BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF037M24

Length=593
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010316906.1|  PREDICTED: carboxyl-terminal-processing pept...    150   2e-40   
ref|XP_006355597.1|  PREDICTED: C-terminal processing peptidase, ...    153   2e-40   Solanum tuberosum [potatoes]
ref|XP_010316905.1|  PREDICTED: carboxyl-terminal-processing pept...    150   2e-39   Solanum lycopersicum
ref|XP_011096495.1|  PREDICTED: carboxyl-terminal-processing pept...    147   4e-38   Sesamum indicum [beniseed]
gb|KCW73749.1|  hypothetical protein EUGRSUZ_E023602                    142   5e-38   Eucalyptus grandis [rose gum]
emb|CDP17322.1|  unnamed protein product                                146   8e-38   Coffea canephora [robusta coffee]
ref|XP_010243686.1|  PREDICTED: carboxyl-terminal-processing pept...    145   2e-37   Nelumbo nucifera [Indian lotus]
gb|AAL99045.1|AF487527_1  D1 protease-like protein precursor            145   2e-37   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009614038.1|  PREDICTED: carboxyl-terminal-processing pept...    145   2e-37   Nicotiana tomentosiformis
ref|XP_010056858.1|  PREDICTED: carboxyl-terminal-processing pept...    142   1e-36   
ref|XP_009785926.1|  PREDICTED: carboxyl-terminal-processing pept...    143   2e-36   Nicotiana sylvestris
ref|XP_006449623.1|  hypothetical protein CICLE_v10018134mg             142   4e-36   
ref|XP_006467532.1|  PREDICTED: C-terminal processing peptidase, ...    142   4e-36   Citrus sinensis [apfelsine]
gb|KDO78060.1|  hypothetical protein CISIN_1g012084mg                   141   4e-36   Citrus sinensis [apfelsine]
gb|KFK31469.1|  hypothetical protein AALP_AA6G116300                    141   6e-36   Arabis alpina [alpine rockcress]
ref|XP_006398333.1|  hypothetical protein EUTSA_v10001155mg             141   8e-36   Eutrema salsugineum [saltwater cress]
ref|XP_010538513.1|  PREDICTED: carboxyl-terminal-processing pept...    140   1e-35   Tarenaya hassleriana [spider flower]
gb|KJB57304.1|  hypothetical protein B456_009G157600                    137   2e-35   Gossypium raimondii
gb|KJB57305.1|  hypothetical protein B456_009G157600                    137   2e-35   Gossypium raimondii
emb|CDY35162.1|  BnaA09g17990D                                          139   2e-35   Brassica napus [oilseed rape]
ref|NP_974893.1|  peptidase S41 family protein                          139   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114354.1|  PREDICTED: carboxyl-terminal-processing pept...    139   3e-35   Brassica rapa
emb|CDY03220.1|  BnaC09g19360D                                          139   4e-35   
ref|XP_007025177.1|  Peptidase S41 family protein isoform 1             139   4e-35   
ref|XP_002865196.1|  peptidase S41 family protein                       139   4e-35   
gb|AFK39374.1|  unknown                                                 138   6e-35   Medicago truncatula
ref|XP_003629901.1|  Carboxyl-terminal-processing protease              138   6e-35   Medicago truncatula
ref|XP_002271932.1|  PREDICTED: carboxyl-terminal-processing pept...    138   7e-35   Vitis vinifera
emb|CBI30818.3|  unnamed protein product                                138   8e-35   Vitis vinifera
ref|XP_010441586.1|  PREDICTED: carboxyl-terminal-processing pept...    138   9e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010441587.1|  PREDICTED: carboxyl-terminal-processing pept...    138   9e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010481459.1|  PREDICTED: carboxyl-terminal-processing pept...    138   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010494810.1|  PREDICTED: carboxyl-terminal-processing pept...    138   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010494809.1|  PREDICTED: carboxyl-terminal-processing pept...    138   1e-34   Camelina sativa [gold-of-pleasure]
gb|KDP21204.1|  hypothetical protein JCGZ_21675                         137   1e-34   Jatropha curcas
ref|XP_006280370.1|  hypothetical protein CARUB_v10026297mg             137   1e-34   Capsella rubella
gb|KJB57306.1|  hypothetical protein B456_009G157600                    137   2e-34   Gossypium raimondii
gb|KJB57308.1|  hypothetical protein B456_009G157600                    137   2e-34   Gossypium raimondii
ref|XP_006580200.1|  PREDICTED: C-terminal processing peptidase, ...    136   2e-34   
ref|XP_007159532.1|  hypothetical protein PHAVU_002G245300g             136   2e-34   Phaseolus vulgaris [French bean]
gb|KJB57307.1|  hypothetical protein B456_009G157600                    137   2e-34   Gossypium raimondii
gb|KHN06461.1|  Carboxyl-terminal-processing protease                   136   3e-34   Glycine soja [wild soybean]
ref|XP_011045312.1|  PREDICTED: carboxyl-terminal-processing pept...    136   3e-34   Populus euphratica
ref|XP_006580201.1|  PREDICTED: C-terminal processing peptidase, ...    136   3e-34   
ref|XP_011045311.1|  PREDICTED: carboxyl-terminal-processing pept...    136   3e-34   Populus euphratica
ref|XP_002316739.1|  peptidase S41 family protein                       136   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004504235.1|  PREDICTED: carboxyl-terminal-processing prot...    135   6e-34   Cicer arietinum [garbanzo]
ref|XP_007213023.1|  hypothetical protein PRUPE_ppa023076mg             134   2e-33   Prunus persica
ref|XP_010926337.1|  PREDICTED: carboxyl-terminal-processing pept...    132   2e-33   
ref|XP_008225367.1|  PREDICTED: C-terminal processing peptidase, ...    133   4e-33   Prunus mume [ume]
ref|XP_004295422.1|  PREDICTED: carboxyl-terminal-processing pept...    133   6e-33   Fragaria vesca subsp. vesca
ref|XP_008443944.1|  PREDICTED: C-terminal processing peptidase, ...    132   2e-32   Cucumis melo [Oriental melon]
ref|XP_010926329.1|  PREDICTED: carboxyl-terminal-processing pept...    131   2e-32   
ref|XP_010926312.1|  PREDICTED: carboxyl-terminal-processing pept...    131   2e-32   
ref|XP_010926256.1|  PREDICTED: carboxyl-terminal-processing pept...    131   2e-32   Elaeis guineensis
ref|XP_010926294.1|  PREDICTED: carboxyl-terminal-processing pept...    131   3e-32   Elaeis guineensis
ref|XP_010926320.1|  PREDICTED: carboxyl-terminal-processing pept...    131   3e-32   
ref|XP_002519743.1|  Carboxyl-terminal-processing protease precur...    131   3e-32   
ref|XP_008364177.1|  PREDICTED: C-terminal processing peptidase, ...    130   3e-32   
ref|XP_009406283.1|  PREDICTED: carboxyl-terminal-processing pept...    130   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004147402.1|  PREDICTED: carboxyl-terminal-processing prot...    130   6e-32   Cucumis sativus [cucumbers]
ref|XP_009406285.1|  PREDICTED: carboxyl-terminal-processing pept...    130   6e-32   
gb|EPS62840.1|  hypothetical protein M569_11946                         129   1e-31   Genlisea aurea
ref|XP_008797514.1|  PREDICTED: carboxyl-terminal-processing pept...    129   1e-31   Phoenix dactylifera
ref|XP_006646179.1|  PREDICTED: C-terminal processing peptidase, ...    127   6e-31   Oryza brachyantha
ref|XP_010666703.1|  PREDICTED: carboxyl-terminal-processing pept...    127   7e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001043789.2|  Os01g0664000                                       125   2e-30   
gb|AIA26575.1|  serine protease                                         125   2e-30   Cicer arietinum [garbanzo]
gb|EAZ12995.1|  hypothetical protein OsJ_02915                          125   2e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD72341.1|  carboxy-terminal proteinase-like                       125   3e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010243687.1|  PREDICTED: carboxyl-terminal-processing pept...    125   4e-30   Nelumbo nucifera [Indian lotus]
ref|XP_002456095.1|  hypothetical protein SORBIDRAFT_03g030380          124   1e-29   Sorghum bicolor [broomcorn]
gb|AAL99044.1|AF487526_1  D1 protease-like protein precursor            122   2e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004969441.1|  PREDICTED: C-terminal processing peptidase, ...    122   4e-29   Setaria italica
gb|ACG26821.1|  carboxyl-terminal-processing protease precursor         122   4e-29   Zea mays [maize]
ref|XP_003569507.1|  PREDICTED: carboxyl-terminal-processing pept...    120   2e-28   Brachypodium distachyon [annual false brome]
ref|XP_010538514.1|  PREDICTED: carboxyl-terminal-processing pept...    120   2e-28   Tarenaya hassleriana [spider flower]
gb|AFW56122.1|  putative NAC domain transcription factor superfam...    120   3e-28   
dbj|BAB11094.1|  carboxy-terminal proteinase D1-like protein            119   4e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KCW73750.1|  hypothetical protein EUGRSUZ_E023602                    116   5e-28   Eucalyptus grandis [rose gum]
gb|EMS58174.1|  Carboxyl-terminal-processing protease                   114   6e-28   Triticum urartu
gb|KDO78061.1|  hypothetical protein CISIN_1g012084mg                   119   6e-28   Citrus sinensis [apfelsine]
gb|KHG18570.1|  Carboxyl-terminal-processing protease                   117   2e-27   Gossypium arboreum [tree cotton]
gb|ABR16649.1|  unknown                                                 116   6e-27   Picea sitchensis
gb|ABR16660.1|  unknown                                                 115   6e-27   Picea sitchensis
ref|XP_010100991.1|  Carboxyl-terminal-processing protease              114   2e-26   
ref|XP_002965587.1|  hypothetical protein SELMODRAFT_143443             109   4e-25   
ref|XP_001775798.1|  predicted protein                                  110   4e-25   
emb|CAA62434.1|  C-terminal peptidase of the D1 protein                 107   4e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002994603.1|  hypothetical protein SELMODRAFT_432513             104   5e-23   
ref|XP_001760142.1|  predicted protein                                  102   2e-22   
ref|XP_002968066.1|  hypothetical protein SELMODRAFT_33876              102   2e-22   
ref|XP_007025178.1|  Peptidase S41 family protein isoform 2             102   5e-22   
ref|XP_007511360.1|  predicted protein                                99.0    2e-20   Bathycoccus prasinos
ref|XP_002946313.1|  hypothetical protein VOLCADRAFT_86465            99.0    5e-20   Volvox carteri f. nagariensis
ref|XP_003079056.1|  peptidase S41 family protein (ISS)               94.7    1e-19   
ref|XP_002506449.1|  predicted protein                                95.1    1e-19   Micromonas commoda
ref|XP_005847877.1|  hypothetical protein CHLNCDRAFT_145217           95.5    2e-19   Chlorella variabilis
emb|CEF97765.1|  Interphotoreceptor retinol-binding                   94.7    2e-19   Ostreococcus tauri
ref|XP_003063156.1|  predicted protein                                92.4    6e-19   Micromonas pusilla CCMP1545
ref|XP_001696273.1|  tail-specific protease                           95.1    6e-19   Chlamydomonas reinhardtii
ref|XP_001417628.1|  D1 proceesing peptidase                          93.2    9e-19   Ostreococcus lucimarinus CCE9901
ref|XP_005652247.1|  ClpP/crotonase                                   92.8    1e-18   Coccomyxa subellipsoidea C-169
ref|XP_011399412.1|  Carboxyl-terminal-processing protease            91.3    1e-17   Auxenochlorella protothecoides
ref|XP_005706724.1|  carboxyl-terminal processing protease            89.4    3e-17   Galdieria sulphuraria
ref|WP_011378408.1|  MULTISPECIES: peptidase S41                      88.2    4e-17   Synechococcus
ref|WP_006511217.1|  C-terminal processing peptidase                  87.0    1e-16   Xenococcus sp. PCC 7305
ref|WP_011244082.1|  peptidase S41                                    86.7    1e-16   Synechococcus elongatus
ref|WP_026082444.1|  carboxyl-terminal protease                       85.9    3e-16   Mastigocladopsis repens
ref|WP_040654924.1|  carboxyl-terminal protease                       85.9    3e-16   Rubidibacter lacunae
ref|WP_041034080.1|  carboxyl-terminal protease                       85.9    3e-16   Tolypothrix campylonemoides
gb|ERN42743.1|  C-terminal peptidase (prc)                            85.9    3e-16   Rubidibacter lacunae KORDI 51-2
ref|WP_028090602.1|  carboxyl-terminal protease                       84.3    9e-16   Dolichospermum circinale
ref|WP_035367839.1|  carboxyl-terminal protease                       84.3    9e-16   Dolichospermum circinale
ref|WP_044291752.1|  carboxyl-terminal protease                       84.0    1e-15   Rivularia sp. PCC 7116
ref|WP_042153271.1|  carboxyl-terminal protease                       84.0    1e-15   Planktothrix agardhii
gb|AFY54937.1|  C-terminal processing peptidase-2                     84.0    1e-15   Rivularia sp. PCC 7116
ref|WP_015169836.1|  C-terminal processing peptidase                  84.0    1e-15   Synechococcus sp. PCC 7502
ref|WP_026788871.1|  carboxyl-terminal protease                       83.6    1e-15   Planktothrix rubescens
ref|WP_009149164.1|  peptidase S41                                    83.6    1e-15   Moorea producens
ref|WP_026794530.1|  MULTISPECIES: carboxyl-terminal protease         83.6    2e-15   Planktothrix
ref|WP_026797118.1|  MULTISPECIES: carboxyl-terminal protease         83.6    2e-15   Planktothrix
ref|WP_016866280.1|  peptidase S41                                    83.2    2e-15   Fischerella muscicola
ref|WP_009456991.1|  MULTISPECIES: peptidase S41                      83.2    2e-15   Fischerella thermalis
ref|WP_027842882.1|  carboxyl-terminal protease                       83.2    2e-15   Mastigocoleus testarum
ref|WP_039737517.1|  carboxyl-terminal protease                       83.2    2e-15   
ref|WP_039201316.1|  carboxyl-terminal protease                       81.3    3e-15   
ref|WP_006105412.1|  peptidase S41                                    82.8    3e-15   Coleofasciculus chthonoplastes
ref|WP_017747653.1|  peptidase S41                                    82.8    3e-15   Scytonema hofmannii
ref|WP_011610886.1|  peptidase S41                                    82.8    4e-15   Trichodesmium erythraeum
ref|WP_016876627.1|  peptidase S41                                    82.4    4e-15   Chlorogloeopsis fritschii
ref|WP_026086846.1|  carboxyl-terminal protease                       82.4    4e-15   Fischerella muscicola
gb|AFZ00838.1|  C-terminal processing peptidase-2                     82.4    4e-15   Calothrix sp. PCC 6303
ref|WP_041739300.1|  carboxyl-terminal protease                       82.4    4e-15   Calothrix parietina
ref|WP_017310516.1|  peptidase S41                                    82.4    4e-15   Fischerella sp. PCC 9339
gb|KIJ84025.1|  carboxyl-terminal protease                            82.4    4e-15   Scytonema tolypothrichoides VB-61278
ref|WP_044449365.1|  carboxyl-terminal protease                       82.4    5e-15   Mastigocladus laminosus
ref|WP_036946641.1|  carboxyl-terminal protease                       82.0    6e-15   
ref|WP_016951818.1|  peptidase S41                                    82.0    7e-15   Anabaena sp. PCC 7108
ref|WP_017287738.1|  hypothetical protein                             81.6    7e-15   Leptolyngbya boryana
ref|WP_011320161.1|  peptidase S41                                    82.0    7e-15   Trichormus variabilis
ref|WP_041269215.1|  carboxyl-terminal protease                       81.6    7e-15   
ref|WP_015206408.1|  C-terminal processing peptidase-2                81.6    8e-15   Cylindrospermum stagnale
ref|WP_015212946.1|  C-terminal processing peptidase-2                81.6    8e-15   Anabaena cylindrica
gb|AFY68008.1|  C-terminal processing peptidase-2                     82.0    8e-15   Geitlerinema sp. PCC 7407
ref|WP_019490098.1|  peptidase S41                                    81.6    8e-15   Calothrix sp. PCC 7103
ref|WP_036479806.1|  carboxyl-terminal protease                       81.6    8e-15   Myxosarcina sp. GI1
ref|WP_037222741.1|  carboxyl-terminal protease                       81.6    8e-15   
ref|WP_008051315.1|  peptidase S41                                    81.6    9e-15   Arthrospira sp. PCC 8005
ref|WP_009341660.1|  peptidase S41                                    81.6    9e-15   
ref|WP_015083378.1|  C-terminal processing peptidase                  81.6    9e-15   Anabaena sp. 90
ref|WP_018399148.1|  hypothetical protein                             81.6    9e-15   filamentous cyanobacterium ESFC-1
ref|WP_015229936.1|  C-terminal processing peptidase                  81.3    1e-14   Dactylococcopsis salina
gb|EDZ92600.1|  carboxyl-terminal protease                            81.3    1e-14   Arthrospira maxima CS-328
ref|WP_039933688.1|  carboxyl-terminal protease                       80.9    1e-14   Arthrospira maxima
ref|WP_009555551.1|  C-terminal processing peptidase-2                81.3    1e-14   Oscillatoriales cyanobacterium JSC-12
ref|WP_035760169.1|  carboxyl-terminal protease                       80.9    1e-14   Arthrospira platensis
gb|EKD06860.1|  carboxyl-terminal protease                            80.9    1e-14   Arthrospira platensis C1
ref|WP_015140150.1|  C-terminal processing peptidase                  80.9    1e-14   Nostoc sp. PCC 7524
gb|EAW43605.1|  Peptidase S41A                                        80.9    1e-14   Nodularia spumigena CCY9414
ref|WP_017804367.1|  peptidase S41                                    80.9    1e-14   Nodularia spumigena
ref|WP_027404374.1|  carboxyl-terminal protease                       80.9    1e-14   Aphanizomenon flos-aquae
ref|WP_015222000.1|  C-terminal processing peptidase-2                80.9    1e-14   
ref|WP_019504598.1|  hypothetical protein                             80.9    1e-14   Pleurocapsa sp. PCC 7319
ref|WP_017661268.1|  hypothetical protein                             80.9    2e-14   Geitlerinema sp. PCC 7105
ref|WP_026722361.1|  carboxyl-terminal protease                       80.9    2e-14   Fischerella sp. PCC 9431
gb|KIE08669.1|  carboxyl-terminal protease                            80.9    2e-14   Tolypothrix bouteillei VB521301
ref|WP_015174802.1|  C-terminal processing peptidase-2                80.5    2e-14   Oscillatoria nigro-viridis
ref|WP_015129801.1|  C-terminal processing peptidase-2                80.5    2e-14   Calothrix sp. PCC 7507
ref|WP_015115192.1|  C-terminal processing peptidase-2                80.5    2e-14   Nostoc sp. PCC 7107
ref|WP_006277346.1|  peptidase S41                                    80.1    3e-14   Cylindrospermopsis raciborskii
ref|WP_027268870.1|  carboxyl-terminal protease                       80.1    3e-14   Leptolyngbya sp. PCC 6406
ref|WP_021829198.1|  carboxyl-terminal processing protease            80.1    3e-14   Crocosphaera watsonii
ref|WP_026731031.1|  carboxyl-terminal protease                       80.1    3e-14   Fischerella sp. PCC 9605
ref|WP_017653214.1|  peptidase S41                                    80.1    3e-14   Fortiea contorta
ref|WP_007307145.1|  peptidase S41                                    80.1    3e-14   Crocosphaera watsonii
gb|AFY89531.1|  C-terminal processing peptidase-2                     80.1    3e-14   Chroococcidiopsis thermalis PCC 7203
ref|WP_041462557.1|  carboxyl-terminal protease                       80.1    3e-14   Chroococcidiopsis thermalis
emb|CCQ68523.1|  carboxyl-terminal processing protease                79.7    3e-14   Crocosphaera watsonii WH 0402
ref|WP_007312203.1|  peptidase S41                                    80.1    3e-14   Crocosphaera watsonii
gb|ERT06714.1|  C-terminal processing peptidase family protein        79.7    3e-14   Lyngbya aestuarii BL J
ref|WP_015193901.1|  carboxyl-terminal protease                       80.1    3e-14   Stanieria cyanosphaera
ref|WP_026101674.1|  carboxyl-terminal protease                       80.1    3e-14   cyanobacterium PCC 7702
ref|WP_012407120.1|  peptidase S41                                    80.1    3e-14   Nostoc punctiforme
ref|WP_007353399.1|  MULTISPECIES: peptidase S41                      79.7    3e-14   Kamptonema
ref|WP_040484141.1|  carboxyl-terminal protease                       79.7    3e-14   Lyngbya aestuarii
ref|WP_013190873.1|  peptidase S41                                    79.7    3e-14   Trichormus azollae
ref|WP_010997570.1|  peptidase S41                                    79.7    4e-14   Nostocaceae
ref|WP_015185760.1|  C-terminal processing peptidase                  79.7    4e-14   Microcoleus sp. PCC 7113
ref|WP_041429564.1|  carboxyl-terminal protease                       79.7    4e-14   
gb|AHB88260.1|  periplasmic carboxyl-terminal processing protease...  79.7    4e-14   Thermosynechococcus sp. NK55a
ref|WP_015201861.1|  carboxyl-terminal protease                       79.7    4e-14   Crinalium epipsammum
ref|WP_009783169.1|  peptidase S41                                    79.7    4e-14   Lyngbya sp. PCC 8106
ref|WP_009633511.1|  C-terminal processing peptidase                  79.3    5e-14   Synechocystis sp. PCC 7509
ref|WP_041922662.1|  carboxyl-terminal protease                       79.3    6e-14   Cyanobacterium aponinum
gb|AFZ52917.1|  C-terminal processing peptidase-2                     79.3    6e-14   Cyanobacterium aponinum PCC 10605
ref|WP_006633249.1|  peptidase S41                                    79.3    6e-14   Microcoleus vaginatus
ref|WP_017716499.1|  hypothetical protein                             79.0    7e-14   Oscillatoria sp. PCC 10802
ref|WP_015194200.1|  carboxyl-terminal protease                       79.0    7e-14   Stanieria cyanosphaera
ref|WP_029632223.1|  carboxyl-terminal protease [                     79.0    7e-14   [Scytonema hofmanni] UTEX B 1581
ref|WP_035159238.1|  carboxyl-terminal protease                       79.0    7e-14   Calothrix sp. 336/3
ref|WP_036006464.1|  carboxyl-terminal protease                       79.0    8e-14   [Leptolyngbya] sp. JSC-1
ref|WP_038652044.1|  peptidase S41                                    79.0    8e-14   Prochlorococcus sp. MIT 0801
ref|WP_014274683.1|  carboxyl-terminal processing protease            78.6    8e-14   Arthrospira platensis
ref|WP_006527095.1|  C-terminal processing peptidase                  78.6    1e-13   Gloeocapsa sp. PCC 73106
ref|WP_030007566.1|  carboxyl-terminal protease                       78.6    1e-13   
ref|WP_035985067.1|  peptidase S41                                    78.6    1e-13   Leptolyngbya sp. KIOST-1
ref|WP_010468839.1|  peptidase S41                                    78.6    1e-13   Acaryochloris sp. CCMEE 5410
ref|WP_019488905.1|  peptidase S41                                    78.2    1e-13   Calothrix sp. PCC 7103
ref|WP_015148284.1|  C-terminal processing peptidase-2                78.2    1e-13   Oscillatoria acuminata
ref|WP_039716394.1|  carboxyl-terminal protease                       78.2    1e-13   
ref|WP_010873417.1|  peptidase S41                                    78.2    1e-13   Synechocystis
ref|WP_011057446.1|  peptidase S41                                    78.2    1e-13   Thermosynechococcus
emb|CDO99364.1|  unnamed protein product                              76.3    2e-13   Coffea canephora [robusta coffee]
ref|WP_036907132.1|  peptidase S41                                    78.2    2e-13   Prochlorococcus marinus
ref|WP_011823450.1|  peptidase S41                                    78.2    2e-13   Prochlorococcus marinus
ref|WP_012195344.1|  peptidase S41                                    77.8    2e-13   Prochlorococcus marinus
ref|WP_011293644.1|  peptidase S41                                    77.8    2e-13   Prochlorococcus marinus
ref|WP_028948307.1|  carboxyl-terminal protease                       77.8    2e-13   Synechocystis sp. PCC 6714
ref|WP_015227062.1|  C-terminal processing peptidase-2                77.8    2e-13   Halothece sp. PCC 7418
ref|WP_015954086.1|  peptidase S41                                    77.4    2e-13   Cyanothece sp. PCC 7424
ref|XP_002181112.1|  predicted protein                                77.0    2e-13   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_015144827.1|  C-terminal processing peptidase                  77.4    2e-13   Pleurocapsa minor
ref|WP_041443794.1|  carboxyl-terminal protease                       77.4    2e-13   Synechococcus
sp|P42784.2|CTPA_SYNP2  RecName: Full=Carboxyl-terminal-processin...  77.4    3e-13   Synechococcus sp. PCC 7002
ref|WP_008274661.1|  peptidase S41                                    77.4    3e-13   Cyanothece sp. CCY0110
ref|XP_005645927.1|  C-terminal processing peptidase                  77.4    3e-13   Coccomyxa subellipsoidea C-169
ref|WP_028948323.1|  peptidase S41                                    77.4    3e-13   Synechocystis sp. PCC 6714
ref|WP_010872128.1|  peptidase S41                                    77.4    3e-13   Synechocystis
ref|WP_012593970.1|  MULTISPECIES: peptidase S41                      77.4    3e-13   Cyanothece
pir||S26195  probable carboxyl-terminal processing proteinase - S...  77.0    3e-13
ref|WP_011317316.1|  peptidase S41                                    77.0    3e-13   Trichormus variabilis
ref|WP_010996656.1|  peptidase S41                                    77.0    4e-13   Nostocaceae
gb|KIJ82862.1|  peptidase S41                                         77.0    4e-13   Scytonema tolypothrichoides VB-61278
ref|WP_041035928.1|  peptidase S41                                    76.6    5e-13   Tolypothrix campylonemoides
ref|WP_012165213.1|  peptidase S41                                    76.6    5e-13   Acaryochloris marina
gb|EWM30018.1|  carboxyl-terminal processing protease                 77.0    6e-13   Nannochloropsis gaditana
ref|XP_005854463.1|  carboxyl-terminal processing protease            77.0    6e-13   Nannochloropsis gaditana CCMP526
ref|WP_023076562.1|  hypothetical protein                             76.3    6e-13   Leptolyngbya sp. Heron Island J
ref|WP_015168366.1|  C-terminal processing peptidase                  76.3    6e-13   Synechococcus sp. PCC 7502
ref|WP_011143095.1|  peptidase S41                                    76.6    6e-13   Gloeobacter violaceus
ref|WP_037221258.1|  peptidase S41                                    76.3    6e-13   
ref|WP_006515294.1|  C-terminal processing peptidase                  76.3    7e-13   Leptolyngbya sp. PCC 7375
ref|WP_011130154.1|  peptidase S41                                    76.3    7e-13   Prochlorococcus marinus
ref|WP_044107588.1|  carboxyl-terminal protease                       76.3    7e-13   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_009543917.1|  MULTISPECIES: peptidase S41                      75.9    8e-13   Cyanothece
gb|EAU71788.1|  Peptidase S41A                                        75.9    8e-13   Synechococcus sp. BL107
emb|CBN56657.1|  C-terminal processing peptidase-2 [ [                75.9    8e-13   [Oscillatoria] sp. PCC 6506
dbj|BAP17535.1|  carboxyl-terminal processing protease                75.9    8e-13   cyanobacterium endosymbiont of Epithemia turgida isolate EtSB Lake Yunoko
ref|WP_037988894.1|  peptidase S41                                    75.9    8e-13   
ref|WP_019487571.1|  MULTISPECIES: peptidase S41                      75.9    8e-13   Kamptonema
ref|WP_036530843.1|  carboxyl-terminal protease                       75.9    9e-13   
ref|WP_011826078.1|  peptidase S41                                    75.9    9e-13   
gb|ACB53339.1|  carboxyl-terminal processing protease                 75.9    9e-13   Cyanothece sp. ATCC 51142
ref|WP_017306984.1|  hypothetical protein                             75.9    1e-12   Spirulina subsalsa
ref|XP_011091370.1|  PREDICTED: carboxyl-terminal-processing pept...  76.3    1e-12   Sesamum indicum [beniseed]
ref|WP_038023249.1|  peptidase S41                                    75.9    1e-12   Synechococcus sp. RS9916
ref|WP_017652656.1|  peptidase S41                                    75.5    1e-12   Fortiea contorta
ref|WP_013320294.1|  peptidase S41                                    75.5    1e-12   Cyanothece sp. PCC 7822
gb|EAU73900.1|  carboxyl-terminal processing protease                 75.5    1e-12   Synechococcus sp. RS9916
ref|WP_015135167.1|  C-terminal processing peptidase-2                75.5    1e-12   Leptolyngbya sp. PCC 7376
ref|WP_015118055.1|  C-terminal processing peptidase-2                75.5    1e-12   Rivularia sp. PCC 7116
ref|WP_017301802.1|  hypothetical protein                             75.5    1e-12   Nodosilinea nodulosa
ref|WP_015166228.1|  carboxyl-terminal protease                       75.9    1e-12   Pseudanabaena sp. PCC 7367
ref|WP_008186509.1|  peptidase S41                                    75.5    1e-12   Moorea producens
ref|WP_024970552.1|  carboxyl-terminal protease                       75.1    1e-12   Microcystis aeruginosa
ref|WP_008235699.1|  carboxyl-terminal protease                       75.5    1e-12   Richelia intracellularis
ref|WP_002751566.1|  peptidase S41                                    75.1    1e-12   Microcystis aeruginosa
ref|WP_017326381.1|  hypothetical protein                             75.5    1e-12   Synechococcus sp. PCC 7336
ref|WP_002735234.1|  photosystem II D1 protease                       75.1    1e-12   Microcystis aeruginosa
ref|WP_008231621.1|  carboxyl-terminal processing protease            75.1    1e-12   Richelia intracellularis
ref|WP_002773231.1|  peptidase S41                                    75.1    1e-12   Microcystis aeruginosa
ref|WP_012266181.1|  peptidase S41                                    75.1    1e-12   Microcystis aeruginosa
ref|WP_002798062.1|  peptidase S41                                    75.1    1e-12   Microcystis
dbj|GAL92865.1|  carboxyl-terminal processing protease                75.1    1e-12   Microcystis aeruginosa NIES-44
ref|WP_004160889.1|  Carboxyl-terminal-processing protease            75.1    1e-12   Microcystis
ref|WP_036915712.1|  MULTISPECIES: peptidase S41                      75.5    1e-12   Prochlorococcus
ref|WP_002744495.1|  photosystem II D1 protease                       75.1    1e-12   Microcystis aeruginosa
ref|WP_002790965.1|  peptidase S41                                    75.1    1e-12   Microcystis aeruginosa
ref|WP_002801046.1|  peptidase S41                                    75.1    2e-12   
ref|WP_017300415.1|  hypothetical protein                             75.1    2e-12   
ref|WP_015174610.1|  carboxyl-terminal protease                       75.5    2e-12   
ref|WP_008201068.1|  peptidase S41                                    75.1    2e-12   
ref|WP_040931495.1|  carboxyl-terminal protease                       75.1    2e-12   
gb|KGG30018.1|  Carboxyl-terminal protease                            75.1    2e-12   
ref|WP_015152692.1|  C-terminal processing peptidase-2                75.1    2e-12   
ref|WP_010309391.1|  peptidase S41                                    75.1    2e-12   
ref|WP_039713340.1|  peptidase S41                                    75.1    2e-12   
ref|WP_041549970.1|  carboxyl-terminal protease                       74.7    2e-12   
gb|AFY96118.1|  C-terminal processing peptidase                       74.7    2e-12   
ref|WP_015111444.1|  C-terminal processing peptidase-2                75.1    2e-12   
ref|WP_041425395.1|  peptidase S41                                    75.1    2e-12   
ref|WP_016515226.1|  putative CtpA-like serine protease               74.7    2e-12   
ref|WP_008227563.1|  carboxyl-terminal protease                       74.7    2e-12   
gb|ABB26142.1|  C-terminal processing peptidase-2. Serine peptida...  75.1    2e-12   
ref|WP_024544620.1|  carboxyl-terminal protease                       74.7    2e-12   
gb|EPS73244.1|  d1 protease                                           73.6    2e-12   
ref|WP_028084403.1|  peptidase S41                                    75.1    2e-12   
ref|WP_006041652.1|  peptidase S41                                    75.1    2e-12   
ref|WP_017746822.1|  peptidase S41                                    74.7    2e-12   
ref|WP_015188917.1|  C-terminal processing peptidase-2                74.7    2e-12   
ref|WP_035985339.1|  carboxyl-terminal protease                       74.7    2e-12   
ref|WP_006456060.1|  peptidase S41                                    74.7    2e-12   
gb|AFK45535.1|  unknown                                               72.0    2e-12   
ref|WP_028089377.1|  peptidase S41                                    74.7    2e-12   
ref|WP_039752246.1|  peptidase S41                                    74.3    2e-12   
ref|WP_038555034.1|  peptidase S41                                    74.7    2e-12   
ref|WP_002767401.1|  peptidase S41                                    74.7    2e-12   
ref|WP_002787753.1|  peptidase S41                                    74.3    2e-12   
ref|WP_011243130.1|  MULTISPECIES: peptidase S41                      74.7    3e-12   
ref|WP_002758895.1|  peptidase S41                                    74.3    3e-12   
ref|WP_017295707.1|  hypothetical protein                             74.3    3e-12   
ref|WP_011933379.1|  peptidase S41                                    74.7    3e-12   
gb|AHF63752.1|  carboxyl-terminal protease                            74.3    3e-12   
ref|WP_015138493.1|  C-terminal processing peptidase                  74.3    3e-12   
ref|WP_040054992.1|  carboxyl-terminal protease                       74.3    3e-12   
ref|XP_001776032.1|  predicted protein                                73.9    3e-12   
ref|WP_039725354.1|  MULTISPECIES: peptidase S41                      74.3    3e-12   
ref|WP_027840975.1|  peptidase S41                                    74.3    3e-12   
gb|KGG34102.1|  Periplasmic protease                                  70.9    3e-12   
ref|WP_017314451.1|  peptidase S41                                    74.3    3e-12   
ref|WP_015128065.1|  C-terminal processing peptidase-2                74.3    3e-12   
ref|WP_006170377.1|  peptidase S41                                    74.3    3e-12   
ref|WP_036903185.1|  peptidase S41                                    74.3    4e-12   
ref|XP_010693972.1|  PREDICTED: carboxyl-terminal-processing pept...  74.3    4e-12   
ref|XP_010693971.1|  PREDICTED: carboxyl-terminal-processing pept...  74.3    4e-12   
ref|WP_028952101.1|  peptidase S41                                    74.3    4e-12   
gb|KIE13300.1|  peptidase S41                                         73.9    4e-12   
ref|WP_015209634.1|  C-terminal processing peptidase-2                73.9    4e-12   
ref|WP_030006029.1|  peptidase S41                                    73.9    4e-12   
ref|WP_006633164.1|  peptidase S41                                    73.9    4e-12   
ref|WP_012305850.1|  peptidase S41                                    73.9    4e-12   
dbj|GAL92498.1|  carboxyl-terminal protease                           73.9    4e-12   
emb|CAN62705.1|  hypothetical protein VITISV_005100                   73.6    4e-12   
ref|WP_015149178.1|  C-terminal processing peptidase                  73.9    5e-12   
ref|WP_039727523.1|  MULTISPECIES: carboxyl-terminal protease         73.6    5e-12   
ref|WP_024545694.1|  peptidase S41                                    73.9    5e-12   
ref|WP_011364272.1|  peptidase S41                                    73.9    5e-12   
ref|WP_015133882.1|  C-terminal processing peptidase-2                73.6    5e-12   
ref|WP_017713548.1|  hypothetical protein                             73.6    5e-12   
dbj|BAA09134.1|  C-terminal protease precursor                        73.9    5e-12   
ref|WP_012164941.1|  peptidase S41                                    73.6    5e-12   
ref|XP_002951533.1|  hypothetical protein VOLCADRAFT_92124            74.3    5e-12   
ref|WP_010471637.1|  peptidase S41                                    73.6    5e-12   
ref|WP_007100043.1|  peptidase S41                                    73.6    6e-12   
ref|XP_002285561.1|  PREDICTED: carboxyl-terminal-processing pept...  73.9    6e-12   
ref|WP_029626349.1|  peptidase S41                                    73.6    6e-12   
ref|WP_011430624.1|  peptidase S41                                    73.6    6e-12   
ref|WP_019501119.1|  hypothetical protein                             73.6    6e-12   
ref|WP_035829920.1|  peptidase S41                                    73.6    6e-12   
ref|WP_022604252.1|  C-terminal peptidase (prc)                       73.2    6e-12   
ref|XP_002518200.1|  Carboxyl-terminal-processing protease precur...  73.2    7e-12   
ref|WP_015140497.1|  C-terminal processing peptidase                  73.6    7e-12   
ref|WP_036004380.1|  peptidase S41                                    73.2    7e-12   
ref|XP_010645207.1|  PREDICTED: carboxyl-terminal-processing pept...  73.6    7e-12   
ref|WP_017322405.1|  peptidase S41                                    73.2    7e-12   
ref|WP_006454673.1|  peptidase S41                                    73.2    7e-12   
ref|XP_007144149.1|  hypothetical protein PHAVU_007G132900g           73.6    7e-12   
ref|WP_024124266.1|  periplasmic carboxyl-terminal protease CtpC      73.2    7e-12   
ref|WP_006511473.1|  C-terminal processing peptidase                  73.2    7e-12   
ref|WP_038544790.1|  peptidase S41                                    73.2    8e-12   
gb|EKE03612.1|  hypothetical protein ACD_20C00176G0007                73.2    8e-12   
ref|XP_005710051.1|  unnamed protein product                          73.2    8e-12   
gb|AAL99043.1|AF487525_1  D1 protease precursor                       72.8    8e-12   
ref|WP_006518089.1|  C-terminal processing peptidase-2                73.2    8e-12   
ref|WP_015190966.1|  C-terminal processing peptidase-2                73.2    8e-12   
ref|WP_026103957.1|  peptidase S41                                    73.2    8e-12   
ref|XP_007222345.1|  hypothetical protein PRUPE_ppa004812mg           73.2    8e-12   
ref|XP_008789458.1|  PREDICTED: carboxyl-terminal-processing pept...  73.2    9e-12   
ref|XP_005648207.1|  photosystem Ii D1 C-terminal processing prot...  73.2    9e-12   
ref|XP_008224042.1|  PREDICTED: C-terminal processing peptidase, ...  73.2    9e-12   
ref|XP_009341603.1|  PREDICTED: carboxyl-terminal-processing pept...  73.2    9e-12   
ref|XP_008342558.1|  PREDICTED: C-terminal processing peptidase, ...  72.4    1e-11   
ref|XP_004495252.1|  PREDICTED: C-terminal processing peptidase, ...  73.2    1e-11   
ref|WP_029633390.1|  peptidase S41 [                                  72.8    1e-11   
gb|EAY88005.1|  hypothetical protein OsI_09428                        71.2    1e-11   
ref|WP_015214151.1|  C-terminal processing peptidase-2                72.8    1e-11   
ref|XP_008342556.1|  PREDICTED: C-terminal processing peptidase, ...  72.8    1e-11   
ref|WP_023174000.1|  carboxyl-terminal protease                       72.8    1e-11   
ref|XP_008391269.1|  PREDICTED: C-terminal processing peptidase, ...  72.8    1e-11   
ref|XP_008342555.1|  PREDICTED: C-terminal processing peptidase, ...  72.8    1e-11   
ref|WP_023072551.1|  c-terminal processing peptidase-2                72.4    1e-11   
ref|WP_015108330.1|  C-terminal processing peptidase                  72.8    1e-11   
ref|XP_009341602.1|  PREDICTED: carboxyl-terminal-processing pept...  73.2    1e-11   
gb|KGG15339.1|  Carboxyl-terminal protease                            72.4    1e-11   
ref|WP_015079592.1|  carboxyl-terminal protease                       72.8    1e-11   
ref|WP_011128040.1|  peptidase S41                                    72.4    1e-11   
ref|XP_009037731.1|  hypothetical protein AURANDRAFT_12100            71.6    1e-11   
ref|WP_028085052.1|  peptidase S41                                    72.4    1e-11   
ref|XP_010264804.1|  PREDICTED: carboxyl-terminal-processing pept...  72.8    1e-11   
ref|WP_006195367.1|  peptidase S41                                    72.4    1e-11   
ref|WP_027404035.1|  peptidase S41                                    72.4    1e-11   
ref|WP_008316952.1|  C-terminal processing peptidase                  72.4    1e-11   
ref|WP_013189895.1|  peptidase S41                                    72.4    1e-11   
ref|WP_014094096.1|  carboxyl-terminal protease                       72.4    1e-11   
gb|KHN01016.1|  Carboxyl-terminal-processing protease                 72.8    1e-11   
ref|WP_039202802.1|  peptidase S41                                    72.4    1e-11   
ref|WP_034416611.1|  peptidase S41                                    72.4    1e-11   
ref|XP_008391268.1|  PREDICTED: C-terminal processing peptidase, ...  72.8    1e-11   
ref|WP_008206751.1|  peptidase S41                                    72.4    1e-11   
ref|WP_017747995.1|  peptidase S41                                    72.4    1e-11   
ref|WP_035156051.1|  peptidase S41                                    72.4    2e-11   
ref|WP_015170194.1|  C-terminal processing peptidase-2                72.4    2e-11   
ref|WP_012627779.1|  peptidase S41                                    72.0    2e-11   
ref|XP_002453033.1|  hypothetical protein SORBIDRAFT_04g037070        70.1    2e-11   
ref|WP_012411348.1|  peptidase S41                                    72.4    2e-11   
ref|WP_040937842.1|  carboxyl-terminal protease                       72.0    2e-11   
ref|WP_002737617.1|  C-terminal processing peptidase family protein   72.4    2e-11   
ref|WP_002756223.1|  peptidase S41                                    72.4    2e-11   
ref|WP_024970531.1|  peptidase S41                                    72.0    2e-11   
ref|WP_002745181.1|  peptidase S41                                    72.0    2e-11   
ref|WP_015957337.1|  peptidase S41                                    72.0    2e-11   
ref|WP_004161873.1|  peptidase S41                                    72.0    2e-11   
ref|WP_002801424.1|  peptidase S41                                    72.0    2e-11   
ref|WP_015785232.1|  peptidase S41                                    72.0    2e-11   
ref|WP_012265732.1|  peptidase S41                                    72.0    2e-11   
ref|WP_029955940.1|  peptidase S41                                    68.6    2e-11   
ref|WP_025938165.1|  hypothetical protein                             69.3    2e-11   
ref|WP_009787475.1|  peptidase S41                                    72.0    2e-11   
ref|WP_025946703.1|  hypothetical protein                             68.9    2e-11   
gb|KJB38424.1|  hypothetical protein B456_006G2539002                 72.0    2e-11   
ref|WP_002781803.1|  Genome sequencing data, contig C327              72.0    2e-11   
ref|WP_002765211.1|  peptidase S41                                    72.0    2e-11   
ref|XP_010940707.1|  PREDICTED: carboxyl-terminal-processing pept...  72.0    2e-11   
ref|WP_025935777.1|  hypothetical protein                             69.3    2e-11   
ref|WP_002789308.1|  peptidase S41                                    72.0    2e-11   
ref|XP_006649167.1|  PREDICTED: C-terminal processing peptidase, ...  72.4    2e-11   
gb|KJB38421.1|  hypothetical protein B456_006G2539002                 72.4    2e-11   
ref|WP_036918273.1|  MULTISPECIES: peptidase S41                      72.0    2e-11   
ref|WP_026148389.1|  peptidase S41                                    72.0    2e-11   
gb|KHG11574.1|  Carboxyl-terminal-processing protease                 72.4    2e-11   
ref|XP_010940706.1|  PREDICTED: carboxyl-terminal-processing pept...  72.4    2e-11   
ref|XP_003578617.2|  PREDICTED: carboxyl-terminal-processing pept...  72.0    2e-11   
ref|XP_001772813.1|  predicted protein                                72.0    2e-11   
ref|WP_011433234.1|  peptidase S41                                    72.0    2e-11   
ref|WP_036483670.1|  peptidase S41                                    72.0    2e-11   
ref|WP_029952095.1|  peptidase S41                                    69.7    2e-11   
ref|XP_007035321.1|  Peptidase S41 family protein isoform 1           72.4    2e-11   
ref|WP_002799171.1|  peptidase S41                                    72.0    2e-11   
ref|XP_006851358.1|  hypothetical protein AMTR_s00050p00221590        72.4    2e-11   
ref|XP_010940703.1|  PREDICTED: carboxyl-terminal-processing pept...  72.0    2e-11   
ref|WP_018396142.1|  peptidase S41                                    72.0    2e-11   
ref|WP_015196982.1|  C-terminal processing peptidase-2                72.0    2e-11   
ref|WP_040943199.1|  peptidase S41                                    71.6    2e-11   
ref|WP_012953682.1|  peptidase S41                                    71.6    2e-11   
gb|EEE58038.1|  hypothetical protein OsJ_08862                        72.0    2e-11   
ref|XP_010547204.1|  PREDICTED: carboxyl-terminal-processing pept...  72.0    2e-11   
ref|WP_040931819.1|  peptidase S41                                    71.6    2e-11   
ref|WP_035158073.1|  peptidase S41                                    71.6    2e-11   
ref|WP_032525951.1|  peptidase S41                                    71.6    2e-11   
gb|AFW74015.1|  hypothetical protein ZEAMMB73_485634                  70.5    2e-11   
ref|WP_029981257.1|  peptidase S41                                    69.3    2e-11   
gb|KGF98365.1|  Carboxyl-terminal protease                            71.6    3e-11   
ref|WP_040935732.1|  peptidase S41                                    71.6    3e-11   
ref|WP_017316703.1|  peptidase S41                                    71.6    3e-11   
ref|WP_029984254.1|  peptidase S41                                    69.7    3e-11   
ref|XP_001702781.1|  predicted protein                                71.2    3e-11   
ref|WP_039738608.1|  peptidase S41                                    71.6    3e-11   
gb|KDO55749.1|  hypothetical protein CISIN_1g009668mg                 71.2    3e-11   
ref|WP_025972919.1|  hypothetical protein                             69.3    3e-11   
ref|WP_036891672.1|  peptidase S41                                    70.9    3e-11   
ref|WP_006909374.1|  peptidase S41                                    71.6    3e-11   
ref|WP_025893080.1|  hypothetical protein                             68.9    3e-11   
gb|KDO39659.1|  hypothetical protein CISIN_1g030210mg                 68.9    3e-11   
ref|WP_017321025.1|  peptidase S41                                    71.6    3e-11   
gb|KIE11691.1|  peptidase S41                                         71.6    3e-11   
ref|WP_011619593.1|  peptidase S41                                    71.6    3e-11   
ref|WP_002756940.1|  peptidase S41                                    71.2    3e-11   
ref|WP_026731992.1|  peptidase S41                                    71.6    3e-11   
gb|EGN64535.1|  C-terminal processing peptidase                       68.2    3e-11   
ref|WP_041455924.1|  peptidase S41                                    71.2    3e-11   
ref|WP_015230264.1|  C-terminal processing peptidase                  71.2    3e-11   
ref|WP_015123562.1|  C-terminal processing peptidase                  71.2    3e-11   
ref|WP_044451745.1|  peptidase S41                                    68.6    3e-11   
gb|ABA19925.1|  C-terminal processing peptidase-2, Serine peptida...  71.2    3e-11   
ref|WP_015209032.1|  C-terminal processing peptidase-2                71.2    3e-11   
ref|WP_010995906.1|  peptidase S41                                    71.2    3e-11   
ref|WP_015127147.1|  C-terminal processing peptidase-2                71.2    3e-11   
ref|XP_006420411.1|  hypothetical protein CICLE_v10004718mg           71.6    3e-11   
ref|WP_026098110.1|  peptidase S41                                    71.2    3e-11   
ref|XP_002868041.1|  hypothetical protein ARALYDRAFT_329753           71.6    3e-11   
ref|XP_010439947.1|  PREDICTED: carboxyl-terminal-processing pept...  71.2    3e-11   
gb|KDO55748.1|  hypothetical protein CISIN_1g009668mg                 71.6    3e-11   
gb|KIJ82524.1|  peptidase S41                                         71.2    4e-11   
ref|WP_006853028.1|  peptidase S41                                    71.2    4e-11   
gb|KGG11320.1|  Periplasmic protease                                  71.2    4e-11   
ref|WP_006619006.1|  peptidase S41                                    71.2    4e-11   
ref|XP_006493999.1|  PREDICTED: C-terminal processing peptidase, ...  71.6    4e-11   
ref|WP_036896536.1|  MULTISPECIES: peptidase S41                      71.2    4e-11   
gb|AFZ44124.1|  C-terminal processing peptidase-2                     71.2    4e-11   
ref|WP_041596227.1|  peptidase S41                                    71.2    4e-11   
ref|XP_010434625.1|  PREDICTED: carboxyl-terminal-processing pept...  71.2    4e-11   
ref|WP_009342576.1|  peptidase S41                                    71.2    4e-11   
ref|WP_006622567.1|  MULTISPECIES: peptidase S41                      71.2    4e-11   
ref|WP_022246604.1|  carboxyl--terminal protease                      70.9    4e-11   
ref|WP_011124521.1|  peptidase S41                                    71.2    4e-11   
ref|XP_010449564.1|  PREDICTED: carboxyl-terminal-processing pept...  71.2    4e-11   
ref|XP_011029901.1|  PREDICTED: carboxyl-terminal-processing pept...  70.9    4e-11   
ref|WP_023064801.1|  C-terminal processing peptidase family protein   71.2    4e-11   
ref|WP_041596658.1|  peptidase S41                                    70.9    4e-11   



>ref|XP_010316906.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=298

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVGD+TYGKGLIQSVFEL DGSGVVVTIGKYVTPNHMDINGNG+EPDFRN PA
Sbjct  222  HDNCRAVLVGDKTYGKGLIQSVFELPDGSGVVVTIGKYVTPNHMDINGNGVEPDFRNFPA  281

Query  411  WNEVSKHLSKCHKPKDG  361
            WNEV+  LSKCHK +DG
Sbjct  282  WNEVNNRLSKCHKQQDG  298



>ref|XP_006355597.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
[Solanum tuberosum]
Length=474

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVGD+TYGKGLIQSVFEL DGSGVVVTIGKYVTPNHMDINGNG+EPDFRN PA
Sbjct  398  HDNCRAVLVGDKTYGKGLIQSVFELPDGSGVVVTIGKYVTPNHMDINGNGVEPDFRNFPA  457

Query  411  WNEVSKHLSKCHKPKDG  361
            WNEV+ HLSKCHK +DG
Sbjct  458  WNEVNNHLSKCHKQQDG  474



>ref|XP_010316905.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=474

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVGD+TYGKGLIQSVFEL DGSGVVVTIGKYVTPNHMDINGNG+EPDFRN PA
Sbjct  398  HDNCRAVLVGDKTYGKGLIQSVFELPDGSGVVVTIGKYVTPNHMDINGNGVEPDFRNFPA  457

Query  411  WNEVSKHLSKCHKPKDG  361
            WNEV+  LSKCHK +DG
Sbjct  458  WNEVNNRLSKCHKQQDG  474



>ref|XP_011096495.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Sesamum indicum]
Length=476

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL DGSGVVVTIGKYVTP HMDINGNG++PDFRNLPA
Sbjct  400  HDNCKAVLVGERTYGKGLIQSVFELNDGSGVVVTIGKYVTPKHMDINGNGVDPDFRNLPA  459

Query  411  WNEVSKHLSKCHKPKDG  361
            WNEV+++LS C +P++G
Sbjct  460  WNEVTRYLSTCQRPQEG  476



>gb|KCW73749.1| hypothetical protein EUGRSUZ_E023602, partial [Eucalyptus grandis]
Length=254

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL DGSGVVVTIGKY TPNHMDINGNGIEPD+R+LPA
Sbjct  178  HDNCRAVLVGERTFGKGLIQSVFELDDGSGVVVTIGKYATPNHMDINGNGIEPDYRSLPA  237

Query  411  WNEVSKHLSKCHKPKDG  361
            WNEV+KH+S+C   + G
Sbjct  238  WNEVNKHISQCKMLRQG  254



>emb|CDP17322.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 73/77 (95%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RTYGKGLIQSVFEL DGSGVVVT+GKYVTPNHMDINGNG+EPDFR+LP+
Sbjct  412  HDNCRAVLVGERTYGKGLIQSVFELHDGSGVVVTVGKYVTPNHMDINGNGVEPDFRSLPS  471

Query  411  WNEVSKHLSKCHKPKDG  361
            W+EV  +LSKCHKP +G
Sbjct  472  WDEVMNNLSKCHKPPEG  488



>ref|XP_010243686.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=484

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/77 (86%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RTYGKGLIQSVFEL DGSGVVVT+GKYVTPNHMDINGNGIEPDFRN+P 
Sbjct  408  HDNCRAVLVGERTYGKGLIQSVFELHDGSGVVVTVGKYVTPNHMDINGNGIEPDFRNIPV  467

Query  411  WNEVSKHLSKCHKPKDG  361
            WNEV KHLS CH  + G
Sbjct  468  WNEVIKHLSWCHMQRLG  484



>gb|AAL99045.1|AF487527_1 D1 protease-like protein precursor [Nicotiana plumbaginifolia]
Length=467

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVGD+TYGKGLIQSVFEL DGSGVVVTIGKYVTPN++DINGNG++PDFRN PA
Sbjct  391  HDNCRAVLVGDKTYGKGLIQSVFELPDGSGVVVTIGKYVTPNNLDINGNGVDPDFRNFPA  450

Query  411  WNEVSKHLSKCHKPKDG  361
            W+EV+  LSKCHKP+ G
Sbjct  451  WSEVTNRLSKCHKPQGG  467



>ref|XP_009614038.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=467

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVGD+TYGKGLIQSVFEL DGSGVVVTIGKYVTPN++DINGNG++PDFRN PA
Sbjct  391  HDNCRAVLVGDKTYGKGLIQSVFELPDGSGVVVTIGKYVTPNNLDINGNGVDPDFRNFPA  450

Query  411  WNEVSKHLSKCHKPKDG  361
            W+EV+  LSKCHKP+ G
Sbjct  451  WSEVTNRLSKCHKPQGG  467



>ref|XP_010056858.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Eucalyptus grandis]
 ref|XP_010056859.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Eucalyptus grandis]
Length=427

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL DGSGVVVTIGKY TPNHMDINGNGIEPD+R+LPA
Sbjct  351  HDNCRAVLVGERTFGKGLIQSVFELDDGSGVVVTIGKYATPNHMDINGNGIEPDYRSLPA  410

Query  411  WNEVSKHLSKCHKPKDG  361
            WNEV+KH+S+C   + G
Sbjct  411  WNEVNKHISQCKMLRQG  427



>ref|XP_009785926.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Nicotiana sylvestris]
Length=467

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DNCRAVLVGD+TYGKGLIQSVFEL DGSGVVVTIGKYVTPN++DINGNG++PDFRN PA
Sbjct  391  QDNCRAVLVGDKTYGKGLIQSVFELPDGSGVVVTIGKYVTPNNLDINGNGVDPDFRNFPA  450

Query  411  WNEVSKHLSKCHKPKDG  361
            W+EV+  LSKCHKP+ G
Sbjct  451  WSEVTNRLSKCHKPQGG  467



>ref|XP_006449623.1| hypothetical protein CICLE_v10018134mg [Citrus clementina]
 gb|ESR62863.1| hypothetical protein CICLE_v10018134mg [Citrus clementina]
Length=498

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG++T+GKGLIQSV+EL DGSGVVVTIGKYVTPNHMDINGNGIEPD+RNLPA
Sbjct  422  HDNCRAVLVGEKTFGKGLIQSVYELHDGSGVVVTIGKYVTPNHMDINGNGIEPDYRNLPA  481

Query  411  WNEVSKHLSKC  379
            WN+V+KHLS+C
Sbjct  482  WNDVTKHLSQC  492



>ref|XP_006467532.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
[Citrus sinensis]
Length=473

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG++T+GKGLIQSV+EL DGSGVVVTIGKYVTPNHMDINGNGIEPD+RNLPA
Sbjct  397  HDNCRAVLVGEKTFGKGLIQSVYELHDGSGVVVTIGKYVTPNHMDINGNGIEPDYRNLPA  456

Query  411  WNEVSKHLSKC  379
            WN+V+KHLS+C
Sbjct  457  WNDVTKHLSQC  467



>gb|KDO78060.1| hypothetical protein CISIN_1g012084mg [Citrus sinensis]
Length=471

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG++T+GKGLIQSV+EL DGSGVVVTIGKYVTPNHMDINGNGIEPD+RNLPA
Sbjct  395  HDNCRAVLVGEKTFGKGLIQSVYELHDGSGVVVTIGKYVTPNHMDINGNGIEPDYRNLPA  454

Query  411  WNEVSKHLSKC  379
            WN+V+KHLS+C
Sbjct  455  WNDVTKHLSQC  465



>gb|KFK31469.1| hypothetical protein AALP_AA6G116300 [Arabis alpina]
Length=483

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLPA
Sbjct  407  HDNCKAVLVGERTYGKGLIQSVFELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPA  466

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  467  WDEVKERLSKCN  478



>ref|XP_006398333.1| hypothetical protein EUTSA_v10001155mg [Eutrema salsugineum]
 gb|ESQ39786.1| hypothetical protein EUTSA_v10001155mg [Eutrema salsugineum]
Length=490

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLPA
Sbjct  414  HDNCKAVLVGERTYGKGLIQSVFELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPA  473

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  474  WDEVKERLSKCN  485



>ref|XP_010538513.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=493

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLPA
Sbjct  411  HDNCKAVLVGERTYGKGLIQSVFELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPA  470

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  471  WDEVKERLSKCN  482



>gb|KJB57304.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
 gb|KJB57311.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
Length=298

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL+DGSGVVVT+G+YVTPNH+DINGNGIEPDFRN P 
Sbjct  222  HDNCRAVLVGERTFGKGLIQSVFELRDGSGVVVTVGQYVTPNHLDINGNGIEPDFRNFPG  281

Query  411  WNEVSKHLSKCHKPKDG  361
            W++VS+HL KC+  + G
Sbjct  282  WSDVSQHLLKCNLHQQG  298



>gb|KJB57305.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
Length=315

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL+DGSGVVVT+G+YVTPNH+DINGNGIEPDFRN P 
Sbjct  239  HDNCRAVLVGERTFGKGLIQSVFELRDGSGVVVTVGQYVTPNHLDINGNGIEPDFRNFPG  298

Query  411  WNEVSKHLSKCHKPKDG  361
            W++VS+HL KC+  + G
Sbjct  299  WSDVSQHLLKCNLHQQG  315



>emb|CDY35162.1| BnaA09g17990D [Brassica napus]
Length=489

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL+DGSGVVVTIGKYVTPNH+DING GIEPDFRNLPA
Sbjct  413  HDNCKAVLVGERTYGKGLIQSVFELRDGSGVVVTIGKYVTPNHIDINGGGIEPDFRNLPA  472

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  473  WDEVKERLSKCN  484



>ref|NP_974893.1| peptidase S41 family protein [Arabidopsis thaliana]
 sp|F4KHG6.1|CTPA1_ARATH RecName: Full=Carboxyl-terminal-processing peptidase 1, chloroplastic; 
AltName: Full=D1 C-terminal processing protease 1; 
AltName: Full=Photosystem II D1 protein processing peptidase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AED95378.1| peptidase S41 family protein [Arabidopsis thaliana]
Length=489

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSV+EL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLPA
Sbjct  413  HDNCKAVLVGERTYGKGLIQSVYELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPA  472

Query  411  WNEVSKHLSKC  379
            W+EV + LSKC
Sbjct  473  WDEVKERLSKC  483



>ref|XP_009114354.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Brassica rapa]
Length=478

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+A+LVG+RTYGKGLIQSVFEL+DGSGVVVTIGKYVTPNH+DING GIEPDFRNLPA
Sbjct  402  HDNCKAILVGERTYGKGLIQSVFELRDGSGVVVTIGKYVTPNHIDINGGGIEPDFRNLPA  461

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  462  WDEVKERLSKCN  473



>emb|CDY03220.1| BnaC09g19360D [Brassica napus]
Length=478

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+A+LVG+RTYGKGLIQSVFEL+DGSGVVVTIGKYVTPNH+DING GIEPDFRNLPA
Sbjct  402  HDNCKAILVGERTYGKGLIQSVFELRDGSGVVVTIGKYVTPNHIDINGGGIEPDFRNLPA  461

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  462  WDEVKERLSKCN  473



>ref|XP_007025177.1| Peptidase S41 family protein isoform 1 [Theobroma cacao]
 gb|EOY27799.1| Peptidase S41 family protein isoform 1 [Theobroma cacao]
Length=477

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL+DGSGVVVT+GKYVTPNH+DINGNGIEPD+RN PA
Sbjct  401  HDNCRAVLVGERTFGKGLIQSVFELRDGSGVVVTVGKYVTPNHLDINGNGIEPDYRNFPA  460

Query  411  WNEVSKHLSKCHKPKDG  361
            WN+V++HL +C+  + G
Sbjct  461  WNDVAQHLLQCNLLRQG  477



>ref|XP_002865196.1| peptidase S41 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41455.1| peptidase S41 family protein [Arabidopsis lyrata subsp. lyrata]
Length=489

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSV+EL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLP 
Sbjct  413  HDNCKAVLVGERTYGKGLIQSVYELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPD  472

Query  411  WNEVSKHLSKCH  376
            WNEV + LSKC+
Sbjct  473  WNEVKERLSKCN  484



>gb|AFK39374.1| unknown [Medicago truncatula]
Length=465

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG RTYGKGLIQSVFELQDGSGVV+T+GKYVTP H DINGNGIEPDF+ LPA
Sbjct  389  HDNCRAVLVGKRTYGKGLIQSVFELQDGSGVVITVGKYVTPKHKDINGNGIEPDFQKLPA  448

Query  411  WNEVSKHLSKCHKPKDG  361
            W++VS+HLSKC   + G
Sbjct  449  WDDVSQHLSKCSMLQQG  465



>ref|XP_003629901.1| Carboxyl-terminal-processing protease [Medicago truncatula]
 gb|AET04377.1| carboxy-terminal processing peptidase-like protein [Medicago 
truncatula]
Length=465

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG RTYGKGLIQSVFELQDGSGVV+T+GKYVTP H DINGNGIEPDF+ LPA
Sbjct  389  HDNCRAVLVGKRTYGKGLIQSVFELQDGSGVVITVGKYVTPKHKDINGNGIEPDFQKLPA  448

Query  411  WNEVSKHLSKCHKPKDG  361
            W++VS+HLSKC   + G
Sbjct  449  WDDVSQHLSKCSMLQQG  465



>ref|XP_002271932.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Vitis vinifera]
 ref|XP_010655629.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Vitis vinifera]
Length=462

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG RT+GKGLIQSVFEL DGSGVVVTIGKYVTPNHMDIN NGIEPDFR  PA
Sbjct  386  HDNCRAVLVGQRTFGKGLIQSVFELHDGSGVVVTIGKYVTPNHMDINKNGIEPDFREFPA  445

Query  411  WNEVSKHLSKCHKPKDG  361
            W+EV++HL++C+  + G
Sbjct  446  WSEVTQHLAQCNTLRQG  462



>emb|CBI30818.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG RT+GKGLIQSVFEL DGSGVVVTIGKYVTPNHMDIN NGIEPDFR  PA
Sbjct  424  HDNCRAVLVGQRTFGKGLIQSVFELHDGSGVVVTIGKYVTPNHMDINKNGIEPDFREFPA  483

Query  411  WNEVSKHLSKCHKPKDG  361
            W+EV++HL++C+  + G
Sbjct  484  WSEVTQHLAQCNTLRQG  500



>ref|XP_010441586.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Camelina sativa]
Length=490

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSV+EL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLP 
Sbjct  414  HDNCKAVLVGERTYGKGLIQSVYELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPG  473

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  474  WDEVKERLSKCN  485



>ref|XP_010441587.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Camelina sativa]
Length=479

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSV+EL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLP 
Sbjct  403  HDNCKAVLVGERTYGKGLIQSVYELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPG  462

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  463  WDEVKERLSKCN  474



>ref|XP_010481459.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic-like 
[Camelina sativa]
Length=491

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSV+EL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLP 
Sbjct  415  HDNCKAVLVGERTYGKGLIQSVYELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPG  474

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  475  WDEVKERLSKCN  486



>ref|XP_010494810.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=480

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSV+EL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLP 
Sbjct  404  HDNCKAVLVGERTYGKGLIQSVYELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPG  463

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  464  WDEVKERLSKCN  475



>ref|XP_010494809.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=491

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSV+EL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLP 
Sbjct  415  HDNCKAVLVGERTYGKGLIQSVYELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPG  474

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  475  WDEVKERLSKCN  486



>gb|KDP21204.1| hypothetical protein JCGZ_21675 [Jatropha curcas]
Length=484

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL+DGSGVVVT+GKYVTPNHMDINGNGIEPD+RN PA
Sbjct  408  HDNCRAVLVGERTFGKGLIQSVFELRDGSGVVVTVGKYVTPNHMDINGNGIEPDYRNFPA  467

Query  411  WNEVSKHLSKCHKPKDG  361
            W +V++HL +C+  + G
Sbjct  468  WGDVTRHLLQCNMNQQG  484



>ref|XP_006280370.1| hypothetical protein CARUB_v10026297mg [Capsella rubella]
 gb|EOA13268.1| hypothetical protein CARUB_v10026297mg [Capsella rubella]
Length=489

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/72 (85%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSV+EL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLP 
Sbjct  413  HDNCKAVLVGERTYGKGLIQSVYELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLPG  472

Query  411  WNEVSKHLSKCH  376
            W+EV + LSKC+
Sbjct  473  WDEVKERLSKCN  484



>gb|KJB57306.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
Length=445

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL+DGSGVVVT+G+YVTPNH+DINGNGIEPDFRN P 
Sbjct  369  HDNCRAVLVGERTFGKGLIQSVFELRDGSGVVVTVGQYVTPNHLDINGNGIEPDFRNFPG  428

Query  411  WNEVSKHLSKCHKPKDG  361
            W++VS+HL KC+  + G
Sbjct  429  WSDVSQHLLKCNLHQQG  445



>gb|KJB57308.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
 gb|KJB57310.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
Length=473

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL+DGSGVVVT+G+YVTPNH+DINGNGIEPDFRN P 
Sbjct  397  HDNCRAVLVGERTFGKGLIQSVFELRDGSGVVVTVGQYVTPNHLDINGNGIEPDFRNFPG  456

Query  411  WNEVSKHLSKCHKPKDG  361
            W++VS+HL KC+  + G
Sbjct  457  WSDVSQHLLKCNLHQQG  473



>ref|XP_006580200.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
isoform X1 [Glycine max]
Length=442

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG RTYGKGLIQSVFEL DGSGVV+T+GKYVTPNH DINGNGIEPDF+ LPA
Sbjct  366  HDNCRAVLVGKRTYGKGLIQSVFELDDGSGVVITVGKYVTPNHKDINGNGIEPDFQKLPA  425

Query  411  WNEVSKHLSKCHKPKDG  361
            W+++S+HL KC   + G
Sbjct  426  WDDISRHLKKCSMSQQG  442



>ref|XP_007159532.1| hypothetical protein PHAVU_002G245300g [Phaseolus vulgaris]
 gb|ESW31526.1| hypothetical protein PHAVU_002G245300g [Phaseolus vulgaris]
Length=446

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG RTYGKGLIQSVFEL DGSGVV+T+GKYVTP+H DINGNGIEPDF+ LPA
Sbjct  370  HDNCRAVLVGKRTYGKGLIQSVFELDDGSGVVITVGKYVTPHHNDINGNGIEPDFQKLPA  429

Query  411  WNEVSKHLSKCHKPKDG  361
            W+++S+HL KC  P+ G
Sbjct  430  WDDISQHLKKCSMPQQG  446



>gb|KJB57307.1| hypothetical protein B456_009G157600 [Gossypium raimondii]
Length=470

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL+DGSGVVVT+G+YVTPNH+DINGNGIEPDFRN P 
Sbjct  394  HDNCRAVLVGERTFGKGLIQSVFELRDGSGVVVTVGQYVTPNHLDINGNGIEPDFRNFPG  453

Query  411  WNEVSKHLSKCHKPKDG  361
            W++VS+HL KC+  + G
Sbjct  454  WSDVSQHLLKCNLHQQG  470



>gb|KHN06461.1| Carboxyl-terminal-processing protease [Glycine soja]
Length=442

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG RTYGKGLIQSVFEL DGSGVV+T+GKYVTPNH DINGNGIEPDF+ LPA
Sbjct  366  HDNCRAVLVGKRTYGKGLIQSVFELDDGSGVVITVGKYVTPNHKDINGNGIEPDFQKLPA  425

Query  411  WNEVSKHLSKCHKPKDG  361
            W+++S+HL KC   + G
Sbjct  426  WDDISRHLKKCSMSQQG  442



>ref|XP_011045312.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Populus euphratica]
Length=440

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL DGSGVVVT+GKYVTPNHMDINGNGIEPD++N P 
Sbjct  364  HDNCRAVLVGERTFGKGLIQSVFELHDGSGVVVTVGKYVTPNHMDINGNGIEPDYQNFPG  423

Query  411  WNEVSKHLSKCHKPKDG  361
            W++V KHLS+C+  + G
Sbjct  424  WSDVQKHLSECNINQQG  440



>ref|XP_006580201.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
isoform X2 [Glycine max]
Length=429

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG RTYGKGLIQSVFEL DGSGVV+T+GKYVTPNH DINGNGIEPDF+ LPA
Sbjct  353  HDNCRAVLVGKRTYGKGLIQSVFELDDGSGVVITVGKYVTPNHKDINGNGIEPDFQKLPA  412

Query  411  WNEVSKHLSKCHKPKDG  361
            W+++S+HL KC   + G
Sbjct  413  WDDISRHLKKCSMSQQG  429



>ref|XP_011045311.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Populus euphratica]
Length=468

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL DGSGVVVT+GKYVTPNHMDINGNGIEPD++N P 
Sbjct  392  HDNCRAVLVGERTFGKGLIQSVFELHDGSGVVVTVGKYVTPNHMDINGNGIEPDYQNFPG  451

Query  411  WNEVSKHLSKCHKPKDG  361
            W++V KHLS+C+  + G
Sbjct  452  WSDVQKHLSECNINQQG  468



>ref|XP_002316739.1| peptidase S41 family protein [Populus trichocarpa]
 gb|EEE97351.1| peptidase S41 family protein [Populus trichocarpa]
Length=468

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL DGSGVVVT+GKYVTPNHMDINGNGIEPD++N P 
Sbjct  392  HDNCRAVLVGERTFGKGLIQSVFELHDGSGVVVTVGKYVTPNHMDINGNGIEPDYQNFPG  451

Query  411  WNEVSKHLSKCHKPKDG  361
            W++V KHLS+C+  + G
Sbjct  452  WSDVKKHLSECNINRQG  468



>ref|XP_004504235.1| PREDICTED: carboxyl-terminal-processing protease-like isoform 
X1 [Cicer arietinum]
Length=461

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG RT+GKGLIQSVFELQDGSGVV+T+GKYVTP H DINGNGIEPDF+ LPA
Sbjct  385  HDNCRAVLVGKRTFGKGLIQSVFELQDGSGVVITVGKYVTPKHKDINGNGIEPDFQKLPA  444

Query  411  WNEVSKHLSKCHKPKDG  361
            W++VS+HL+KC   + G
Sbjct  445  WDDVSQHLTKCSMLQQG  461



>ref|XP_007213023.1| hypothetical protein PRUPE_ppa023076mg [Prunus persica]
 gb|EMJ14222.1| hypothetical protein PRUPE_ppa023076mg [Prunus persica]
Length=475

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 70/77 (91%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCR VLVG+RT+GKGLIQSVFEL+DGSGVVVT+GKYVTP H DINGNGIEPD+RN PA
Sbjct  399  HDNCRGVLVGERTFGKGLIQSVFELRDGSGVVVTVGKYVTPKHKDINGNGIEPDYRNFPA  458

Query  411  WNEVSKHLSKCHKPKDG  361
            W++V++HLS+C+  + G
Sbjct  459  WSDVTQHLSRCNMLQRG  475



>ref|XP_010926337.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X6 [Elaeis guineensis]
Length=302

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL DGSGVVVTIGKYVTPNHMDINGNG+EPDF  LPA
Sbjct  226  HDNCKAVLVGERTYGKGLIQSVFELHDGSGVVVTIGKYVTPNHMDINGNGVEPDFPRLPA  285

Query  411  WNEVSKHLSKCHKPKDG  361
             +EV  +LS C  P  G
Sbjct  286  LSEVRNYLSHCQTPLMG  302



>ref|XP_008225367.1| PREDICTED: C-terminal processing peptidase, chloroplastic [Prunus 
mume]
Length=475

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCR VLVG+RT+GKGLIQSVFEL+DGSGVVVT+GKYVTP H DINGNGIEPD+RN PA
Sbjct  399  HDNCRGVLVGERTFGKGLIQSVFELRDGSGVVVTVGKYVTPKHKDINGNGIEPDYRNFPA  458

Query  411  WNEVSKHLSKCHKPKDG  361
            W+ V++HLS+C+  + G
Sbjct  459  WSNVTQHLSQCNMLQRG  475



>ref|XP_004295422.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=468

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+ VLVGDRT+GKGLIQSVFELQDGSGVVVT+GKYVTPNH DINGNGIEPD+RN P 
Sbjct  392  HDNCKGVLVGDRTFGKGLIQSVFELQDGSGVVVTVGKYVTPNHKDINGNGIEPDYRNFPG  451

Query  411  WNEVSKHLSKCH  376
            W+++S+ LS+C+
Sbjct  452  WSDISQRLSQCN  463



>ref|XP_008443944.1| PREDICTED: C-terminal processing peptidase, chloroplastic [Cucumis 
melo]
Length=490

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL DGSGV VT+GKYVTPNH DINGNGIEPDF+N PA
Sbjct  414  HDNCKAVLVGERTYGKGLIQSVFELHDGSGVAVTVGKYVTPNHKDINGNGIEPDFQNFPA  473

Query  411  WNEVSKHLSKCHKPKDG  361
            W++V++ LS+C   + G
Sbjct  474  WSDVTERLSQCSILRQG  490



>ref|XP_010926329.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X5 [Elaeis guineensis]
Length=448

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL DGSGVVVTIGKYVTPNHMDINGNG+EPDF  LPA
Sbjct  372  HDNCKAVLVGERTYGKGLIQSVFELHDGSGVVVTIGKYVTPNHMDINGNGVEPDFPRLPA  431

Query  411  WNEVSKHLSKCHKPKDG  361
             +EV  +LS C  P  G
Sbjct  432  LSEVRNYLSHCQTPLMG  448



>ref|XP_010926312.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X3 [Elaeis guineensis]
Length=473

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL DGSGVVVTIGKYVTPNHMDINGNG+EPDF  LPA
Sbjct  397  HDNCKAVLVGERTYGKGLIQSVFELHDGSGVVVTIGKYVTPNHMDINGNGVEPDFPRLPA  456

Query  411  WNEVSKHLSKCHKPKDG  361
             +EV  +LS C  P  G
Sbjct  457  LSEVRNYLSHCQTPLMG  473



>ref|XP_010926256.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010926264.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Elaeis guineensis]
 ref|XP_010926281.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=488

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL DGSGVVVTIGKYVTPNHMDINGNG+EPDF  LPA
Sbjct  412  HDNCKAVLVGERTYGKGLIQSVFELHDGSGVVVTIGKYVTPNHMDINGNGVEPDFPRLPA  471

Query  411  WNEVSKHLSKCHKPKDG  361
             +EV  +LS C  P  G
Sbjct  472  LSEVRNYLSHCQTPLMG  488



>ref|XP_010926294.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Elaeis guineensis]
 ref|XP_010926303.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=484

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL DGSGVVVTIGKYVTPNHMDINGNG+EPDF  LPA
Sbjct  408  HDNCKAVLVGERTYGKGLIQSVFELHDGSGVVVTIGKYVTPNHMDINGNGVEPDFPRLPA  467

Query  411  WNEVSKHLSKCHKPKDG  361
             +EV  +LS C  P  G
Sbjct  468  LSEVRNYLSHCQTPLMG  484



>ref|XP_010926320.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X4 [Elaeis guineensis]
Length=469

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL DGSGVVVTIGKYVTPNHMDINGNG+EPDF  LPA
Sbjct  393  HDNCKAVLVGERTYGKGLIQSVFELHDGSGVVVTIGKYVTPNHMDINGNGVEPDFPRLPA  452

Query  411  WNEVSKHLSKCHKPKDG  361
             +EV  +LS C  P  G
Sbjct  453  LSEVRNYLSHCQTPLMG  469



>ref|XP_002519743.1| Carboxyl-terminal-processing protease precursor, putative [Ricinus 
communis]
 gb|EEF42716.1| Carboxyl-terminal-processing protease precursor, putative [Ricinus 
communis]
Length=491

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 72/93 (77%), Gaps = 16/93 (17%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLP-  415
            HDNCRAVLVG+RT+GKGLIQSVFEL DGSGVVVT+GKYVTPNHMDINGNGIEPD+RN P 
Sbjct  399  HDNCRAVLVGERTFGKGLIQSVFELHDGSGVVVTVGKYVTPNHMDINGNGIEPDYRNFPV  458

Query  414  ---------------AWNEVSKHLSKCHKPKDG  361
                           AW++V++HLS+C+  + G
Sbjct  459  KWQEPLIVEEPSLYAAWSDVTRHLSQCNMNRQG  491



>ref|XP_008364177.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
[Malus domestica]
Length=471

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCR VLVG+RT+GKGLIQSVFEL+DGSGVVVT+GKYVTP H DINGNGIEPDFR  PA
Sbjct  395  HDNCRGVLVGERTFGKGLIQSVFELRDGSGVVVTVGKYVTPKHKDINGNGIEPDFRKFPA  454

Query  411  WNEVSKHLSKCHKPKDG  361
            W++V++ LS+C   + G
Sbjct  455  WSDVTQRLSQCSMLQRG  471



>ref|XP_009406283.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009406284.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RT+GKGLIQSV+EL DGSGVVVTIGKYVTPN+ DING+GIEPDFR LPA
Sbjct  416  HDNCKAVLVGERTFGKGLIQSVYELDDGSGVVVTIGKYVTPNYKDINGDGIEPDFRRLPA  475

Query  411  WNEVSKHLSKCH  376
             NEV+ +LS+CH
Sbjct  476  LNEVTNYLSQCH  487



>ref|XP_004147402.1| PREDICTED: carboxyl-terminal-processing protease-like [Cucumis 
sativus]
 ref|XP_004171819.1| PREDICTED: carboxyl-terminal-processing protease-like [Cucumis 
sativus]
 gb|KGN65570.1| hypothetical protein Csa_1G458990 [Cucumis sativus]
Length=489

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL DGSGV VT+GKYVTPNH DINGNGIEPDF++ PA
Sbjct  413  HDNCKAVLVGERTYGKGLIQSVFELHDGSGVAVTVGKYVTPNHKDINGNGIEPDFQSFPA  472

Query  411  WNEVSKHLSKCHKPKDG  361
            W++V++ LS+C   + G
Sbjct  473  WSDVTERLSQCSILRQG  489



>ref|XP_009406285.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=452

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RT+GKGLIQSV+EL DGSGVVVTIGKYVTPN+ DING+GIEPDFR LPA
Sbjct  376  HDNCKAVLVGERTFGKGLIQSVYELDDGSGVVVTIGKYVTPNYKDINGDGIEPDFRRLPA  435

Query  411  WNEVSKHLSKCH  376
             NEV+ +LS+CH
Sbjct  436  LNEVTNYLSQCH  447



>gb|EPS62840.1| hypothetical protein M569_11946, partial [Genlisea aurea]
Length=420

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 70/98 (71%), Gaps = 25/98 (26%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLP-  415
            HDNCRAVLVG+RTYGKGLIQSVFEL DGSGVV+T+GKYVTPN +DINGNGI+PDFRNLP 
Sbjct  320  HDNCRAVLVGERTYGKGLIQSVFELHDGSGVVITVGKYVTPNRLDINGNGIDPDFRNLPS  379

Query  414  ------------------------AWNEVSKHLSKCHK  373
                                    AW+E S++LSKCHK
Sbjct  380  KIFFFTFLRYRRYRMNEMYIYICAAWDEASRYLSKCHK  417



>ref|XP_008797514.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797515.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Phoenix dactylifera]
Length=488

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL DGSGVVVTIGKY TPNH+DINGNG+EPDF  LPA
Sbjct  412  HDNCKAVLVGERTYGKGLIQSVFELHDGSGVVVTIGKYATPNHLDINGNGVEPDFPRLPA  471

Query  411  WNEVSKHLSKCHKP  370
             +EV  +LS+C  P
Sbjct  472  LSEVRNYLSRCQTP  485



>ref|XP_006646179.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
[Oryza brachyantha]
Length=455

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG++T+GKGLIQSVFEL DGSG+VVT+GKYVTPNH DINGNGIEPD+R LP 
Sbjct  379  HDNCKAVLVGEKTFGKGLIQSVFELHDGSGIVVTVGKYVTPNHKDINGNGIEPDYRRLPD  438

Query  411  WNEVSKHLSKCH  376
            +NE +++LS+C 
Sbjct  439  FNEATEYLSRCQ  450



>ref|XP_010666703.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=478

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG++TYGKGLIQSVFEL DGSGVVVT+GKYVTP H DINGNGIEPDF N+P 
Sbjct  402  HDNCKAVLVGEKTYGKGLIQSVFELHDGSGVVVTVGKYVTPGHSDINGNGIEPDFSNIPR  461

Query  411  WNEVSKHLSKCHKPK  367
            W++V+++LS C+  K
Sbjct  462  WSKVTEYLSTCNLSK  476



>ref|NP_001043789.2| Os01g0664000 [Oryza sativa Japonica Group]
 gb|EAY75274.1| hypothetical protein OsI_03161 [Oryza sativa Indica Group]
 dbj|BAF05703.2| Os01g0664000 [Oryza sativa Japonica Group]
Length=474

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG++T+GKGLIQSVFEL DGSG+VVT+GKYVTPNH DINGNGIEPD+R +P 
Sbjct  398  HDNCKAVLVGEKTFGKGLIQSVFELHDGSGIVVTVGKYVTPNHKDINGNGIEPDYRRIPD  457

Query  411  WNEVSKHLSKCH  376
            +NE +++LS+C 
Sbjct  458  FNEATEYLSRCR  469



>gb|AIA26575.1| serine protease [Cicer arietinum]
Length=476

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 69/92 (75%), Gaps = 15/92 (16%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLP-  415
            HDNCRAVLVG RT+GKGLIQSVFELQDGSGVV+T+GKYVTP H DINGNGIEPDF+ LP 
Sbjct  385  HDNCRAVLVGKRTFGKGLIQSVFELQDGSGVVITVGKYVTPKHKDINGNGIEPDFQKLPV  444

Query  414  --------------AWNEVSKHLSKCHKPKDG  361
                          AW++VS+HL+KC   + G
Sbjct  445  KLQYGFHDLSPIFAAWDDVSQHLTKCSMLQQG  476



>gb|EAZ12995.1| hypothetical protein OsJ_02915 [Oryza sativa Japonica Group]
Length=474

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG++T+GKGLIQSVFEL DGSG+VVT+GKYVTPNH DINGNGIEPD+R +P 
Sbjct  398  HDNCKAVLVGEKTFGKGLIQSVFELHDGSGIVVTVGKYVTPNHKDINGNGIEPDYRRIPD  457

Query  411  WNEVSKHLSKCH  376
            +NE +++LS+C 
Sbjct  458  FNEATEYLSRCR  469



>dbj|BAD72341.1| carboxy-terminal proteinase-like [Oryza sativa Japonica Group]
Length=461

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG++T+GKGLIQSVFEL DGSG+VVT+GKYVTPNH DINGNGIEPD+R +P 
Sbjct  385  HDNCKAVLVGEKTFGKGLIQSVFELHDGSGIVVTVGKYVTPNHKDINGNGIEPDYRRIPD  444

Query  411  WNEVSKHLSKCH  376
            +NE +++LS+C 
Sbjct  445  FNEATEYLSRCR  456



>ref|XP_010243687.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Nelumbo nucifera]
Length=476

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RTYGKGLIQSVFEL DGSGVVVT+GKYVTPNHMDINGNGIEPDFRN+P 
Sbjct  408  HDNCRAVLVGERTYGKGLIQSVFELHDGSGVVVTVGKYVTPNHMDINGNGIEPDFRNIPV  467

Query  411  WNEVSKHLS  385
             + V   +S
Sbjct  468  SSRVGATIS  476



>ref|XP_002456095.1| hypothetical protein SORBIDRAFT_03g030380 [Sorghum bicolor]
 gb|EES01215.1| hypothetical protein SORBIDRAFT_03g030380 [Sorghum bicolor]
Length=463

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RT+GKGLIQSVFEL DGSG+VVT+GKYVTPNH DINGNGIEPD+  LP 
Sbjct  387  HDNCKAVLVGERTFGKGLIQSVFELHDGSGIVVTVGKYVTPNHKDINGNGIEPDYNRLPD  446

Query  411  WNEVSKHLSKCH  376
            +NE   +LS+C 
Sbjct  447  FNEARDYLSRCR  458



>gb|AAL99044.1|AF487526_1 D1 protease-like protein precursor [Triticum aestivum]
Length=400

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RT+GKGLIQSVFEL DGSG+VVT+GKYVTPNH DING+GIEPD+R LP 
Sbjct  324  HDNCKAVLVGERTFGKGLIQSVFELHDGSGIVVTVGKYVTPNHKDINGDGIEPDYRRLPD  383

Query  411  WNEVSKHLSKCHKPK  367
             NE   +L +C   K
Sbjct  384  LNEARDYLMRCQSKK  398



>ref|XP_004969441.1| PREDICTED: C-terminal processing peptidase, chloroplastic-like 
[Setaria italica]
Length=457

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RT+GKGLIQSVFEL DGSG+VVT+GKYVTP+H DINGNGIEPD+  LP 
Sbjct  381  HDNCKAVLVGERTFGKGLIQSVFELHDGSGIVVTVGKYVTPDHKDINGNGIEPDYNRLPD  440

Query  411  WNEVSKHLSKCH  376
            +NE   +LS+C 
Sbjct  441  FNEARDYLSRCR  452



>gb|ACG26821.1| carboxyl-terminal-processing protease precursor [Zea mays]
Length=463

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RT+GKGLIQSVFEL DGSG+VVT+GKYVTPNH DINGNGIEPD+  LP 
Sbjct  387  HDNCKAVLVGERTFGKGLIQSVFELHDGSGIVVTVGKYVTPNHKDINGNGIEPDYNRLPD  446

Query  411  WNEVSKHLSKC  379
            +NE    LS+C
Sbjct  447  FNEARDFLSRC  457



>ref|XP_003569507.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
[Brachypodium distachyon]
Length=456

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RTYGKGLIQSVFEL DGSG+VVT+GKYVTPNH DING+GIEPD+  LP 
Sbjct  380  HDNCKAVLVGERTYGKGLIQSVFELYDGSGIVVTVGKYVTPNHQDINGDGIEPDYHRLPG  439

Query  411  WNEVSKHLSKCHKPK  367
             NE   +L +C   K
Sbjct  440  LNEARDYLLRCEGKK  454



>ref|XP_010538514.1| PREDICTED: carboxyl-terminal-processing peptidase 1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=477

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLP  415
            HDNC+AVLVG+RTYGKGLIQSVFEL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLP
Sbjct  411  HDNCKAVLVGERTYGKGLIQSVFELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLP  469



>gb|AFW56122.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
Length=515

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG++T+GKGLIQSVFEL DGSG+VVT+GKY+TPNH DINGNGIEPD+  LP 
Sbjct  393  HDNCKAVLVGEKTFGKGLIQSVFELHDGSGIVVTVGKYMTPNHKDINGNGIEPDYNRLPD  452

Query  411  WNEVSKHLSKC  379
            +NE   +LS+C
Sbjct  453  FNEARGYLSRC  463



>dbj|BAB11094.1| carboxy-terminal proteinase D1-like protein [Arabidopsis thaliana]
Length=488

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/59 (92%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLP  415
            HDNC+AVLVG+RTYGKGLIQSV+EL+DGSGVVVTIGKYVTPNHMDING GIEPDFRNLP
Sbjct  413  HDNCKAVLVGERTYGKGLIQSVYELRDGSGVVVTIGKYVTPNHMDINGGGIEPDFRNLP  471



>gb|KCW73750.1| hypothetical protein EUGRSUZ_E023602, partial [Eucalyptus grandis]
 gb|KCW73751.1| hypothetical protein EUGRSUZ_E023602, partial [Eucalyptus grandis]
Length=263

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLP  415
            HDNCRAVLVG+RT+GKGLIQSVFEL DGSGVVVTIGKY TPNHMDINGNGIEPD+R+LP
Sbjct  178  HDNCRAVLVGERTFGKGLIQSVFELDDGSGVVVTIGKYATPNHMDINGNGIEPDYRSLP  236



>gb|EMS58174.1| Carboxyl-terminal-processing protease [Triticum urartu]
Length=154

 Score =   114 bits (284),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 68/100 (68%), Gaps = 7/100 (7%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNC+AVLVG+RT+GKGLIQSVFEL DGSG+VVT+GKYVTPNH DING+GIEPD+R LP 
Sbjct  49   HDNCKAVLVGERTFGKGLIQSVFELHDGSGIVVTVGKYVTPNHKDINGDGIEPDYRRLPG  108

Query  411  WNEVSKHLSKCHKPKDG*HQGFRWFRGSRALPLQIIIHVR  292
             N          K +DG  +  R   G R       + VR
Sbjct  109  KNN-------GRKIRDGRKKSRRREEGGRVYKEGNTLEVR  141



>gb|KDO78061.1| hypothetical protein CISIN_1g012084mg [Citrus sinensis]
Length=454

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/59 (90%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLP  415
            HDNCRAVLVG++T+GKGLIQSV+EL DGSGVVVTIGKYVTPNHMDINGNGIEPD+RNLP
Sbjct  395  HDNCRAVLVGEKTFGKGLIQSVYELHDGSGVVVTIGKYVTPNHMDINGNGIEPDYRNLP  453



>gb|KHG18570.1| Carboxyl-terminal-processing protease [Gossypium arboreum]
Length=514

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/59 (86%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLP  415
            HDNCRAVLVG+RT+GKGLIQSVFEL+DGSGVV+T+G+YVTPNH+DINGNGIEPDFRN P
Sbjct  397  HDNCRAVLVGERTFGKGLIQSVFELRDGSGVVITVGQYVTPNHLDINGNGIEPDFRNFP  455



>gb|ABR16649.1| unknown [Picea sitchensis]
Length=500

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRA+LVG+RT+GKGLIQSV+EL+DGS VVVT+GKYVTP H DI+GNGIEPDF   P 
Sbjct  417  HDNCRAILVGERTFGKGLIQSVYELEDGSAVVVTVGKYVTPTHRDIDGNGIEPDFHYRPG  476

Query  411  WNEVSKHLSKCHKPKD  364
              E  K LS+C  P +
Sbjct  477  LVEAKKTLSRCRVPAE  492



>gb|ABR16660.1| unknown [Picea sitchensis]
Length=472

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRA+LVG+RT+GKGLIQSV+EL+DGS VVVT+GKYVTP H DI+GNGIEPDF   P 
Sbjct  389  HDNCRAILVGERTFGKGLIQSVYELEDGSAVVVTVGKYVTPTHRDIDGNGIEPDFHYRPG  448

Query  411  WNEVSKHLSKCHKPKD  364
              E  K LS+C  P +
Sbjct  449  LVEAKKTLSRCRVPAE  464



>ref|XP_010100991.1| Carboxyl-terminal-processing protease [Morus notabilis]
 gb|EXB86582.1| Carboxyl-terminal-processing protease [Morus notabilis]
Length=501

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG+RT+GKGLIQSVFEL DGSGVVVT+GKYVTPNH D+NGNGIEPD+ N PA
Sbjct  406  HDNCRAVLVGERTFGKGLIQSVFELHDGSGVVVTVGKYVTPNHKDLNGNGIEPDYHNFPA  465



>ref|XP_002965587.1| hypothetical protein SELMODRAFT_143443 [Selaginella moellendorffii]
 gb|EFJ33007.1| hypothetical protein SELMODRAFT_143443 [Selaginella moellendorffii]
Length=318

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVL G RT+GKGLIQSVFE  DGSGV++T+GKY+TP H DI+GNG+EPDF  +P 
Sbjct  242  HDNCRAVLAGSRTFGKGLIQSVFEFNDGSGVILTVGKYMTPAHRDIDGNGLEPDFWRMPG  301

Query  411  WNEVSKHLSKCHKPK  367
              EV + L  C   K
Sbjct  302  HLEVEQKLRACLSKK  316



>ref|XP_001775798.1| predicted protein [Physcomitrella patens]
 gb|EDQ59337.1| predicted protein [Physcomitrella patens]
Length=384

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVLVG RT+GKGLIQ+V+EL DGSGVV+T+GKYVTP H DI+G GIEPDF  LP 
Sbjct  304  HDNCRAVLVGKRTFGKGLIQAVYELSDGSGVVLTVGKYVTPGHQDIDGVGIEPDFNQLPD  363

Query  411  WNEVSKHLSKCHKPK  367
             NE    L++C   K
Sbjct  364  SNEGLGKLAQCKMMK  378



>emb|CAA62434.1| C-terminal peptidase of the D1 protein [Hordeum vulgare subsp. 
vulgare]
Length=354

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = -3

Query  591  HDNCRA-VLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLP  415
            HDNC++ V    RT+GKGLIQSVFEL DGSG+VVT+GKYVTPNH DING+GI+PD+R LP
Sbjct  277  HDNCKSCVSSARRTFGKGLIQSVFELHDGSGIVVTVGKYVTPNHKDINGDGIKPDYRRLP  336

Query  414  AWNEVSKHLSKCHKPK  367
              NE   +L +C   K
Sbjct  337  DLNEARDYLLRCQSKK  352



>ref|XP_002994603.1| hypothetical protein SELMODRAFT_432513 [Selaginella moellendorffii]
 gb|EFJ04331.1| hypothetical protein SELMODRAFT_432513 [Selaginella moellendorffii]
Length=434

 Score =   104 bits (260),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVL G RT+GKGLIQSVFE  DGSGV++T+GKY+TP H DI+GNG+EPDF  +PA
Sbjct  370  HDNCRAVLAGSRTFGKGLIQSVFEFNDGSGVILTVGKYMTPAHRDIDGNGLEPDFWRMPA  429



>ref|XP_001760142.1| predicted protein [Physcomitrella patens]
 gb|EDQ74898.1| predicted protein, partial [Physcomitrella patens]
Length=364

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLP  415
            HDNCRAVLVG RT+GKGLIQ+V+EL DGSGVV+T+GKYVTP H+DI+G GIEPD++  P
Sbjct  297  HDNCRAVLVGQRTFGKGLIQAVYELSDGSGVVLTVGKYVTPKHLDIDGAGIEPDYKQPP  355



>ref|XP_002968066.1| hypothetical protein SELMODRAFT_33876, partial [Selaginella moellendorffii]
 gb|EFJ30320.1| hypothetical protein SELMODRAFT_33876, partial [Selaginella moellendorffii]
Length=343

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLP  415
            HDNCRAVL G RT+GKGLIQSVFE  DGSGV++T+GKY+TP H DI+GNG+EPDF  +P
Sbjct  283  HDNCRAVLAGSRTFGKGLIQSVFEFNDGSGVILTVGKYMTPAHRDIDGNGLEPDFWRMP  341



>ref|XP_007025178.1| Peptidase S41 family protein isoform 2, partial [Theobroma cacao]
 gb|EOY27800.1| Peptidase S41 family protein isoform 2, partial [Theobroma cacao]
Length=439

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = -3

Query  543  GLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNEVSKHL  388
            GLIQSVFEL+DGSGVVVT+GKYVTPNH+DINGNGIEPD+RN PAWN+V++HL
Sbjct  388  GLIQSVFELRDGSGVVVTVGKYVTPNHLDINGNGIEPDYRNFPAWNDVAQHL  439



>ref|XP_007511360.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17481.1| predicted protein [Bathycoccus prasinos]
Length=612

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -3

Query  588  DNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAW  409
            DNCRA +VG +TYGKGLIQSV+EL DGSGVV+T+G+YVTP  +DI+  GI PDF   P +
Sbjct  538  DNCRATVVGSKTYGKGLIQSVYELSDGSGVVLTVGRYVTPKFVDIDRTGITPDFAMFPGF  597

Query  408  NEVSKHLSKCHKPK  367
                K L  C  PK
Sbjct  598  EVSKKSLDACELPK  611



>ref|XP_002946313.1| hypothetical protein VOLCADRAFT_86465 [Volvox carteri f. nagariensis]
 gb|EFJ53308.1| hypothetical protein VOLCADRAFT_86465 [Volvox carteri f. nagariensis]
Length=1050

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVL G RTYGKGLIQSV+EL DGSG+V+T+GKY+TP   DI+  GI+PDF ++P+
Sbjct  872  HDNCRAVLAGSRTYGKGLIQSVYELSDGSGLVITVGKYLTPRGTDIDRYGIKPDFNSVPS  931

Query  411  WNEVSKHLSKC  379
              +    +  C
Sbjct  932  GTQYDSTIKAC  942



>ref|XP_003079056.1| peptidase S41 family protein (ISS), partial [Ostreococcus tauri]
Length=386

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DNCRA +VG RTYGKGLIQSV+EL D SG+V+T+GKYVTP+ +DI+  GI P+F   P 
Sbjct  310  KDNCRATVVGSRTYGKGLIQSVYELSDLSGMVLTVGKYVTPSLVDIDQTGITPNFVMFPG  369

Query  411  WNEVSKHLSKCHKP  370
            ++  +K +  C  P
Sbjct  370  FDAAAKEIGACKVP  383



>ref|XP_002506449.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67707.1| predicted protein [Micromonas sp. RCC299]
Length=444

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DNCRA + G +TYGKGLIQSV+EL DGSG+V+T+GKYVTP   DI+  GI P+F   P 
Sbjct  367  KDNCRATVAGSKTYGKGLIQSVYELSDGSGLVLTVGKYVTPGLNDIDRQGITPNFAMFPG  426

Query  411  WNEVSKHLSKCHKP  370
            + +  + L  C +P
Sbjct  427  FQKAQEELGACERP  440



>ref|XP_005847877.1| hypothetical protein CHLNCDRAFT_145217 [Chlorella variabilis]
 gb|EFN55775.1| hypothetical protein CHLNCDRAFT_145217 [Chlorella variabilis]
Length=495

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DNCRAVL G RTYGKGLIQSV+EL DGSG+V+T+GKYVTP+  DI+  G+ PDFR  P 
Sbjct  397  QDNCRAVLAGSRTYGKGLIQSVYELSDGSGLVLTVGKYVTPSGTDIDREGLRPDFRAQPG  456

Query  411  WNEVSKHLSKCH  376
                 + +  C 
Sbjct  457  AAAADQAIHACR  468



>emb|CEF97765.1| Interphotoreceptor retinol-binding [Ostreococcus tauri]
Length=431

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DNCRA +VG RTYGKGLIQSV+EL D SG+V+T+GKYVTP+ +DI+  GI P+F   P 
Sbjct  355  KDNCRATVVGSRTYGKGLIQSVYELSDLSGMVLTVGKYVTPSLVDIDQTGITPNFVMFPG  414

Query  411  WNEVSKHLSKCHKP  370
            ++  +K +  C  P
Sbjct  415  FDAAAKEIGACKVP  428



>ref|XP_003063156.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH52292.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=349

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DNCRA + G RTYGKGLIQSV+EL DGSG+V+T+GKYVTP+  D++  GI P+F   P 
Sbjct  273  KDNCRATVAGSRTYGKGLIQSVYELSDGSGLVLTVGKYVTPSLEDLDRVGIAPNFGMFPG  332

Query  411  WNEVSKHLSKCHKP  370
            + + ++ LS C  P
Sbjct  333  FAKANETLSHCEVP  346



>ref|XP_001696273.1| tail-specific protease [Chlamydomonas reinhardtii]
 gb|EDP08250.1| tail-specific protease [Chlamydomonas reinhardtii]
Length=678

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDNCRAVL G RTYGKGLIQSV+EL DGSG+V+T+GKY+TP   DI+  GI PD+ ++P+
Sbjct  592  HDNCRAVLAGGRTYGKGLIQSVYELSDGSGLVITVGKYLTPRGTDIDRYGIMPDYSSVPS  651

Query  411  WNEVSKHLSKC  379
             ++    +  C
Sbjct  652  NSQYDSAVKAC  662



>ref|XP_001417628.1| D1 proceesing peptidase [Ostreococcus lucimarinus CCE9901]
 gb|ABO95921.1| D1 proceesing peptidase [Ostreococcus lucimarinus CCE9901]
Length=446

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DNCRA +VG +TYGKGLIQSV+EL D SG+V+T+GKYVTP  +DI+  GI P+F   P 
Sbjct  370  KDNCRATVVGSKTYGKGLIQSVYELSDLSGMVLTVGKYVTPGLVDIDQTGISPNFMMFPG  429

Query  411  WNEVSKHLSKCHKP  370
            ++  ++ +  C  P
Sbjct  430  FDAAAREIDACKVP  443



>ref|XP_005652247.1| ClpP/crotonase [Coccomyxa subellipsoidea C-169]
 gb|EIE27703.1| ClpP/crotonase [Coccomyxa subellipsoidea C-169]
Length=447

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 2/74 (3%)
 Frame = -3

Query  591  HDNCRAVLVG--DRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNL  418
            HDNCRA+LV     TYGKGLIQSV+EL D SG+V+T+GKY+TP   DI+  G++PDFR++
Sbjct  368  HDNCRALLVLALSSTYGKGLIQSVYELSDSSGLVLTVGKYLTPARTDIDREGLKPDFRHM  427

Query  417  PAWNEVSKHLSKCH  376
            P+    ++ LS C 
Sbjct  428  PSSTAAAETLSACR  441



>ref|XP_011399412.1| Carboxyl-terminal-processing protease [Auxenochlorella protothecoides]
 gb|KFM26480.1| Carboxyl-terminal-processing protease [Auxenochlorella protothecoides]
Length=912

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/69 (57%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -3

Query  585  NCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWN  406
            NCRAV+ G +T+GKGLIQSV+EL DGSG+V+T+GKY TP  +DI+  GI+PDFR++P   
Sbjct  834  NCRAVVAGRQTFGKGLIQSVYELSDGSGLVLTVGKYFTPAGVDIDREGIQPDFRSVPDQQ  893

Query  405  EVSKHLSKC  379
            +  + L  C
Sbjct  894  QAEEVLRAC  902



>ref|XP_005706724.1| carboxyl-terminal processing protease [Galdieria sulphuraria]
 gb|EME30204.1| carboxyl-terminal processing protease [Galdieria sulphuraria]
Length=490

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 8/81 (10%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF----R  424
            HDNCRAVLVG++T+GKGL+Q+VF L DG G+++T+ +Y TPNH +I+  GIEPD     R
Sbjct  401  HDNCRAVLVGEKTFGKGLVQAVFGLSDGGGLILTVAEYQTPNHTNIHKKGIEPDIYLKQR  460

Query  423  N----LPAWNEVSKHLSKCHK  373
            N    +  W+++ K L +C +
Sbjct  461  NPISVIREWDKIDKQLCQCRQ  481



>ref|WP_011378408.1| MULTISPECIES: peptidase S41 [Synechococcus]
 gb|ABB58360.1| C-terminal processing peptidase-2. Serine peptidase. MEROPS family 
S41A [Synechococcus elongatus PCC 7942]
 gb|AJD57175.1| carboxyl-terminal protease [Synechococcus sp. UTEX 2973]
Length=407

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA+LVGDRT+GKGLIQS+FEL DG+G+ VT+ KY TPNH DIN  GI+PD 
Sbjct  317  QDNERAILVGDRTFGKGLIQSLFELSDGAGLAVTVAKYETPNHNDINKQGIQPDL  371



>ref|WP_006511217.1| C-terminal processing peptidase [Xenococcus sp. PCC 7305]
 gb|ELS01661.1| C-terminal processing peptidase [Xenococcus sp. PCC 7305]
Length=410

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RAVLVG+ TYGKGLIQS+FEL D SG+ VT+ KY TPNH DIN  GIEPDF
Sbjct  319  QDNGRAVLVGETTYGKGLIQSLFELPDDSGIAVTVAKYETPNHTDINKLGIEPDF  373



>ref|WP_011244082.1| peptidase S41 [Synechococcus elongatus]
 dbj|BAD79962.1| carboxyl-terminal processing protease [Synechococcus elongatus 
PCC 6301]
Length=407

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA+LVGDRT+GKGLIQS+FEL DG+G+ VT+ +Y TPNH DIN  GI+PD 
Sbjct  317  QDNERAILVGDRTFGKGLIQSLFELSDGAGLAVTVAEYETPNHNDINKQGIQPDL  371



>ref|WP_026082444.1| carboxyl-terminal protease [Mastigocladopsis repens]
Length=414

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RAVLVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNGRAVLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKQGIKPD  376



>ref|WP_040654924.1| carboxyl-terminal protease [Rubidibacter lacunae]
Length=413

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNL  418
             DN RAVLVG+RT+GKGLIQS+FEL D SG+ VT+ KY TPNH DI+  GI PD+  L
Sbjct  322  QDNVRAVLVGERTFGKGLIQSLFELPDASGMAVTVAKYETPNHTDIHQKGISPDYEVL  379



>ref|WP_041034080.1| carboxyl-terminal protease [Tolypothrix campylonemoides]
 gb|KIJ77955.1| carboxyl-terminal protease [Tolypothrix campylonemoides VB511288]
Length=414

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RAVLVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNGRAVLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKQGIKPD  376



>gb|ERN42743.1| C-terminal peptidase (prc) [Rubidibacter lacunae KORDI 51-2]
Length=425

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNL  418
             DN RAVLVG+RT+GKGLIQS+FEL D SG+ VT+ KY TPNH DI+  GI PD+  L
Sbjct  334  QDNVRAVLVGERTFGKGLIQSLFELPDASGMAVTVAKYETPNHTDIHQKGISPDYEVL  391



>ref|WP_028090602.1| carboxyl-terminal protease [Dolichospermum circinale]
Length=410

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+RT+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  327  QDNHRAQLVGERTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  380



>ref|WP_035367839.1| carboxyl-terminal protease [Dolichospermum circinale]
Length=410

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+RT+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  327  QDNHRAQLVGERTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  380



>ref|WP_044291752.1| carboxyl-terminal protease [Rivularia sp. PCC 7116]
Length=414

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI PD
Sbjct  320  QDNKRATLVGEKTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGITPD  373



>ref|WP_042153271.1| carboxyl-terminal protease [Planktothrix agardhii]
 gb|KEI66523.1| CtpA [Planktothrix agardhii NIVA-CYA 126/8]
Length=411

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDN RA LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DIN  GI PD R +P+
Sbjct  321  HDNHRATLVGEKTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHTDINKLGIMPD-RVIPS  379



>gb|AFY54937.1| C-terminal processing peptidase-2 [Rivularia sp. PCC 7116]
Length=433

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI PD
Sbjct  339  QDNKRATLVGEKTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGITPD  392



>ref|WP_015169836.1| C-terminal processing peptidase [Synechococcus sp. PCC 7502]
 gb|AFY75185.1| C-terminal processing peptidase [Synechococcus sp. PCC 7502]
Length=445

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
            HDN RA L+G RTYGKGL+QS+F L+DG+G+ VTI  Y TPNH DI+ +GI+PD   +PA
Sbjct  343  HDNGRARLLGTRTYGKGLVQSLFTLEDGAGLAVTIAHYQTPNHTDIHKSGIQPDVEVIPA  402



>ref|WP_026788871.1| carboxyl-terminal protease [Planktothrix rubescens]
Length=412

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
            HDN RA LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DIN  GI PD
Sbjct  321  HDNHRATLVGEKTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHTDINKLGIMPD  374



>ref|WP_009149164.1| peptidase S41 [Moorea producens]
 gb|EGJ30787.1| serine peptidase, MEROPS family S41A [Moorea producens 3L]
Length=411

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA LVG++T+GKGLIQS+FEL DGSG+ VT+ KY TPNH DIN  GIEPD 
Sbjct  320  QDNGRAKLVGEKTFGKGLIQSLFELIDGSGLAVTVAKYETPNHRDINKLGIEPDL  374



>ref|WP_026794530.1| MULTISPECIES: carboxyl-terminal protease [Planktothrix]
Length=411

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
            HDN RA LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DIN  GI PD
Sbjct  321  HDNHRATLVGEKTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHTDINKLGIMPD  374



>ref|WP_026797118.1| MULTISPECIES: carboxyl-terminal protease [Planktothrix]
Length=411

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
            HDN RA LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DIN  GI PD
Sbjct  321  HDNHRATLVGEKTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHTDINKLGIMPD  374



>ref|WP_016866280.1| peptidase S41 [Fischerella muscicola]
Length=415

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNGRAILVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  376



>ref|WP_009456991.1| MULTISPECIES: peptidase S41 [Fischerella]
 gb|EHC14100.1| carboxyl-terminal protease [Fischerella sp. JSC-11]
Length=415

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNGRAILVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  376



>ref|WP_027842882.1| carboxyl-terminal protease [Mastigocoleus testarum]
Length=414

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GIEPD
Sbjct  323  QDNGRAQLVGETTFGKGLIQSLFELSDGSGMAVTIAKYETPNHRDINKLGIEPD  376



>ref|WP_039737517.1| carboxyl-terminal protease [Hassallia byssoidea]
 gb|KIF37895.1| carboxyl-terminal protease [Hassallia byssoidea VB512170]
Length=413

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 48/67 (72%), Gaps = 7/67 (10%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD      
Sbjct  323  QDNNRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD------  376

Query  411  WNEVSKH  391
              E+S+H
Sbjct  377  -KEISQH  382



>ref|WP_039201316.1| carboxyl-terminal protease, partial [Aphanizomenon flos-aquae]
 gb|KHG41767.1| carboxyl-terminal protease, partial [Aphanizomenon flos-aquae 
2012/KM1/D3]
Length=231

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA L+G+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  136  QDNHRAQLIGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  189



>ref|WP_006105412.1| peptidase S41 [Coleofasciculus chthonoplastes]
 gb|EDX71703.1| C-terminal processing peptidase subfamily [Coleofasciculus chthonoplastes 
PCC 7420]
Length=412

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA LVG+RT+GKGLIQS+F+L DGSG+ VT+ KY TPNH DIN  GI PD+
Sbjct  320  QDNGRAELVGERTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHRDINKLGITPDW  374



>ref|WP_017747653.1| peptidase S41 [Scytonema hofmanni]
Length=413

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RA+LVG+ T+GKGLIQS+FEL +G+G+ VTI KY TPNH DIN  GI+PD R
Sbjct  323  QDNKRALLVGETTFGKGLIQSLFELSNGAGLAVTIAKYETPNHHDINKLGIQPDMR  378



>ref|WP_011610886.1| peptidase S41 [Trichodesmium erythraeum]
 gb|ABG50500.1| C-terminal processing peptidase-2. Serine peptidase. MEROPS family 
S41A [Trichodesmium erythraeum IMS101]
Length=412

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH+DIN  GI PD
Sbjct  321  QDNGRAMLVGEKTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHIDINKQGIIPD  374



>ref|WP_016876627.1| peptidase S41 [Chlorogloeopsis fritschii]
Length=415

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNGRATLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHKDINKLGIKPD  376



>ref|WP_026086846.1| carboxyl-terminal protease [Fischerella muscicola]
Length=415

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNRRATLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHKDINKLGIKPD  376



>gb|AFZ00838.1| C-terminal processing peptidase-2 [Calothrix sp. PCC 6303]
Length=410

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  319  QDNHRATLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  372



>ref|WP_041739300.1| carboxyl-terminal protease [Calothrix parietina]
Length=413

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  322  QDNHRATLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  375



>ref|WP_017310516.1| peptidase S41 [Fischerella sp. PCC 9339]
Length=415

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNDRATLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHKDINKLGIKPD  376



>gb|KIJ84025.1| carboxyl-terminal protease [Scytonema tolypothrichoides VB-61278]
Length=413

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG+ T+GKGLIQS++EL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  322  QDNGRAILVGETTFGKGLIQSLYELSDGSGLAVTIAKYETPNHRDINKLGIKPD  375



>ref|WP_044449365.1| carboxyl-terminal protease [Mastigocladus laminosus]
 gb|KIY13482.1| carboxyl-terminal protease [Mastigocladus laminosus UU774]
Length=415

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNDRATLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHKDINKLGIKPD  376



>ref|WP_036946641.1| carboxyl-terminal protease, partial [Pseudanabaena sp. PCC 6802]
Length=420

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA LVG +TYGKGLIQS+FEL+DGSG+ VTI KY TP+H DIN  GI PD 
Sbjct  339  QDNGRASLVGTKTYGKGLIQSLFELEDGSGLAVTIAKYETPSHRDINKVGITPDL  393



>ref|WP_016951818.1| peptidase S41 [Anabaena sp. PCC 7108]
Length=414

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  376



>ref|WP_017287738.1| hypothetical protein [Leptolyngbya boryana]
Length=412

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA ++G++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DIN  GI+PD
Sbjct  321  QDNARATIIGEKTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHTDINRLGIQPD  374



>ref|WP_011320161.1| peptidase S41 [Anabaena variabilis]
 gb|ABA23047.1| C-terminal processing peptidase-2, Serine peptidase, MEROPS family 
S41A [Anabaena variabilis ATCC 29413]
Length=417

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  376



>ref|WP_041269215.1| carboxyl-terminal protease, partial [Geitlerinema sp. PCC 7407]
Length=410

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VT+ KY TPNH DIN  GI+PD
Sbjct  320  QDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTVAKYETPNHHDINKLGIQPD  373



>ref|WP_015206408.1| C-terminal processing peptidase-2 [Cylindrospermum stagnale]
 gb|AFZ23152.1| C-terminal processing peptidase-2 [Cylindrospermum stagnale PCC 
7417]
Length=414

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHHDINKLGIKPD  376



>ref|WP_015212946.1| C-terminal processing peptidase-2 [Anabaena cylindrica]
 gb|AFZ56293.1| C-terminal processing peptidase-2 [Anabaena cylindrica PCC 7122]
Length=411

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  320  QDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  373



>gb|AFY68008.1| C-terminal processing peptidase-2 [Geitlerinema sp. PCC 7407]
Length=431

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VT+ KY TPNH DIN  GI+PD
Sbjct  320  QDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTVAKYETPNHHDINKLGIQPD  373



>ref|WP_019490098.1| peptidase S41 [Calothrix sp. PCC 7103]
Length=413

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TP H DIN  GI+PD
Sbjct  323  QDNGRAILVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPQHHDINKIGIKPD  376



>ref|WP_036479806.1| carboxyl-terminal protease [Myxosarcina sp. GI1]
Length=409

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA+LVG +T+GKGLIQS+FEL DG+G+ VT+ KY TPNH DIN  GI PD+
Sbjct  318  QDNDRALLVGQKTFGKGLIQSLFELPDGAGLAVTVAKYETPNHKDINKLGILPDW  372



>ref|WP_037222741.1| carboxyl-terminal protease [Richelia intracellularis]
 emb|CDN15250.1| Periplasmic protease [Richelia intracellularis]
Length=414

 Score = 81.6 bits (200),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNGRAQLVGETTFGKGLIQSLFELADGSGLAVTIAKYETPNHRDINKLGIKPD  376



>ref|WP_008051315.1| peptidase S41 [Arthrospira sp. PCC 8005]
 emb|CCE16956.1| carboxyl-terminal processing protease; C-terminal processing 
peptidase-2. Serine peptidase. MEROPS family S41 [Arthrospira 
sp. PCC 8005]
 emb|CDM95561.1| carboxyl-terminal processing protease; C-terminal processing 
peptidase-2. Serine peptidase. MEROPS family S41 [Arthrospira 
sp. PCC 8005]
Length=406

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN RA+LVG++T+GKGLIQS+F+L DGSG+ VT+  Y TPNH DIN  GI+PD R + +
Sbjct  321  QDNHRALLVGEKTFGKGLIQSLFDLSDGSGLAVTVAHYETPNHTDINKQGIQPD-RIVKS  379

Query  411  WNEVSKHLSKCHKPK  367
             N +   L+    P+
Sbjct  380  PNLMRSQLATEADPQ  394



>ref|WP_009341660.1| peptidase S41 [Raphidiopsis brookii]
 gb|EFA74238.1| Peptidase S41A [Raphidiopsis brookii D9]
Length=406

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  311  QDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  364



>ref|WP_015083378.1| C-terminal processing peptidase [Anabaena sp. 90]
 gb|AFW96823.1| C-terminal processing peptidase [Anabaena sp. 90]
Length=415

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  326  QDNHRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  379



>ref|WP_018399148.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=414

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA L+GDRT+GKGLIQS+FEL D +G+ VT+ KY TP+H DIN  GI PD+
Sbjct  321  QDNGRAQLIGDRTFGKGLIQSLFELPDDAGLAVTVAKYETPDHRDINKQGIAPDY  375



>ref|WP_015229936.1| C-terminal processing peptidase [Dactylococcopsis salina]
 gb|AFZ50945.1| C-terminal processing peptidase [Dactylococcopsis salina PCC 
8305]
Length=415

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RA +VG+ T+GKGLIQS+F+L D SG+ VT+ KY TPNH DIN  GIEPD++
Sbjct  325  QDNDRATIVGETTFGKGLIQSLFDLPDDSGIAVTVAKYETPNHRDINKAGIEPDYK  380



>gb|EDZ92600.1| carboxyl-terminal protease [Arthrospira maxima CS-328]
Length=416

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG++T+GKGLIQS+F+L DGSG+ VT+  Y TPNH DIN  GI+PD
Sbjct  331  QDNHRALLVGEKTFGKGLIQSLFDLSDGSGLAVTVAHYETPNHTDINKQGIKPD  384



>ref|WP_039933688.1| carboxyl-terminal protease [Arthrospira maxima]
Length=406

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN RA+LVG++T+GKGLIQS+F+L DGSG+ VT+  Y TPNH DIN  GI+PD R + +
Sbjct  321  QDNHRALLVGEKTFGKGLIQSLFDLSDGSGLAVTVAHYETPNHTDINKQGIKPD-RIVKS  379

Query  411  WNEVSKHLSKCHKPK  367
             N +   L+    P+
Sbjct  380  PNLMRSQLATEADPQ  394



>ref|WP_009555551.1| C-terminal processing peptidase-2 [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ70955.1| C-terminal processing peptidase-2 [Oscillatoriales cyanobacterium 
JSC-12]
Length=420

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA +VG+RT+GKGLIQS+F+L DGSG+ VT+ KY TP H+DIN  GI+PD 
Sbjct  329  KDNGRATIVGERTFGKGLIQSLFDLSDGSGLAVTVAKYETPGHIDINKQGIKPDI  383



>ref|WP_035760169.1| carboxyl-terminal protease [Arthrospira platensis]
Length=406

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN RA+LVG++T+GKGLIQS+F+L DGSG+ VT+  Y TPNH DIN  GI+PD R + +
Sbjct  321  QDNHRALLVGEKTFGKGLIQSLFDLSDGSGLAVTVAHYETPNHTDINKQGIKPD-RIVKS  379

Query  411  WNEVSKHLSKCHKPK  367
             N +   L+    P+
Sbjct  380  PNLMRSQLATEADPQ  394



>gb|EKD06860.1| carboxyl-terminal protease [Arthrospira platensis C1]
Length=416

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN RA+LVG++T+GKGLIQS+F+L DGSG+ VT+  Y TPNH DIN  GI+PD R + +
Sbjct  331  QDNHRALLVGEKTFGKGLIQSLFDLSDGSGLAVTVAHYETPNHTDINKQGIKPD-RIVKS  389

Query  411  WNEVSKHLSKCHKPK  367
             N +   L+    P+
Sbjct  390  PNLMRSQLATEADPQ  404



>ref|WP_015140150.1| C-terminal processing peptidase [Nostoc sp. PCC 7524]
 gb|AFY49730.1| C-terminal processing peptidase [Nostoc sp. PCC 7524]
Length=417

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA L+G+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  323  QDNGRAKLLGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  376



>gb|EAW43605.1| Peptidase S41A [Nodularia spumigena CCY9414]
 gb|AHJ30814.1| carboxyl-terminal processing protease [Nodularia spumigena CCY9414]
Length=414

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TP H DIN  GI+PD
Sbjct  320  QDNGRATLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPQHRDINKLGIKPD  373



>ref|WP_017804367.1| peptidase S41 [Nodularia spumigena]
Length=417

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TP H DIN  GI+PD
Sbjct  323  QDNGRATLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPQHRDINKLGIKPD  376



>ref|WP_027404374.1| carboxyl-terminal protease [Aphanizomenon flos-aquae]
Length=417

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA L+G+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  327  QDNHRAQLIGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPD  380



>ref|WP_015222000.1| C-terminal processing peptidase-2 [Cyanobacterium stanieri]
 gb|AFZ46682.1| C-terminal processing peptidase-2 [Cyanobacterium stanieri PCC 
7202]
Length=403

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA+LVG++TYGKGLIQS+FEL DG+G+ VT+ KY TP H DIN  GI PD 
Sbjct  319  QDNHRAILVGEKTYGKGLIQSLFELPDGAGLAVTVAKYETPKHKDINKLGITPDL  373



>ref|WP_019504598.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=414

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG++T+GKGLIQS+FEL DGSG+ VT+ KY TP+H DIN  GI PD
Sbjct  322  QDNHRALLVGEKTFGKGLIQSLFELPDGSGLAVTVAKYETPSHKDINKLGIMPD  375



>ref|WP_017661268.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=414

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA LVG+RT+GKGLIQS+F+L D SG+ VT+ KY TPNH DIN  GI PDF
Sbjct  323  QDNGRAKLVGERTFGKGLIQSLFDLSDDSGLAVTVAKYETPNHKDINKLGIMPDF  377



>ref|WP_026722361.1| carboxyl-terminal protease [Fischerella sp. PCC 9431]
Length=415

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TP+H DIN  GI+PD
Sbjct  323  QDNGRATLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPSHKDINKLGIKPD  376



>gb|KIE08669.1| carboxyl-terminal protease [Tolypothrix bouteillei VB521301]
Length=413

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RA+LVG+ T+GKGLIQS+FEL +G+G+ VTI KY TPNH DIN  GI+PD +
Sbjct  323  QDNKRALLVGETTFGKGLIQSLFELSNGAGLAVTIAKYETPNHHDINKLGIKPDMQ  378



>ref|WP_015174802.1| C-terminal processing peptidase-2 [Oscillatoria nigro-viridis]
 gb|AFZ05474.1| C-terminal processing peptidase-2 [Oscillatoria nigro-viridis 
PCC 7112]
Length=412

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DIN  GI PD
Sbjct  321  QDNGRAQLVGEKTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHKDINKLGIAPD  374



>ref|WP_015129801.1| C-terminal processing peptidase-2 [Calothrix sp. PCC 7507]
 gb|AFY33994.1| C-terminal processing peptidase-2 [Calothrix sp. PCC 7507]
Length=415

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TP H DIN  GI+PD
Sbjct  324  QDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPKHRDINKLGIKPD  377



>ref|WP_015115192.1| C-terminal processing peptidase-2 [Nostoc sp. PCC 7107]
 gb|AFY44998.1| C-terminal processing peptidase-2 [Nostoc sp. PCC 7107]
Length=415

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TP H DIN  GI+PD
Sbjct  323  QDNGRAKLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPQHRDINKLGIKPD  376



>ref|WP_006277346.1| peptidase S41 [Cylindrospermopsis raciborskii]
 gb|EFA69771.1| Peptidase S41A [Cylindrospermopsis raciborskii CS-505]
Length=419

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+F+L DGSG+ VTI KY TPNH DIN  GI+PD
Sbjct  324  QDNGRAELVGETTFGKGLIQSLFQLTDGSGLAVTIAKYETPNHRDINKLGIKPD  377



>ref|WP_027268870.1| carboxyl-terminal protease [Leptolyngbya sp. PCC 6406]
Length=420

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RAVLVG  T+GKGLIQS+F+L DGSG+VVT+ KY TP H DIN +GI PD R
Sbjct  329  QDNQRAVLVGGITFGKGLIQSLFDLSDGSGLVVTVAKYETPAHHDINRSGIRPDQR  384



>ref|WP_021829198.1| carboxyl-terminal processing protease [Crocosphaera watsonii]
 emb|CCQ49050.1| carboxyl-terminal processing protease [Crocosphaera watsonii 
WH 8502]
Length=413

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TPNH DI+  GIEPD
Sbjct  322  KDNRRATLVGEKTFGKGLIQSLFELPDGAGLAVTVAKYETPNHNDIHKLGIEPD  375



>ref|WP_026731031.1| carboxyl-terminal protease [Fischerella sp. PCC 9605]
Length=415

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TP H DIN  GI+PD
Sbjct  323  QDNGRATLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPQHKDINKLGIKPD  376



>ref|WP_017653214.1| peptidase S41 [Microchaete sp. PCC 7126]
Length=411

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TP H DIN  GI+PD
Sbjct  324  QDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPKHRDINKLGIKPD  377



>ref|WP_007307145.1| peptidase S41 [Crocosphaera watsonii]
 gb|EAM49099.1| Peptidase S41A, C-terminal protease [Crocosphaera watsonii WH 
8501]
 emb|CCQ64093.1| Carboxyl-terminal-processing protease precursor [Crocosphaera 
watsonii WH 0401]
Length=413

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TPNH DI+  GIEPD
Sbjct  322  KDNRRATLVGEKTFGKGLIQSLFELPDGAGLAVTVAKYETPNHNDIHKLGIEPD  375



>gb|AFY89531.1| C-terminal processing peptidase-2 [Chroococcidiopsis thermalis 
PCC 7203]
Length=411

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA +VG++T+GKGLIQS+FEL DGSG+ VT+ KY TPNH DI+  GI PD 
Sbjct  319  QDNRRAKIVGEKTFGKGLIQSLFELSDGSGMAVTVAKYETPNHRDIHKQGIVPDL  373



>ref|WP_041462557.1| carboxyl-terminal protease [Chroococcidiopsis thermalis]
Length=412

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA +VG++T+GKGLIQS+FEL DGSG+ VT+ KY TPNH DI+  GI PD 
Sbjct  320  QDNRRAKIVGEKTFGKGLIQSLFELSDGSGMAVTVAKYETPNHRDIHKQGIVPDL  374



>emb|CCQ68523.1| carboxyl-terminal processing protease [Crocosphaera watsonii 
WH 0402]
Length=397

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TPNH DI+  GIEPD
Sbjct  306  KDNGRATLVGEKTFGKGLIQSLFELPDGAGLAVTVAKYETPNHNDIHKLGIEPD  359



>ref|WP_007312203.1| peptidase S41 [Crocosphaera watsonii]
 gb|EHJ10946.1| carboxyl-terminal processing protease [Crocosphaera watsonii 
WH 0003]
Length=413

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TPNH DI+  GIEPD
Sbjct  322  KDNGRATLVGEKTFGKGLIQSLFELPDGAGLAVTVAKYETPNHNDIHKLGIEPD  375



>gb|ERT06714.1| C-terminal processing peptidase family protein [Lyngbya aestuarii 
BL J]
Length=402

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DI+  GI+PD
Sbjct  311  QDNLRAQLVGEKTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHHDIHKLGIKPD  364



>ref|WP_015193901.1| carboxyl-terminal protease [Stanieria cyanosphaera]
 gb|AFZ36233.1| carboxyl-terminal protease [Stanieria cyanosphaera PCC 7437]
Length=411

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TP+H DIN  GI PD
Sbjct  320  QDNGRALLVGEKTFGKGLIQSLFELPDGAGLAVTVAKYETPSHRDINKLGITPD  373



>ref|WP_026101674.1| carboxyl-terminal protease [cyanobacterium PCC 7702]
Length=415

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA L+G+ T+GKGLIQS+FEL DGSG+ VTI KY TP H DIN  GI+PD 
Sbjct  323  QDNGRARLIGETTFGKGLIQSLFELSDGSGLAVTIAKYETPKHKDINKLGIKPDL  377



>ref|WP_012407120.1| peptidase S41 [Nostoc punctiforme]
 gb|ACC79094.1| carboxyl-terminal protease [Nostoc punctiforme PCC 73102]
Length=414

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TP H DIN  GI+PD
Sbjct  323  QDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPQHRDINKLGIKPD  376



>ref|WP_007353399.1| MULTISPECIES: peptidase S41 [Kamptonema]
 emb|CBN54172.1| C-terminal processing peptidase-2 [ [[Oscillatoria] sp. PCC 6506]
Length=413

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DIN  GI PD
Sbjct  321  QDNGRAKLVGEKTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHTDINKLGIMPD  374



>ref|WP_040484141.1| carboxyl-terminal protease [Lyngbya aestuarii]
Length=412

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DI+  GI+PD
Sbjct  321  QDNLRAQLVGEKTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHHDIHKLGIKPD  374



>ref|WP_013190873.1| peptidase S41 [Trichormus azollae]
 gb|ADI63855.1| carboxyl-terminal protease ['Nostoc azollae' 0708]
Length=413

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TP H DIN  GI+PD
Sbjct  323  QDNKRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPKHRDINKLGIKPD  376



>ref|WP_010997570.1| peptidase S41 [Nostoc sp. PCC 7120]
 dbj|BAB75119.1| carboxyl-terminal processing protease [Nostoc sp. PCC 7120]
Length=417

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TPNH DIN  GI+P+
Sbjct  323  QDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPNHRDINKLGIKPN  376



>ref|WP_015185760.1| C-terminal processing peptidase [Microcoleus sp. PCC 7113]
 gb|AFZ21631.1| C-terminal processing peptidase [Microcoleus sp. PCC 7113]
Length=412

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RA LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DI+  GI+PD  
Sbjct  319  QDNGRAKLVGEKTFGKGLIQSLFDLTDGSGLAVTVAKYETPNHRDIHKLGIQPDLE  374



>ref|WP_041429564.1| carboxyl-terminal protease, partial [Thermosynechococcus sp. 
NK55a]
Length=396

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             D+ RA LVGDRTYGKG IQS+F L DGSG+ VTI  Y TPNH +IN  GIEPD R L A
Sbjct  315  QDHGRARLVGDRTYGKGSIQSLFSLSDGSGLAVTIAHYETPNHHNINKVGIEPDRRVLDA  374



>gb|AHB88260.1| periplasmic carboxyl-terminal processing protease CtpA [Thermosynechococcus 
sp. NK55a]
Length=412

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             D+ RA LVGDRTYGKG IQS+F L DGSG+ VTI  Y TPNH +IN  GIEPD R L A
Sbjct  320  QDHGRARLVGDRTYGKGSIQSLFSLSDGSGLAVTIAHYETPNHHNINKVGIEPDRRVLDA  379



>ref|WP_015201861.1| carboxyl-terminal protease [Crinalium epipsammum]
 gb|AFZ11739.1| carboxyl-terminal protease [Crinalium epipsammum PCC 9333]
Length=411

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DIN  GI PD
Sbjct  320  QDNGRAKLVGEKTFGKGLIQSLFDLPDGSGIAVTVAKYETPNHHDINKLGITPD  373



>ref|WP_009783169.1| peptidase S41 [Lyngbya sp. PCC 8106]
 gb|EAW38288.1| Peptidase S41A [Lyngbya sp. PCC 8106]
Length=412

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DI+  GI+PD
Sbjct  321  QDNLRAQLVGEKTFGKGLIQSLFDLPDGSGLAVTVAKYETPNHHDIHKLGIKPD  374



>ref|WP_009633511.1| C-terminal processing peptidase [Synechocystis sp. PCC 7509]
Length=414

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+F+L DG+G+ VT+ KY TPNH DIN  GI PD
Sbjct  323  QDNGRATLVGETTFGKGLIQSLFDLSDGAGIAVTVAKYETPNHRDINKLGIAPD  376



>ref|WP_041922662.1| carboxyl-terminal protease [Cyanobacterium aponinum]
Length=415

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA L+G+ T+GKGLIQS+FEL DG+G+ +T+ KY TPNH DIN  GI P+
Sbjct  319  QDNQRATLIGETTFGKGLIQSLFELPDGAGIAITVAKYETPNHKDINKKGITPN  372



>gb|AFZ52917.1| C-terminal processing peptidase-2 [Cyanobacterium aponinum PCC 
10605]
Length=420

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA L+G+ T+GKGLIQS+FEL DG+G+ +T+ KY TPNH DIN  GI P+
Sbjct  324  QDNQRATLIGETTFGKGLIQSLFELPDGAGIAITVAKYETPNHKDINKKGITPN  377



>ref|WP_006633249.1| peptidase S41 [Microcoleus vaginatus]
 gb|EGK87693.1| carboxyl-terminal protease [Microcoleus vaginatus FGP-2]
Length=412

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+ T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DIN  GI PD
Sbjct  321  QDNGRAQLVGENTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHKDINKLGISPD  374



>ref|WP_017716499.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=410

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DI+  GI PD
Sbjct  319  QDNGRALLVGEKTFGKGLIQSLFDLSDGSGLAVTVAKYETPNHRDIHKLGIVPD  372



>ref|WP_015194200.1| carboxyl-terminal protease [Stanieria cyanosphaera]
 gb|AFZ36534.1| carboxyl-terminal protease [Stanieria cyanosphaera PCC 7437]
Length=430

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RAVLVG +T+GKGL+QSV  L DGSG+ VTI KY+TP+  DIN +GIEPDF
Sbjct  325  QDNDRAVLVGTKTFGKGLVQSVRSLGDGSGLAVTIAKYLTPSGRDINKHGIEPDF  379



>ref|WP_029632223.1| carboxyl-terminal protease [[Scytonema hofmanni] UTEX B 1581]
Length=417

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 47/67 (70%), Gaps = 7/67 (10%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN RA LVG+ T+GKGLIQS+FEL DGSG+ VTI KY TP H DI+  GI+PD      
Sbjct  323  QDNNRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYETPKHRDIHKLGIKPD------  376

Query  411  WNEVSKH  391
              E+S+H
Sbjct  377  -KEISQH  382



>ref|WP_035159238.1| carboxyl-terminal protease [Calothrix sp. 336/3]
 gb|KFB84684.1| carboxyl-terminal protease [Calothrix sp. 336/3]
Length=414

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG  T+GKGLIQS+FEL DGSG+ VTI KY TP H DIN  GI+PD
Sbjct  323  QDNGRATLVGATTFGKGLIQSLFELSDGSGLAVTIAKYETPKHRDINKLGIKPD  376



>ref|WP_036006464.1| carboxyl-terminal protease [Leptolyngbya sp. JSC-1]
Length=416

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG+RT+GKGLIQS+F L DGSG+ VTI KY TP+H DIN  GI PD
Sbjct  323  QDNGRAKLVGERTFGKGLIQSLFNLADGSGLAVTIAKYETPSHHDINRLGISPD  376



>ref|WP_038652044.1| peptidase S41 [Prochlorococcus sp. MIT 0801]
 gb|AIQ96871.1| Carboxyl-terminal protease [Prochlorococcus sp. MIT 0801]
Length=434

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN R VLVG +T+GKGL+QSV  L DGSG+ VT+ KY+TP+  DIN NGIEPD R    
Sbjct  322  KDNKRGVLVGKKTFGKGLVQSVRSLSDGSGLTVTVAKYLTPSGKDINKNGIEPDVRVDLL  381

Query  411  WNEVSK  394
             NE +K
Sbjct  382  LNERNK  387



>ref|WP_014274683.1| carboxyl-terminal processing protease [Arthrospira platensis]
 dbj|BAI89148.1| carboxyl-terminal processing protease [Arthrospira platensis 
NIES-39]
 gb|KDR59093.1| carboxyl-terminal protease [Arthrospira platensis str. Paraca]
Length=407

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 52/75 (69%), Gaps = 1/75 (1%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN RA+LVG++T+GKGLIQS+F+L DG+G+ VT+  Y TPNH DIN  GI PD R + +
Sbjct  321  QDNHRALLVGEKTFGKGLIQSLFDLSDGAGLAVTVAHYETPNHTDINKQGIMPD-RIVKS  379

Query  411  WNEVSKHLSKCHKPK  367
             N +   L+    P+
Sbjct  380  PNLMRSQLATEADPQ  394



>ref|WP_006527095.1| C-terminal processing peptidase [Gloeocapsa sp. PCC 73106]
 gb|ELS00082.1| C-terminal processing peptidase [Gloeocapsa sp. PCC 73106]
Length=412

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RAVLVG++T+GKGLIQS+FEL DGSG+ VT+ KY TP H DIN  GI P+
Sbjct  321  QDNHRAVLVGEKTFGKGLIQSLFELPDGSGLAVTVAKYETPAHKDINKLGIVPN  374



>ref|WP_030007566.1| carboxyl-terminal protease [Synechococcus sp. NKBG042902]
Length=414

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RAVLVG++T+GKGLIQS+FEL DG+G+ VT+ KY TP H DIN  GI PD
Sbjct  320  QDNGRAVLVGEKTFGKGLIQSLFELPDGAGMAVTVAKYETPLHHDINKLGIMPD  373



>ref|WP_035985067.1| peptidase S41 [Leptolyngbya sp. KIOST-1]
Length=432

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RAVLVG RT+GKGL+QSV  L DGSGV +T+ +Y+TPN  DIN NGI PD 
Sbjct  325  RDNERAVLVGTRTFGKGLVQSVRSLGDGSGVAITVARYLTPNGTDINKNGISPDI  379



>ref|WP_010468839.1| peptidase S41 [Acaryochloris sp. CCMEE 5410]
Length=430

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RAVL+G +T+GKGL+QSV  L+DGSG+ VT+ KY TPN  DIN  GIEPD 
Sbjct  324  QDNKRAVLIGTKTFGKGLVQSVHPLEDGSGLAVTVAKYFTPNGRDINKKGIEPDI  378



>ref|WP_019488905.1| peptidase S41 [Calothrix sp. PCC 7103]
Length=429

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RAVLVG +T+GKGL+QSV  L DGSGV VTI KY TPN  DIN +GI+PD +
Sbjct  324  QDNKRAVLVGSQTFGKGLVQSVRPLDDGSGVAVTIAKYFTPNGRDINKHGIDPDIK  379



>ref|WP_015148284.1| C-terminal processing peptidase-2 [Oscillatoria acuminata]
 gb|AFY81640.1| C-terminal processing peptidase-2 [Oscillatoria acuminata PCC 
6304]
Length=412

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG++T+GKGLIQS+F+L DGSG+ VT+ KY TPNH DI+  GI PD
Sbjct  321  QDNGRALLVGEKTFGKGLIQSLFDLADGSGLAVTVAKYETPNHRDIHKLGIVPD  374



>ref|WP_039716394.1| carboxyl-terminal protease [Scytonema millei]
 gb|KIF18888.1| carboxyl-terminal protease [Scytonema millei VB511283]
Length=412

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA +VG++T+GKGLIQS+FEL DGSG+ VT+ KY TP+H DI+  GI PD 
Sbjct  320  QDNGRAKIVGEKTFGKGLIQSLFELSDGSGMAVTVAKYETPSHRDIHKQGIVPDL  374



>ref|WP_010873417.1| peptidase S41 [Synechocystis sp. PCC 6803]
 ref|NP_442119.1| carboxyl-terminal processing protease [Synechocystis sp. PCC 
6803]
 sp|Q55669.1|CTPA_SYNY3 RecName: Full=Carboxyl-terminal-processing protease; AltName: 
Full=CtpA; Flags: Precursor [Synechocystis sp. PCC 6803 substr. 
Kazusa]
 gb|AAA21727.1| protease [Synechocystis sp.]
 dbj|BAA10189.1| carboxyl-terminal processing protease [Synechocystis sp. PCC 
6803]
 dbj|BAK50972.1| carboxyl-terminal processing protease [Synechocystis sp. PCC 
6803]
 dbj|BAL29970.1| carboxyl-terminal processing protease [Synechocystis sp. PCC 
6803 substr. GT-I]
 dbj|BAL33139.1| carboxyl-terminal processing protease [Synechocystis sp. PCC 
6803 substr. PCC-N]
 dbj|BAL36308.1| carboxyl-terminal processing protease [Synechocystis sp. PCC 
6803 substr. PCC-P]
 dbj|BAM54467.1| carboxyl-terminal processing protease [Bacillus subtilis BEST7613]
 gb|AGF52482.1| carboxyl-terminal processing protease [Synechocystis sp. PCC 
6803]
Length=427

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TP H DI+  GI PD
Sbjct  323  QDNQRATLVGEKTFGKGLIQSLFELSDGAGIAVTVAKYETPQHHDIHKLGIMPD  376



>ref|WP_011057446.1| peptidase S41 [Thermosynechococcus elongatus]
 ref|NP_682397.1| carboxyl-terminal processing protease [Thermosynechococcus elongatus 
BP-1]
 dbj|BAC09159.1| carboxyl-terminal processing protease [Thermosynechococcus elongatus 
BP-1]
Length=412

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             D+ RA LVGDRT+GKG IQS+F L DGSG+ VTI  Y TPNH +IN  GIEPD R L A
Sbjct  320  QDHGRARLVGDRTFGKGSIQSLFHLSDGSGLAVTIAHYETPNHHNINKVGIEPDRRVLDA  379



>emb|CDO99364.1| unnamed protein product [Coffea canephora]
Length=254

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN RA L G++T+GKG IQSVFEL DGSG+ VT+ +Y TP H DI+  GI PD+R LPA
Sbjct  166  KDNKRATLFGEQTFGKGKIQSVFELSDGSGLAVTVARYETPAHTDIDKVGIIPDYR-LPA  224



>ref|WP_036907132.1| peptidase S41 [Prochlorococcus marinus]
 gb|KGG19516.1| Carboxyl-terminal protease [Prochlorococcus marinus str. PAC1]
Length=434

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN R VLVG +T+GKGL+QSV  L DGSG+ VT+ KY+TP+  DIN NGI PD R    
Sbjct  322  KDNKRGVLVGKKTFGKGLVQSVRSLSDGSGLTVTVAKYLTPSGKDINKNGIAPDIRADLL  381

Query  411  WNEVSK  394
             NE +K
Sbjct  382  LNEKNK  387



>ref|WP_011823450.1| peptidase S41 [Prochlorococcus marinus]
 gb|ABM75294.1| carboxyl-terminal processing protease [Prochlorococcus marinus 
str. NATL1A]
Length=434

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN R VLVG +T+GKGL+QSV  L DGSG+ VT+ KY+TP+  DIN NGI PD R    
Sbjct  322  KDNKRGVLVGKKTFGKGLVQSVRSLSDGSGLTVTVAKYLTPSGKDINKNGIAPDIRADLL  381

Query  411  WNEVSK  394
             NE +K
Sbjct  382  LNEKNK  387



>ref|WP_012195344.1| peptidase S41 [Prochlorococcus marinus]
 gb|ABX08722.1| carboxyl-terminal processing protease [Prochlorococcus marinus 
str. MIT 9211]
Length=450

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN R +LVG +T+GKGL+QSV  L DGSG+ VT+ KY+TPN  DIN NGI+PD +
Sbjct  340  QDNKRGILVGSKTFGKGLVQSVRPLVDGSGITVTVAKYLTPNGTDINKNGIKPDIK  395



>ref|WP_011293644.1| peptidase S41 [Prochlorococcus marinus]
 gb|AAZ57602.1| C-terminal processing peptidase-2, Serine peptidase, MEROPS family 
S41A [Prochlorococcus marinus str. NATL2A]
Length=434

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN R +LVG +T+GKGL+QSV  L DGSG+ VT+ KY+TP+  DIN NGI PD R    
Sbjct  322  KDNKRGILVGKKTFGKGLVQSVRSLSDGSGLTVTVAKYLTPSGKDINKNGIAPDIRADLL  381

Query  411  WNEVSK  394
             NE +K
Sbjct  382  LNEKNK  387



>ref|WP_028948307.1| carboxyl-terminal protease [Synechocystis sp. PCC 6714]
 gb|AIE75847.1| Tail-specific protease [Synechocystis sp. PCC 6714]
Length=414

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TP H DI+  GI PD
Sbjct  323  QDNHRATLVGEKTFGKGLIQSLFELSDGAGIAVTVAKYETPEHHDIHKLGIMPD  376



>ref|WP_015227062.1| C-terminal processing peptidase-2 [Halothece sp. PCC 7418]
 gb|AFZ45190.1| C-terminal processing peptidase-2 [Halothece sp. PCC 7418]
Length=414

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RA +VG+ T+GKGLIQS+F+L D SG+ VT+ KY TP+H DIN  GIEPD+
Sbjct  324  QDNNRAQIVGETTFGKGLIQSLFDLPDDSGIAVTVAKYETPSHRDINEAGIEPDY  378



>ref|WP_015954086.1| peptidase S41 [Cyanothece sp. PCC 7424]
 gb|ACK70480.1| carboxyl-terminal protease [Cyanothece sp. PCC 7424]
Length=416

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN R +L+G++T+GKGLIQS+FEL DGSG+ +T+ KY TPNH DI+  GI PD
Sbjct  325  QDNGRGILLGEKTFGKGLIQSLFELPDGSGLAITVAKYETPNHKDIHKAGIVPD  378



>ref|XP_002181112.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47764.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=356

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
            HDNCRAVL+G++++GKGLIQ+V+ L++G+G+V+T+ +YVTP+  DI G GI PD 
Sbjct  301  HDNCRAVLMGNKSFGKGLIQAVYGLKNGAGLVLTVARYVTPSGNDIQGIGINPDI  355



>ref|WP_015144827.1| C-terminal processing peptidase [Pleurocapsa minor]
 gb|AFY78528.1| C-terminal processing peptidase [Pleurocapsa sp. PCC 7327]
Length=414

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+FEL DG+G+ +T+ KY TP H DI+  GI PD
Sbjct  323  QDNGRATLVGEKTFGKGLIQSLFELPDGAGLAITVAKYETPTHKDIHKQGIVPD  376



>ref|WP_041443794.1| carboxyl-terminal protease [Synechococcus sp. PCC 7002]
Length=413

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TP H DIN  GI PD
Sbjct  319  QDNGRAMLVGEKTFGKGLIQSLFELPDGAGMAVTVAKYETPLHHDINKLGIMPD  372



>sp|P42784.2|CTPA_SYNP2 RecName: Full=Carboxyl-terminal-processing protease; AltName: 
Full=CtpA; Flags: Precursor [Synechococcus sp. PCC 7002]
 gb|ACA98847.1| carboxyl-terminal protease [Synechococcus sp. PCC 7002]
Length=414

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TP H DIN  GI PD
Sbjct  320  QDNGRAMLVGEKTFGKGLIQSLFELPDGAGMAVTVAKYETPLHHDINKLGIMPD  373



>ref|WP_008274661.1| peptidase S41 [Cyanothece sp. CCY0110]
 gb|EAZ92158.1| carboxyl-terminal processing protease [Cyanothece sp. CCY0110]
Length=413

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+FEL DG+G+ +T+ KY TP+H DI+  GI+PD
Sbjct  322  KDNGRATLVGEKTFGKGLIQSLFELPDGAGLAITVAKYETPSHSDIHKLGIQPD  375



>ref|XP_005645927.1| C-terminal processing peptidase [Coccomyxa subellipsoidea C-169]
 gb|EIE21383.1| C-terminal processing peptidase [Coccomyxa subellipsoidea C-169]
Length=433

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVGDRT+GKG IQSVFEL+DGS + VT+ KY TPN  DI+  GI+PD
Sbjct  330  RDNGRATLVGDRTFGKGKIQSVFELEDGSALFVTVAKYRTPNMEDIDKVGIQPD  383



>ref|WP_028948323.1| peptidase S41 [Synechocystis sp. PCC 6714]
 gb|AIE75827.1| carboxyl-terminal protease [Synechocystis sp. PCC 6714]
Length=423

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RAV+VG +T+GKGL+QSV EL DGSG+ VTI KY+TPN  DIN +GI+PD
Sbjct  325  QDNQRAVIVGTKTFGKGLVQSVRELGDGSGMAVTIAKYLTPNGRDINKHGIDPD  378



>ref|WP_010872128.1| peptidase S41 [Synechocystis sp. PCC 6803]
 ref|NP_440818.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 dbj|BAA17498.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 dbj|BAK49672.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 dbj|BAL28671.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31840.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL35009.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM51230.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
 gb|AGF51187.1| carboxyl-terminal protease [Synechocystis sp. PCC 6803]
Length=423

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RAV+VG +T+GKGL+QSV EL DGSG+ VTI KY+TPN  DIN +GI+PD
Sbjct  325  QDNQRAVIVGTKTFGKGLVQSVRELGDGSGMAVTIAKYLTPNGRDINKHGIDPD  378



>ref|WP_012593970.1| MULTISPECIES: peptidase S41 [Cyanothece]
 gb|ACK64693.1| carboxyl-terminal protease [Cyanothece sp. PCC 8801]
 gb|ACU99566.1| carboxyl-terminal protease [Cyanothece sp. PCC 8802]
Length=413

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+L+G++T+GKGLIQS+FEL DG+G+ +T+ KY TPNH DI+  GI PD
Sbjct  322  QDNGRALLIGEKTFGKGLIQSLFELGDGAGLAITVAKYETPNHKDIHKLGIMPD  375



>pir||S26195 probable carboxyl-terminal processing proteinase - Synechococcus 
sp. (PCC 7002) (fragment)
 emb|CAA44776.1| unnamed protein product [Synechococcus sp. PCC 7002]
Length=411

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TP H DIN  GI PD
Sbjct  320  QDNGRAMLVGEKTFGKGLIQSLFELPDGAGMAVTVAKYETPLHHDINKLGIMPD  373



>ref|WP_011317316.1| peptidase S41 [Anabaena variabilis]
 gb|ABA20058.1| C-terminal processing peptidase-2, Serine peptidase, MEROPS family 
S41A [Anabaena variabilis ATCC 29413]
Length=428

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RAV+VG +T+GKGL+QSV  L DGSG+ VTI KY+TPN  DIN +GI+PD +
Sbjct  324  QDNKRAVIVGTQTFGKGLVQSVRPLDDGSGLAVTIAKYLTPNDRDINKHGIDPDVK  379



>ref|WP_010996656.1| peptidase S41 [Nostoc sp. PCC 7120]
 dbj|BAB74199.1| carboxyl-terminal protease [Nostoc sp. PCC 7120]
Length=428

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RAV+VG +T+GKGL+QSV  L DGSG+ VTI KY+TPN  DIN +GI+PD +
Sbjct  324  QDNKRAVIVGTQTFGKGLVQSVRPLDDGSGLAVTIAKYLTPNDRDINKHGIDPDVK  379



>gb|KIJ82862.1| peptidase S41 [Scytonema tolypothrichoides VB-61278]
Length=428

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RAV+VG +T+GKGL+QSV  L DGSG+ VTI KY TPN+ DIN +GI+PD +
Sbjct  324  QDNKRAVIVGSQTFGKGLVQSVRPLDDGSGLAVTIAKYYTPNNRDINKHGIDPDVK  379



>ref|WP_041035928.1| peptidase S41 [Tolypothrix campylonemoides]
 gb|KIJ75733.1| peptidase S41 [Tolypothrix campylonemoides VB511288]
Length=429

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RAVLVG +T+GKGL+QSV  L DGSG+ VTI KY+TP+  DIN +GI+PD +
Sbjct  326  QDNKRAVLVGSQTFGKGLVQSVRPLDDGSGLAVTIAKYLTPSGRDINKHGIDPDIK  381



>ref|WP_012165213.1| peptidase S41 [Acaryochloris marina]
 gb|ABW29940.1| carboxyl--terminal protease [Acaryochloris marina MBIC11017]
Length=430

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RAVL+G +T+GKGL+QSV  L+DGSG+ VT+ KY TP+  DIN  GIEPD 
Sbjct  324  QDNKRAVLIGTKTFGKGLVQSVHPLEDGSGLAVTVAKYFTPSGRDINKKGIEPDI  378



>gb|EWM30018.1| carboxyl-terminal processing protease [Nannochloropsis gaditana]
Length=542

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNL  418
            HDNCRAVL+G RT+GKGL+Q VF L DG G+V+T+ KY TP    I G GI PD   +
Sbjct  452  HDNCRAVLMGQRTFGKGLVQGVFGLNDGKGLVMTVAKYETPRGASIQGTGIFPDIETV  509



>ref|XP_005854463.1| carboxyl-terminal processing protease [Nannochloropsis gaditana 
CCMP526]
 gb|EKU21896.1| carboxyl-terminal processing protease [Nannochloropsis gaditana 
CCMP526]
Length=539

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNL  418
            HDNCRAVL+G RT+GKGL+Q VF L DG G+V+T+ KY TP    I G GI PD   +
Sbjct  449  HDNCRAVLMGQRTFGKGLVQGVFGLNDGKGLVMTVAKYETPRGASIQGTGIFPDIETV  506



>ref|WP_023076562.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
 gb|ESA32676.1| hypothetical protein N836_25510 [Leptolyngbya sp. Heron Island 
J]
Length=432

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RAVLVG +T+GKGL+QSV  L DGSG+ VTI KY+TP+  DIN  GIEPDF
Sbjct  325  QDNNRAVLVGTKTFGKGLVQSVRGLGDGSGIAVTIAKYLTPSGRDINTLGIEPDF  379



>ref|WP_015168366.1| C-terminal processing peptidase [Synechococcus sp. PCC 7502]
 gb|AFY73709.1| C-terminal processing peptidase [Synechococcus sp. PCC 7502]
Length=422

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA+LVG +T+GKGL+QSV  L DGSG+ VTI KY+TPN  DIN +GI+PD
Sbjct  322  QDNKRAILVGTKTFGKGLVQSVVPLGDGSGMAVTIAKYLTPNGTDINHSGIKPD  375



>ref|WP_011143095.1| peptidase S41 [Gloeobacter violaceus]
 ref|NP_926048.1| carboxyl-terminal protease [Gloeobacter violaceus PCC 7421]
 dbj|BAC91043.1| carboxyl-terminal protease [Gloeobacter violaceus PCC 7421]
Length=445

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 49/73 (67%), Gaps = 5/73 (7%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             D+ RAVLVG RTYGKGL+QSV  L DGSGV VTI  Y TP+  DIN  GI+PD +    
Sbjct  321  QDHHRAVLVGTRTYGKGLVQSVHSLSDGSGVAVTIAHYQTPSGRDINKKGIDPDIK----  376

Query  411  WNEVSKHLSKCHK  373
              E++K ++K  K
Sbjct  377  -VELTKEMAKNLK  388



>ref|WP_037221258.1| peptidase S41 [Richelia intracellularis]
 emb|CDN14172.1| carboxyl-terminal protease [Richelia intracellularis]
Length=428

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RAVL+G +T+GKGL+QSV  L DGSGV VTI KY TPN  DIN  GI PD +
Sbjct  324  QDNKRAVLIGAKTFGKGLVQSVRPLDDGSGVAVTIAKYFTPNGRDINKQGIVPDVK  379



>ref|WP_006515294.1| C-terminal processing peptidase [Leptolyngbya sp. PCC 7375]
 gb|EKV00888.1| C-terminal processing peptidase [Leptolyngbya sp. PCC 7375]
Length=432

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF  427
             DN RAVLVG +T+GKGL+QSV  L DGSG+ VTI KY+TP+  DIN  GIEPDF
Sbjct  325  QDNNRAVLVGTKTFGKGLVQSVRGLGDGSGIAVTIAKYLTPSGRDINTLGIEPDF  379



>ref|WP_011130154.1| peptidase S41 [Prochlorococcus marinus]
 emb|CAE20951.1| carboxyl-terminal processing protease [Prochlorococcus marinus 
str. MIT 9313]
Length=453

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPA  412
             DN R VLVG +T+GKGL+QSV  L DGSG+ VTI KY+TP+  DI+ NGI+PD + + +
Sbjct  339  QDNHRGVLVGQKTFGKGLVQSVRGLSDGSGLTVTIAKYLTPSGTDIHKNGIKPDIKAVMS  398

Query  411  WNEV  400
              E+
Sbjct  399  EKEI  402



>ref|WP_044107588.1| carboxyl-terminal protease [cyanobacterium endosymbiont of Epithemia 
turgida]
Length=413

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN R +LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TPNH DI+  GI PD
Sbjct  322  QDNGRGILVGEKTFGKGLIQSLFELPDGAGLAVTVAKYETPNHKDIHRLGIIPD  375



>ref|WP_009543917.1| MULTISPECIES: peptidase S41 [Cyanothece]
Length=413

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN RA LVG++T+GKGLIQS+FEL DG+G+ +T+ KY TP+H DI+  GI+PD
Sbjct  322  QDNGRARLVGEKTFGKGLIQSLFELPDGAGLAITVAKYETPSHNDIHKLGIQPD  375



>gb|EAU71788.1| Peptidase S41A [Synechococcus sp. BL107]
Length=399

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRN  421
             DN RA LVG +T+GKGL+Q+V  L DGSG+ VTI KY+TP   DI+ NGIEPD ++
Sbjct  308  QDNARAKLVGQKTFGKGLVQAVRGLSDGSGLTVTIAKYLTPKGTDIHKNGIEPDVKS  364



>emb|CBN56657.1| C-terminal processing peptidase-2 [ [[Oscillatoria] sp. PCC 6506]
Length=422

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFR  424
             DN RAVLVG +T+GKGL+QSV  + +GSG+ VTI KY TPN  DIN  GIEPDF+
Sbjct  310  QDNKRAVLVGTKTFGKGLVQSVRGVGNGSGMAVTIAKYFTPNGTDINHAGIEPDFK  365



>dbj|BAP17535.1| carboxyl-terminal processing protease [cyanobacterium endosymbiont 
of Epithemia turgida isolate EtSB Lake Yunoko]
Length=407

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD  430
             DN R +LVG++T+GKGLIQS+FEL DG+G+ VT+ KY TPNH DI+  GI PD
Sbjct  316  QDNGRGILVGEKTFGKGLIQSLFELPDGAGLAVTVAKYETPNHKDIHRLGIIPD  369



>ref|WP_037988894.1| peptidase S41, partial [Synechococcus sp. BL107]
Length=417

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  591  HDNCRAVLVGDRTYGKGLIQSVFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRN  421
             DN RA LVG +T+GKGL+Q+V  L DGSG+ VTI KY+TP   DI+ NGIEPD ++
Sbjct  338  QDNARAKLVGQKTFGKGLVQAVRGLSDGSGLTVTIAKYLTPKGTDIHKNGIEPDVKS  394



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160