI        CLA A         L++I N+
Sbjct  390  DLSGKTEVKVPTVVLHFRGADVSLPASNYLIPVDTSGNFCLAFAGTMGG----LSIIGNI  445

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV++D   SR+G     C
Sbjct  446  QQQGFRVVYDLAGSRVGFAPHGC  468



>ref|XP_004229990.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=500

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 98/203 (48%), Gaps = 13/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWV-YI  524
            FSYCL    +      L  G     +T   TPL+KNP   + YYV LTG SVG   V  I
Sbjct  303  FSYCLVDRSASSKPSYLVFGESAVSRTAVFTPLVKNPKLDTFYYVELTGFSVGGARVPAI  362

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVT----GPFSSLGAFDTCF  356
                   D A   G ++DSGT ++R   PAYVA+R+ FR         P  SL  FDTCF
Sbjct  363  RPSLFKLDAAGDGGVIVDSGTSVTRLTRPAYVALRDAFRMGAKDLKRAPDFSL--FDTCF  420

Query  355  AVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
             ++   E   P +  HF+G D+ LP  N LI        C A A       S L++I N+
Sbjct  421  DLSGKTEVKVPTVVMHFRGADVSLPASNYLIPVDSDGTFCFAFAG----TMSGLSIIGNI  476

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV+FD   +RLG     C
Sbjct  477  QQQGFRVVFDLAGNRLGFAPRGC  499



>ref|XP_006852628.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
 gb|ERN14095.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
Length=489

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 102/201 (51%), Gaps = 10/201 (5%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVYIP  521
            FSYCL   +S    GSL  G +  P T   T ++KNP   + YY+ L G+SVG   + I 
Sbjct  293  FSYCLTD-RSSPSPGSLSFGNLPNPSTTVFTTMIKNPKLDTFYYLGLVGISVGGARLPIS  351

Query  520  QEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTG-PFS-SLGAFDTCFAVT  347
                  DP    G ++DSGT ++R V  AY  +R+ FR   TG P + S   FDTC+ + 
Sbjct  352  SSLFRLDPTGNGGVIVDSGTSVTRLVSSAYDVVRDAFRAGATGLPLADSFSLFDTCYNLG  411

Query  346  KE--FMAPPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANLQQ  176
                   P + FHF  G DL LP  N LI  +   + C A A       S L++I N+QQ
Sbjct  412  GRDVVKVPTMVFHFDGGADLSLPASNYLIPVNNQGVFCFAFAG----TRSGLSIIGNIQQ  467

Query  175  QNLRVLFDTVNSRLGITHENC  113
            Q   V+FD  NSR+G   + C
Sbjct  468  QGFSVVFDGKNSRIGFVPKGC  488



>ref|XP_010556596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=467

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 102/207 (49%), Gaps = 17/207 (8%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIWVY  527
            G FSYCL    +     S+  G     +T R TP+L NP   + YYV L G+SVG   V 
Sbjct  268  GKFSYCLVDRSATSKPSSIVFGDASVSRTARFTPMLLNPKLDTFYYVELLGISVGGTRVP  327

Query  526  IPQEHLTFDPATGAGTVI-DSGTVISRFVEPAYVAIREEFR------KQVTGPFSSLGAF  368
                 L     TG G VI DSGT ++R   PAY+A+R+ FR      K+ T    S   F
Sbjct  328  GVSASLFKLAQTGNGGVILDSGTSVTRLTRPAYIAMRDAFRVGAKNLKRAT----SFSLF  383

Query  367  DTCFAVT--KEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNV  194
            DTCF ++   E   P +  HF+G D+ LP  N LI        C A A   +     L++
Sbjct  384  DTCFDLSGLTEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGTASG----LSI  439

Query  193  IANLQQQNLRVLFDTVNSRLGITHENC  113
            I N+QQQ  RV++D V SR+G     C
Sbjct  440  IGNIQQQGFRVVYDLVGSRVGFAPRGC  466



>gb|EMT01748.1| Aspartic proteinase nepenthesin-1 [Aegilops tauschii]
Length=435

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 105/211 (50%), Gaps = 17/211 (8%)
 Frame = -3

Query  706  GVFSYCLPSFKSYYFSGSLRLGPVG--QPKTIRTTPLLKNPHRPSL---YYVNLTGVSVG  542
            G+FSYCL  F+    +  L LGP        +RTTP + +P +  +   YY+NLTG+SVG
Sbjct  228  GMFSYCLTPFQDANSTSMLLLGPSAALNGTGVRTTPFVASPSKAPMSTYYYLNLTGISVG  287

Query  541  KIWVYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF---SSLGA  371
               + IP            G +IDSGT I+  V+ AY  +R   +  VT P    S    
Sbjct  288  TTALSIPPNAFALRADGTGGLIIDSGTTITSLVDAAYQQVRAAIKSLVTLPVADGSDSTG  347

Query  370  FDTCFAVTKEFMAPP----ITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSV  203
             D CFA+T E   PP    +T HF G D+VLP+EN +I  S   + CLAM    N     
Sbjct  348  LDLCFALTSETSTPPSMPSMTLHFDGADMVLPVENYMILGS--GVWCLAMR---NQTIGA  402

Query  202  LNVIANLQQQNLRVLFDTVNSRLGITHENCN  110
            ++ + N QQQN+ +L+D     L      C+
Sbjct  403  MSTLGNYQQQNVHLLYDIHKETLSFAPAKCS  433



>ref|XP_003523200.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Glycine max]
 gb|KHN31204.1| Aspartic proteinase nepenthesin-1 [Glycine soja]
Length=453

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/206 (37%), Positives = 109/206 (53%), Gaps = 16/206 (8%)
 Frame = -3

Query  700  FSYCL----PSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSVGKIW  533
            FSYCL     + +S    GSL  G V   K + TTPLLKNP +PS YY++L G+SVG   
Sbjct  253  FSYCLTPMDDTKESILLLGSL--GKVKDAKEVVTTPLLKNPLQPSFYYLSLEGISVGDTR  310

Query  532  VYIPQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPF--SSLGAFDTC  359
            + I +           G +IDSGT I+   + A+ A+++EF  Q   P   +S    D C
Sbjct  311  LSIEKSTFEVGDDGNGGVIIDSGTTITYIEQKAFEALKKEFISQTKLPLDKTSSTGLDLC  370

Query  358  FAV---TKEFMAPPITFHFQGMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIA  188
            F++   + +   P I FHF+G DL LP EN +I  S   +ACLAM A+     S +++  
Sbjct  371  FSLPSGSTQVEIPKIVFHFKGGDLELPAENYMIGDSNLGVACLAMGAS-----SGMSIFG  425

Query  187  NLQQQNLRVLFDTVNSRLGITHENCN  110
            N+QQQN+ V  D     +     +C+
Sbjct  426  NVQQQNILVNHDLEKETISFVPTSCD  451



>gb|ABK24467.1| unknown [Picea sitchensis]
Length=497

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 102/203 (50%), Gaps = 12/203 (6%)
 Frame = -3

Query  700  FSYCLPSFKSYYFSGSLRLGPVGQPKTIRTTPLLKNPHRPSLYYVNLTGVSV-GKIWVYI  524
            FSYCL    +   + SL  G    PK+   TPLL NP   + YYV L G+SV G+    I
Sbjct  298  FSYCLVDRSASGTASSLIFGKAAIPKSAIFTPLLSNPKLDTFYYVELVGISVGGRRLTSI  357

Query  523  PQEHLTFDPATGAGTVIDSGTVISRFVEPAYVAIREEFRKQVTGPFSSLGA---FDTCFA  353
            P      D     G +IDSGT ++R V+ AY  +R+ FR   TG   S G    FDTC+ 
Sbjct  358  PASVFRMDATGNGGVIIDSGTSVTRLVDSAYSTMRDAFRVG-TGNLKSAGGFSLFDTCYD  416

Query  352  VT--KEFMAPPITFHFQ-GMDLVLPMENTLIHTSYGNLACLAMAAAPNNVNSVLNVIANL  182
            ++  K    P + FHFQ G  + LP  N LI        C A A         L++I N+
Sbjct  417  LSGLKTVKVPTLVFHFQGGAHISLPATNYLIPVDSSATFCFAFAGNTGG----LSIIGNI  472

Query  181  QQQNLRVLFDTVNSRLGITHENC  113
            QQQ  RV+FD++ +R+G    +C
Sbjct  473  QQQGYRVVFDSLANRVGFKAGSC  495



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365