BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF037M20

Length=652
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009781597.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    326   4e-101   Nicotiana sylvestris
ref|XP_009781599.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    326   4e-101   Nicotiana sylvestris
ref|XP_009781598.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    325   7e-101   Nicotiana sylvestris
ref|XP_009617762.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    321   2e-99    
ref|XP_009617761.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    321   2e-99    Nicotiana tomentosiformis
ref|XP_007199702.1|  hypothetical protein PRUPE_ppa000811mg             317   7e-98    
ref|XP_008235714.1|  PREDICTED: poly [ADP-ribose] polymerase 1          317   1e-97    Prunus mume [ume]
ref|XP_009367708.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    316   1e-97    Pyrus x bretschneideri [bai li]
ref|XP_009367706.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    316   1e-97    Pyrus x bretschneideri [bai li]
ref|XP_006341445.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     316   2e-97    
gb|KDP21330.1|  hypothetical protein JCGZ_21801                         314   7e-97    Jatropha curcas
ref|XP_004235864.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    314   1e-96    Solanum lycopersicum
gb|ACN36904.1|  unknown                                                 294   1e-96    Zea mays [maize]
ref|XP_010318682.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    314   1e-96    Solanum lycopersicum
ref|XP_002521021.1|  poly [ADP-ribose] polymerase, putative             313   3e-96    Ricinus communis
gb|KDO68484.1|  hypothetical protein CISIN_1g035625mg                   311   6e-96    Citrus sinensis [apfelsine]
ref|XP_010038006.1|  PREDICTED: poly [ADP-ribose] polymerase 1          311   1e-95    Eucalyptus grandis [rose gum]
ref|XP_011457987.1|  PREDICTED: poly [ADP-ribose] polymerase 1          311   1e-95    Fragaria vesca subsp. vesca
gb|EYU46476.1|  hypothetical protein MIMGU_mgv1a000724mg                311   2e-95    Erythranthe guttata [common monkey flower]
ref|XP_006443872.1|  hypothetical protein CICLE_v10018683mg             310   3e-95    Citrus clementina [clementine]
ref|XP_009354923.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     310   3e-95    Pyrus x bretschneideri [bai li]
ref|XP_010652358.1|  PREDICTED: poly [ADP-ribose] polymerase 1          309   8e-95    Vitis vinifera
ref|XP_011080022.1|  PREDICTED: poly [ADP-ribose] polymerase 1          308   1e-94    Sesamum indicum [beniseed]
ref|XP_010274828.1|  PREDICTED: poly [ADP-ribose] polymerase 1          308   2e-94    Nelumbo nucifera [Indian lotus]
ref|XP_003554282.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     308   2e-94    Glycine max [soybeans]
ref|XP_010918778.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     307   2e-94    
ref|XP_010679215.1|  PREDICTED: poly [ADP-ribose] polymerase 1          307   3e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009144226.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    306   4e-94    Brassica rapa
ref|XP_009144225.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    306   4e-94    Brassica rapa
ref|XP_011028774.1|  PREDICTED: poly [ADP-ribose] polymerase 1          306   6e-94    Populus euphratica
emb|CDY24761.1|  BnaC04g13660D                                          305   6e-94    Brassica napus [oilseed rape]
ref|XP_008461881.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    305   7e-94    Cucumis melo [Oriental melon]
ref|XP_002302058.2|  poly (ADP-ribose) polymerase family protein        306   7e-94    
gb|KFK31229.1|  hypothetical protein AALP_AA6G085200                    306   7e-94    Arabis alpina [alpine rockcress]
ref|XP_003521279.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    306   1e-93    Glycine max [soybeans]
ref|XP_007162524.1|  hypothetical protein PHAVU_001G159200g             306   2e-93    Phaseolus vulgaris [French bean]
ref|XP_008461878.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    305   2e-93    Cucumis melo [Oriental melon]
ref|XP_010933094.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    305   2e-93    Elaeis guineensis
ref|XP_008461880.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    305   2e-93    Cucumis melo [Oriental melon]
gb|EMS59387.1|  Poly [ADP-ribose] polymerase 1                          293   2e-93    Triticum urartu
ref|XP_010522166.1|  PREDICTED: poly [ADP-ribose] polymerase 1          305   3e-93    Tarenaya hassleriana [spider flower]
emb|CDY10794.1|  BnaA05g11420D                                          307   4e-93    Brassica napus [oilseed rape]
gb|KEH23887.1|  poly(ADP-ribose) polymerase domain protein              305   4e-93    Medicago truncatula
ref|XP_006293618.1|  hypothetical protein CARUB_v10022570mg             304   6e-93    Capsella rubella
ref|NP_850165.1|  poly [ADP-ribose] polymerase 2                        303   2e-92    Arabidopsis thaliana [mouse-ear cress]
gb|ADE76583.1|  unknown                                                 290   3e-92    Picea sitchensis
ref|XP_009398035.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    301   3e-92    
gb|KJB42240.1|  hypothetical protein B456_007G144300                    302   3e-92    Gossypium raimondii
gb|AAD20677.1|  putative poly (ADP-ribose) polymerase                   302   3e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398034.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    301   4e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004493762.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     302   4e-92    
ref|XP_004151977.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     301   4e-92    Cucumis sativus [cucumbers]
ref|XP_002881169.1|  hypothetical protein ARALYDRAFT_902162             301   7e-92    Arabidopsis lyrata subsp. lyrata
ref|XP_008794292.1|  PREDICTED: poly [ADP-ribose] polymerase 1          301   8e-92    Phoenix dactylifera
ref|XP_008801332.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     299   9e-92    Phoenix dactylifera
ref|XP_010469693.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     300   2e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010510210.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     300   2e-91    Camelina sativa [gold-of-pleasure]
gb|EPS63698.1|  hypothetical protein M569_11084                         300   2e-91    Genlisea aurea
ref|XP_010414140.1|  PREDICTED: poly [ADP-ribose] polymerase 1          299   3e-91    Camelina sativa [gold-of-pleasure]
ref|XP_004959167.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     295   1e-90    
ref|XP_007050347.1|  Poly(ADP-ribose) polymerase 2 isoform 1            296   4e-90    
ref|XP_007050348.1|  Poly(ADP-ribose) polymerase 2 isoform 2            296   5e-90    
emb|CAA10889.1|  poly(ADP-ribose) polymerase                            296   5e-90    Zea mays [maize]
tpg|DAA39431.1|  TPA: hypothetical protein ZEAMMB73_927988              296   6e-90    
ref|NP_001288538.1|  poly [ADP-ribose] polymerase 1                     296   6e-90    Zea mays [maize]
ref|XP_002459755.1|  hypothetical protein SORBIDRAFT_02g009900          295   7e-90    
gb|EMT10594.1|  Poly (ADP-ribose) polymerase 1                          288   8e-90    
ref|XP_006657714.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     295   1e-89    Oryza brachyantha
gb|EEC81908.1|  hypothetical protein OsI_25738                          290   5e-88    Oryza sativa Indica Group [Indian rice]
ref|NP_001059453.1|  Os07g0413700                                       290   8e-88    
emb|CDP03723.1|  unnamed protein product                                288   3e-87    Coffea canephora [robusta coffee]
emb|CAN75718.1|  hypothetical protein VITISV_037618                     287   2e-86    Vitis vinifera
ref|XP_003557295.1|  PREDICTED: poly [ADP-ribose] polymerase 1          286   3e-86    Brachypodium distachyon [annual false brome]
gb|KHN10726.1|  Poly [ADP-ribose] polymerase 1                          288   9e-86    Glycine soja [wild soybean]
ref|XP_006410264.1|  hypothetical protein EUTSA_v10016190mg             283   2e-85    
ref|XP_006827511.1|  hypothetical protein AMTR_s00009p00184050          276   2e-83    
ref|XP_010111892.1|  Poly [ADP-ribose] polymerase 1                     271   9e-81    
ref|XP_002969183.1|  hypothetical protein SELMODRAFT_90144              262   9e-78    
ref|XP_002973881.1|  hypothetical protein SELMODRAFT_100128             262   1e-77    
ref|XP_001769461.1|  predicted protein                                  251   1e-73    
ref|XP_007050353.1|  Poly(ADP-ribose) polymerase 2, putative isof...    247   2e-73    
ref|XP_005809620.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     228   3e-71    
gb|ACN58594.1|  Poly synthetase 1                                       224   3e-70    Salmo salar
pdb|2RD6|A  Chain A, Parp Complexed With A861695                        227   4e-69    Homo sapiens [man]
pdb|4L6S|A  Chain A, Parp Complexed With Benzo[1,4]oxazin-3-one I...    227   4e-69    Homo sapiens [man]
pdb|1UK0|A  Chain A, Crystal Structure Of Catalytic Domain Of Hum...    227   4e-69    Homo sapiens [man]
pdb|4GV7|A  Chain A, Human Artd1 (parp1) - Catalytic Domain In Co...    227   4e-69    Homo sapiens [man]
pdb|4HHY|A  Chain A, Crystal Structure Of Parp Catalytic Domain I...    227   4e-69    Homo sapiens [man]
pdb|4PJT|A  Chain A, Structure Of Parp1 Catalytic Domain Bound To...    227   7e-69    Homo sapiens [man]
ref|XP_004333519.1|  Poly(ADPribose) polymerase catalytic domain ...    235   1e-68    Acanthamoeba castellanii str. Neff
emb|CAA46478.1|  Poly(ADP-ribose) polymerase                            228   6e-68    Rattus norvegicus [brown rat]
gb|KFB53217.1|  AGAP003230-PA-like protein                              223   3e-67    Anopheles sinensis
pdb|4DQY|C  Chain C, Structure Of Human Parp-1 Bound To A Dna Dou...    226   4e-67    Homo sapiens [man]
pdb|4OPX|C  Chain C, Structure Of Human Parp-1 Bound To A Dna Dou...    226   4e-67    Homo sapiens [man]
dbj|BAE88881.1|  unnamed protein product                                223   5e-67    Macaca fascicularis [crab eating macaque]
ref|XP_011165140.1|  PREDICTED: poly [ADP-ribose] polymerase-like       231   9e-67    Solenopsis invicta [imported red fire ant]
gb|AAF61293.1|AF126717_1  msPARP                                        224   9e-67    Mus musculus [mouse]
gb|AAB35557.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            227   1e-66    Mus sp. [mice]
gb|AAA51599.1|  poly(ADP-ribose) polymerase                             226   1e-66    Homo sapiens [man]
ref|XP_003971725.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     231   2e-66    Takifugu rubripes [tiger puffer]
ref|XP_004083528.1|  PREDICTED: poly [ADP-ribose] polymerase 1          231   2e-66    Oryzias latipes [Japanese rice fish]
ref|XP_008311174.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    230   4e-66    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008311175.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    229   5e-66    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_007253978.1|  PREDICTED: poly [ADP-ribose] polymerase 1          229   6e-66    
ref|XP_009025261.1|  hypothetical protein HELRODRAFT_95414              229   7e-66    Helobdella robusta
ref|XP_001638875.1|  predicted protein                                  229   7e-66    Nematostella vectensis
ref|XP_003396806.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    229   8e-66    
ref|XP_002163577.2|  PREDICTED: poly [ADP-ribose] polymerase 1-like     219   8e-66    Hydra vulgaris
ref|XP_007071821.1|  PREDICTED: poly [ADP-ribose] polymerase 1          229   8e-66    
ref|XP_001177436.2|  PREDICTED: poly [ADP-ribose] polymerase 1-like     228   1e-65    
ref|XP_005289622.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    228   1e-65    Chrysemys picta bellii
ref|XP_005289623.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    228   1e-65    
ref|XP_004605484.1|  PREDICTED: poly [ADP-ribose] polymerase 1          228   2e-65    Sorex araneus [Eurasian shrew]
ref|XP_007552911.1|  PREDICTED: poly [ADP-ribose] polymerase 1          228   2e-65    Poecilia formosa
gb|AAB35560.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            224   2e-65    Xenopus
ref|XP_006118141.1|  PREDICTED: poly [ADP-ribose] polymerase 1          229   3e-65    
gb|KFD59055.1|  hypothetical protein M513_00218                         227   3e-65    Trichuris suis
ref|XP_006625727.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     227   3e-65    
ref|NP_037195.1|  poly [ADP-ribose] polymerase 1                        228   3e-65    Rattus norvegicus [brown rat]
ref|XP_010732988.1|  PREDICTED: poly [ADP-ribose] polymerase 1          227   3e-65    
gb|KHJ46115.1|  Poly(ADP-ribose) polymerase catalytic domain protein    227   4e-65    Trichuris suis
gb|AAB35558.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            223   4e-65    Bos taurus [bovine]
pdb|1EFY|A  Chain A, Crystal Structure Of The Catalytic Fragment ...    216   4e-65    Gallus gallus [bantam]
ref|XP_010972367.1|  PREDICTED: poly [ADP-ribose] polymerase 1          227   4e-65    Camelus bactrianus [camel]
pdb|1A26|A  Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) P...    216   5e-65    Gallus gallus [bantam]
ref|XP_006744107.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   5e-65    Leptonychotes weddellii
ref|XP_004690817.1|  PREDICTED: poly [ADP-ribose] polymerase 1          227   5e-65    
ref|XP_005454773.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    227   5e-65    
ref|XP_010158766.1|  PREDICTED: poly [ADP-ribose] polymerase 1          213   6e-65    Eurypyga helias
ref|XP_003449904.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    226   6e-65    Oreochromis niloticus
ref|XP_003999138.2|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    226   6e-65    
ref|XP_010780561.1|  PREDICTED: poly [ADP-ribose] polymerase 1          225   6e-65    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011289117.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    226   6e-65    
ref|XP_005734478.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    226   6e-65    
ref|XP_005914567.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    226   7e-65    Haplochromis burtoni
ref|XP_004541848.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     226   7e-65    Maylandia zebra
ref|XP_005914568.1|  PREDICTED: poly [ADP-ribose] polymerase 1-li...    226   7e-65    
ref|XP_006797147.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     226   7e-65    Neolamprologus brichardi [lyretail cichlid]
ref|XP_010990763.1|  PREDICTED: poly [ADP-ribose] polymerase 1          226   7e-65    Camelus dromedarius [camel]
ref|XP_006188179.1|  PREDICTED: poly [ADP-ribose] polymerase 1          226   7e-65    Camelus ferus
ref|XP_005906361.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     223   7e-65    Bos mutus
ref|XP_011232467.1|  PREDICTED: poly [ADP-ribose] polymerase 1          226   9e-65    
gb|EFB29647.1|  hypothetical protein PANDA_016433                       226   9e-65    Ailuropoda melanoleuca
ref|XP_006198888.1|  PREDICTED: poly [ADP-ribose] polymerase 1          226   1e-64    Vicugna pacos
ref|XP_011063716.1|  PREDICTED: poly [ADP-ribose] polymerase isof...    226   1e-64    Acromyrmex echinatior
ref|XP_011254366.1|  PREDICTED: poly [ADP-ribose] polymerase            226   1e-64    Camponotus floridanus
ref|XP_008396025.1|  PREDICTED: poly [ADP-ribose] polymerase 1          226   1e-64    Poecilia reticulata
ref|XP_005349022.1|  PREDICTED: poly [ADP-ribose] polymerase 1          226   1e-64    Microtus ochrogaster [prairie voles]
gb|AAH37545.1|  Poly (ADP-ribose) polymerase 1                          226   1e-64    Homo sapiens [man]
gb|AAA60137.1|  poly(ADP-ribose) polymerase                             226   1e-64    Homo sapiens [man]
ref|NP_001609.2|  poly [ADP-ribose] polymerase 1                        226   1e-64    Homo sapiens [man]
dbj|BAG35260.1|  unnamed protein product                                226   1e-64    Homo sapiens [man]
gb|AAB59447.1|  poly(ADP-ribose) synthetase                             226   1e-64    Homo sapiens [man]
dbj|BAE39743.1|  unnamed protein product                                226   1e-64    Mus musculus [mouse]
gb|ABM82562.1|  poly (ADP-ribose) polymerase family, member 1           226   1e-64    synthetic construct
ref|XP_004653313.1|  PREDICTED: poly [ADP-ribose] polymerase 1          225   2e-64    Jaculus jaculus
dbj|BAE41080.1|  unnamed protein product                                225   2e-64    Mus musculus [mouse]
dbj|BAG10250.1|  poly [ADP-ribose] polymerase-1                         225   2e-64    synthetic construct
sp|P11103.3|PARP1_MOUSE  RecName: Full=Poly [ADP-ribose] polymera...    225   2e-64    Mus musculus [mouse]
dbj|BAE35080.1|  unnamed protein product                                225   2e-64    Mus musculus [mouse]
ref|XP_006897812.1|  PREDICTED: poly [ADP-ribose] polymerase 1          225   2e-64    Elephantulus edwardii [Cape long-eared elephant shrew]
dbj|BAE27352.1|  unnamed protein product                                225   2e-64    Mus musculus [mouse]
dbj|BAG64403.1|  unnamed protein product                                225   2e-64    Homo sapiens [man]
ref|XP_010863533.1|  PREDICTED: poly [ADP-ribose] polymerase 1          225   2e-64    Esox lucius
ref|XP_003357689.1|  PREDICTED: poly [ADP-ribose] polymerase 1          225   2e-64    
ref|NP_031441.2|  poly [ADP-ribose] polymerase 1                        225   2e-64    Mus musculus [mouse]
gb|ERE73581.1|  poly [ADP-ribose] polymerase 1                          225   2e-64    Cricetulus griseus [Chinese hamsters]
ref|XP_003487068.1|  PREDICTED: poly [ADP-ribose] polymerase-like       225   2e-64    Bombus impatiens
ref|XP_003275213.1|  PREDICTED: poly [ADP-ribose] polymerase 1          225   2e-64    
emb|CDQ76498.1|  unnamed protein product                                225   2e-64    Oncorhynchus mykiss
ref|XP_008559441.1|  PREDICTED: poly [ADP-ribose] polymerase-like       225   2e-64    Microplitis demolitor
ref|XP_009960357.1|  PREDICTED: poly [ADP-ribose] polymerase 1          213   2e-64    Leptosomus discolor
gb|EGW11182.1|  Poly [ADP-ribose] polymerase 1                          225   2e-64    Cricetulus griseus [Chinese hamsters]
ref|XP_007534861.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    224   2e-64    Erinaceus europaeus [common hedgehog]
ref|XP_010589425.1|  PREDICTED: poly [ADP-ribose] polymerase 1          225   2e-64    
ref|XP_004065376.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    225   2e-64    
ref|XP_005078195.1|  PREDICTED: poly [ADP-ribose] polymerase 1          225   3e-64    Mesocricetus auratus [Syrian golden hamster]
ref|XP_004375937.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    225   3e-64    Trichechus manatus latirostris
ref|NP_001233650.1|  poly [ADP-ribose] polymerase 1                     224   3e-64    Cricetulus griseus [Chinese hamsters]
ref|XP_008579018.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   3e-64    Galeopterus variegatus [Malayan flying lemur]
ref|XP_002941174.2|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    224   3e-64    Xenopus tropicalis [western clawed frog]
ref|XP_003216114.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   3e-64    Anolis carolinensis [Carolina anole]
ref|XP_008058853.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   3e-64    
ref|XP_002809428.2|  PREDICTED: poly [ADP-ribose] polymerase 1          224   3e-64    
ref|XP_006157311.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   3e-64    Tupaia chinensis
ref|XP_009976244.1|  PREDICTED: poly [ADP-ribose] polymerase 1          213   4e-64    Tauraco erythrolophus
ref|XP_002760624.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   4e-64    Callithrix jacchus [common marmoset]
ref|XP_008820594.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   4e-64    Nannospalax galili
ref|XP_008266574.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    224   5e-64    Oryctolagus cuniculus [domestic rabbit]
ref|XP_003791037.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   5e-64    Otolemur garnettii
ref|XP_004761981.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    224   5e-64    Mustela putorius furo [black ferret]
ref|XP_011359180.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    223   6e-64    
ref|XP_006974251.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   6e-64    Peromyscus maniculatus bairdii
ref|XP_004271024.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   6e-64    Orcinus orca [Orca]
ref|XP_007102732.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   6e-64    
ref|XP_011499146.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    223   7e-64    Ceratosolen solmsi marchali
ref|XP_001491507.4|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    223   7e-64    
ref|XP_003814976.1|  PREDICTED: poly [ADP-ribose] polymerase 1          224   7e-64    Pan paniscus [bonobo]
ref|XP_007464233.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   8e-64    Lipotes vexillifer [baiji]
gb|ELW49552.1|  Poly [ADP-ribose] polymerase 1                          224   8e-64    Tupaia chinensis
ref|XP_004761979.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    224   8e-64    
ref|XP_007167258.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    223   8e-64    Balaenoptera acutorostrata scammoni
ref|XP_003770730.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     224   8e-64    
ref|XP_011138702.1|  PREDICTED: poly [ADP-ribose] polymerase            223   8e-64    
ref|XP_006268817.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   9e-64    
ref|XP_006914334.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   9e-64    Pteropus alecto
ref|XP_009808696.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     213   9e-64    Gavia stellata
gb|AAI00002.1|  Poly (ADP-ribose) polymerase family, member 1           223   9e-64    Danio rerio [leopard danio]
ref|XP_007935170.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   9e-64    Orycteropus afer afer
ref|XP_004439616.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   9e-64    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_003930339.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   9e-64    Saimiri boliviensis boliviensis
gb|EHH15492.1|  hypothetical protein EGK_01593                          223   9e-64    Macaca mulatta [rhesus macaque]
ref|XP_004393605.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   1e-63    Odobenus rosmarus divergens
ref|XP_004354000.1|  Poly(ADPribose) polymerase catalytic domain ...    209   1e-63    Acanthamoeba castellanii str. Neff
ref|XP_006871190.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     223   1e-63    Chrysochloris asiatica
ref|NP_001038407.1|  poly [ADP-ribose] polymerase 1                     223   1e-63    Danio rerio [leopard danio]
ref|XP_006012380.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     221   1e-63    
ref|XP_001090984.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    223   1e-63    
ref|XP_005541069.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   1e-63    Macaca fascicularis [crab eating macaque]
ref|XP_005404552.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   1e-63    Chinchilla lanigera
ref|XP_010380279.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   1e-63    Rhinopithecus roxellana
ref|XP_001090628.2|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    223   1e-63    
ref|XP_007670669.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   1e-63    
ref|XP_010611507.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   1e-63    Fukomys damarensis [Damara mole rat]
ref|XP_007986456.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    223   1e-63    Chlorocebus sabaeus
ref|XP_006016655.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   1e-63    
emb|CBY18306.1|  unnamed protein product                                223   1e-63    Oikopleura dioica
ref|XP_005014800.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    222   2e-63    
ref|XP_003462410.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   2e-63    Cavia porcellus [guinea pig]
ref|XP_010851175.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    223   2e-63    Bison bison bison
sp|P31669.1|PARP1_XENLA  RecName: Full=Poly [ADP-ribose] polymera...    222   2e-63    Xenopus laevis [clawed frog]
ref|XP_004013685.1|  PREDICTED: poly [ADP-ribose] polymerase 1          222   2e-63    
ref|XP_010851174.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    222   2e-63    Bison bison bison
ref|XP_005690590.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    222   2e-63    
ref|XP_005959159.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     222   2e-63    Pantholops hodgsonii [Tibetan antelope]
dbj|BAE38574.1|  unnamed protein product                                222   2e-63    Mus musculus [mouse]
gb|KFO19690.1|  Poly [ADP-ribose] polymerase 1                          222   2e-63    Fukomys damarensis [Damara mole rat]
ref|XP_547506.3|  PREDICTED: poly [ADP-ribose] polymerase 1 isofo...    223   2e-63    
ref|XP_005216853.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    222   2e-63    Bos taurus [bovine]
ref|NP_001081571.1|  poly [ADP-ribose] polymerase 1                     222   2e-63    Xenopus laevis [clawed frog]
tpg|DAA21368.1|  TPA: poly [ADP-ribose] polymerase 1                    222   2e-63    Bos taurus [bovine]
ref|XP_005690591.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    222   2e-63    
ref|XP_003707671.1|  PREDICTED: poly [ADP-ribose] polymerase-like       222   2e-63    Megachile rotundata
ref|XP_006046141.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    222   2e-63    
ref|XP_006046140.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    222   3e-63    Bubalus bubalis [domestic water buffalo]
ref|XP_009184638.1|  PREDICTED: poly [ADP-ribose] polymerase 1          223   3e-63    
gb|ELT93548.1|  hypothetical protein CAPTEDRAFT_223861                  222   3e-63    Capitella teleta
ref|XP_008159430.1|  PREDICTED: poly [ADP-ribose] polymerase 1          221   3e-63    Eptesicus fuscus
ref|XP_003424731.1|  PREDICTED: poly [ADP-ribose] polymerase            221   3e-63    Nasonia vitripennis
ref|XP_005326600.1|  PREDICTED: poly [ADP-ribose] polymerase 1          222   4e-63    Ictidomys tridecemlineatus
ref|XP_002058751.1|  GJ11149                                            221   5e-63    
ref|XP_005880205.1|  PREDICTED: poly [ADP-ribose] polymerase 1          221   5e-63    Myotis brandtii
ref|XP_003693603.1|  PREDICTED: poly [ADP-ribose] polymerase-like       221   6e-63    Apis florea [dwarf honeybee]
ref|NP_777176.1|  poly [ADP-ribose] polymerase 1                        221   6e-63    Bos taurus [bovine]
ref|XP_003385071.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     220   7e-63    Amphimedon queenslandica
ref|XP_007481564.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    220   7e-63    
ref|XP_004889988.1|  PREDICTED: poly [ADP-ribose] polymerase 1          221   8e-63    
gb|KFB53219.1|  AGAP003230-PA-like protein                              221   8e-63    Anopheles sinensis
ref|XP_007905391.1|  PREDICTED: poly [ADP-ribose] polymerase 1          221   9e-63    Callorhinchus milii [Australian ghost shark]
gb|AIZ09031.1|  poly [ADP-ribose] polymerase 1                          220   1e-62    Heterocephalus glaber [naked mole rat]
ref|XP_624477.3|  PREDICTED: poly [ADP-ribose] polymerase               220   1e-62    Apis mellifera [bee]
ref|XP_001996195.1|  GH22365                                            220   1e-62    Drosophila grimshawi
ref|XP_007481563.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    220   1e-62    Monodelphis domestica
ref|XP_010293489.1|  PREDICTED: poly [ADP-ribose] polymerase 1          212   1e-62    Phaethon lepturus
ref|XP_004862328.1|  PREDICTED: poly [ADP-ribose] polymerase 1          220   1e-62    
ref|XP_004472547.1|  PREDICTED: poly [ADP-ribose] polymerase 1          221   2e-62    
ref|XP_004700007.1|  PREDICTED: poly [ADP-ribose] polymerase 1          220   2e-62    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_009568032.1|  PREDICTED: poly [ADP-ribose] polymerase 1          219   2e-62    Cuculus canorus
gb|EHB06347.1|  Poly [ADP-ribose] polymerase 1                          220   3e-62    Heterocephalus glaber [naked mole rat]
ref|XP_006812383.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     219   3e-62    Saccoglossus kowalevskii
sp|Q11208.1|PARP_SARPE  RecName: Full=Poly [ADP-ribose] polymeras...    219   4e-62    Sarcophaga peregrina
gb|AAA60155.1|  poly(ADP-ribose) polymerase                             219   5e-62    Homo sapiens [man]
ref|XP_004641229.1|  PREDICTED: poly [ADP-ribose] polymerase 1          218   5e-62    Octodon degus
ref|XP_011334668.1|  PREDICTED: poly [ADP-ribose] polymerase            218   5e-62    
ref|NP_001191521.1|  poly-(ADP-ribose) polymerase I                     218   6e-62    Aplysia californica
gb|AAM50807.1|  LD31274p                                                213   7e-62    Drosophila melanogaster
gb|AAB35559.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            214   9e-62    Gallus gallus [bantam]
ref|XP_002109067.1|  hypothetical protein TRIADDRAFT_19562              217   9e-62    Trichoplax adhaerens
ref|XP_002964898.1|  hypothetical protein SELMODRAFT_83360              214   1e-61    
ref|XP_002986480.1|  hypothetical protein SELMODRAFT_124300             214   1e-61    
ref|XP_001947212.1|  PREDICTED: poly [ADP-ribose] polymerase            218   1e-61    
ref|XP_006375453.1|  Poly [ADP-ribose] polymerase family protein        214   1e-61    
gb|KFM63822.1|  Poly [ADP-ribose] polymerase 1                          217   1e-61    
ref|XP_002073889.1|  GK14355                                            217   1e-61    
emb|CDX90941.1|  BnaA03g26210D                                          214   1e-61    
ref|XP_001027169.3|  WGR domain containing protein                      214   1e-61    
ref|XP_010134097.1|  PREDICTED: poly [ADP-ribose] polymerase 1          217   1e-61    
ref|XP_011204662.1|  PREDICTED: poly [ADP-ribose] polymerase            217   2e-61    
ref|XP_010259524.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    213   2e-61    
ref|XP_010259523.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    213   2e-61    
ref|XP_009134435.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    213   2e-61    
ref|XP_009134436.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    213   2e-61    
gb|KFB53220.1|  AGAP003230-PA-like protein                              216   2e-61    
ref|XP_001782209.1|  predicted protein                                  214   2e-61    
ref|XP_006612556.1|  PREDICTED: poly [ADP-ribose] polymerase-like       216   3e-61    
ref|XP_001998459.1|  GI23619                                            216   3e-61    
gb|EQB78542.1|  poly [ADP-ribose] polymerase 1                          218   3e-61    
emb|CDY18025.1|  BnaC03g30970D                                          214   4e-61    
gb|EFX75651.1|  hypothetical protein DAPPUDRAFT_55885                   216   4e-61    
ref|XP_010429576.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    213   4e-61    
ref|XP_002019344.1|  GL12354                                            216   4e-61    
ref|XP_010422601.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    213   4e-61    
ref|XP_010456041.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    213   4e-61    
ref|XP_010456042.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    213   4e-61    
ref|XP_010422599.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    213   4e-61    
ref|XP_010441111.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     213   4e-61    
ref|XP_010429584.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    213   5e-61    
ref|XP_002137908.2|  GA25584                                            215   6e-61    
ref|XP_011426298.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     215   6e-61    
ref|XP_003149248.1|  poly(ADP-ribose) polymerase                        205   7e-61    
ref|XP_005175604.1|  PREDICTED: poly [ADP-ribose] polymerase isof...    215   7e-61    
ref|XP_005043071.1|  PREDICTED: poly [ADP-ribose] polymerase 1          215   7e-61    
sp|P26446.2|PARP1_CHICK  RecName: Full=Poly [ADP-ribose] polymera...    215   8e-61    
ref|NP_990594.2|  poly [ADP-ribose] polymerase 1                        215   9e-61    
ref|XP_009860226.1|  PREDICTED: poly [ADP-ribose] polymerase 1          214   1e-60    
ref|XP_009684683.1|  PREDICTED: poly [ADP-ribose] polymerase 1          214   1e-60    
ref|XP_010704958.1|  PREDICTED: poly [ADP-ribose] polymerase 1          214   1e-60    
ref|NP_001089376.1|  uncharacterized protein LOC734426                  208   2e-60    
ref|XP_011188189.1|  PREDICTED: poly [ADP-ribose] polymerase            214   2e-60    
gb|AAB35561.1|  NAD+:protein(ADP-ribosyl)-transferase, ADPRT            210   2e-60    
ref|XP_003740601.1|  PREDICTED: poly [ADP-ribose] polymerase-like       213   3e-60    
ref|XP_006396446.1|  hypothetical protein EUTSA_v10028509mg             211   3e-60    
ref|XP_009872148.1|  PREDICTED: poly [ADP-ribose] polymerase 1          212   3e-60    
ref|XP_003949754.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    214   3e-60    
ref|XP_009504077.1|  PREDICTED: poly [ADP-ribose] polymerase 1          213   3e-60    
ref|NP_001104452.1|  Poly-(ADP-ribose) polymerase                       213   4e-60    
gb|KFW91620.1|  Poly [ADP-ribose] polymerase 1                          212   4e-60    
gb|AAC19283.1|  T14P8.19                                                210   4e-60    
ref|XP_002874918.1|  poly(ADP-ribose) polymerase                        210   4e-60    
ref|XP_010224835.1|  PREDICTED: poly [ADP-ribose] polymerase 1          213   4e-60    
ref|NP_192148.2|  poly(ADP-ribose) polymerase                           210   4e-60    
ref|XP_004926518.1|  PREDICTED: poly [ADP-ribose] polymerase            213   4e-60    
ref|XP_004519485.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    212   5e-60    
emb|CAA36917.1|  unnamed protein product                                213   6e-60    
ref|XP_004519483.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    212   7e-60    
ref|XP_009092024.1|  PREDICTED: poly [ADP-ribose] polymerase 1          212   7e-60    
ref|XP_005488534.1|  PREDICTED: poly [ADP-ribose] polymerase 1          212   8e-60    
ref|XP_009899525.1|  PREDICTED: poly [ADP-ribose] polymerase 1          212   8e-60    
ref|XP_004519484.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    212   8e-60    
ref|XP_004165914.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     209   8e-60    
ref|XP_004136022.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     209   8e-60    
ref|XP_005427073.1|  PREDICTED: poly [ADP-ribose] polymerase 1          212   8e-60    
ref|XP_009969669.1|  PREDICTED: poly [ADP-ribose] polymerase 1          212   8e-60    
ref|XP_011079644.1|  PREDICTED: poly [ADP-ribose] polymerase 2          211   1e-59    
ref|XP_009470783.1|  PREDICTED: poly [ADP-ribose] polymerase 1          212   1e-59    
ref|XP_005151917.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    212   1e-59    
ref|XP_009935626.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    212   1e-59    
ref|XP_009910585.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    211   1e-59    
ref|XP_010195273.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_010162117.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_009892579.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_009476172.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_010007824.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_010180660.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_008628789.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_009646446.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_008933052.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
gb|EMC85168.1|  Poly [ADP-ribose] polymerase 1                          211   1e-59    
gb|KGN44946.1|  hypothetical protein Csa_7G397590                       209   1e-59    
ref|XP_009993082.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_009076073.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_006756108.1|  PREDICTED: poly [ADP-ribose] polymerase 1          212   1e-59    
ref|XP_010391791.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_010576040.1|  PREDICTED: poly [ADP-ribose] polymerase 1          212   1e-59    
ref|XP_010300324.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
gb|KJB41911.1|  hypothetical protein B456_007G127600                    205   1e-59    
ref|XP_009581523.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   1e-59    
ref|XP_002194832.2|  PREDICTED: poly [ADP-ribose] polymerase 1          213   2e-59    
ref|XP_002409668.1|  poly [ADP-ribose] polymerase, putative             211   2e-59    
ref|XP_002430760.1|  polyA polymerase, putative                         211   2e-59    
ref|XP_008451559.1|  PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ri...    208   2e-59    
ref|XP_005523343.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    211   2e-59    
ref|XP_005241893.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   2e-59    
ref|XP_005507407.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   2e-59    
ref|XP_005523344.1|  PREDICTED: poly [ADP-ribose] polymerase 1 is...    211   2e-59    
ref|XP_005441299.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   2e-59    
ref|XP_009331916.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   2e-59    
ref|XP_001661932.1|  AAEL011815-PA                                      211   2e-59    
ref|XP_010076719.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   2e-59    
ref|XP_008499362.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   2e-59    
ref|XP_004332883.1|  Poly(ADPribose) polymerase catalytic domain ...    208   2e-59    
ref|XP_009283832.1|  PREDICTED: poly [ADP-ribose] polymerase 1          211   2e-59    
ref|XP_006677781.1|  hypothetical protein BATDEDRAFT_16284              204   2e-59    
ref|XP_002090141.1|  GE20224                                            211   3e-59    
emb|CDP17120.1|  unnamed protein product                                208   3e-59    
ref|XP_010088282.1|  Poly [ADP-ribose] polymerase 2                     208   3e-59    
ref|XP_006286374.1|  hypothetical protein CARUB_v10000452mg             207   3e-59    
ref|XP_008948173.1|  PREDICTED: poly [ADP-ribose] polymerase 1          210   4e-59    
gb|ETO30134.1|  WGR domain containing protein                           201   4e-59    
gb|AAW27016.1|  SJCHGC00945 protein                                     201   4e-59    
ref|XP_001901649.1|  WGR domain containing protein                      209   5e-59    
gb|EKC34863.1|  Poly [ADP-ribose] polymerase 1                          210   5e-59    
ref|XP_001862547.1|  poly                                               210   5e-59    
emb|CDP98672.1|  Protein BM-PME-1, isoform b                            209   5e-59    
ref|XP_004366295.1|  poly(ADP-ribosyl)transferase                       208   1e-58    
gb|KJB41910.1|  hypothetical protein B456_007G127600                    206   1e-58    
ref|XP_011063718.1|  PREDICTED: poly [ADP-ribose] polymerase isof...    208   1e-58    
ref|XP_006643364.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     200   2e-58    
ref|XP_010522796.1|  PREDICTED: poly [ADP-ribose] polymerase 2          206   2e-58    
ref|XP_008235208.1|  PREDICTED: poly [ADP-ribose] polymerase 2          206   2e-58    
ref|XP_001424619.1|  hypothetical protein                               204   2e-58    
ref|XP_011033516.1|  PREDICTED: poly [ADP-ribose] polymerase 2          205   3e-58    
gb|KFK30828.1|  hypothetical protein AALP_AA6G031100                    205   3e-58    
gb|KJB41909.1|  hypothetical protein B456_007G127600                    206   3e-58    
ref|XP_006825226.1|  PREDICTED: poly [ADP-ribose] polymerase 1-like     195   3e-58    
gb|KFK30829.1|  hypothetical protein AALP_AA6G031100                    205   3e-58    
ref|XP_006588586.1|  PREDICTED: poly [ADP-ribose] polymerase 2-A-...    204   3e-58    
gb|KHN03715.1|  Poly [ADP-ribose] polymerase 2                          204   4e-58    
ref|XP_010684358.1|  PREDICTED: poly [ADP-ribose] polymerase 2-A ...    205   4e-58    
ref|XP_010684359.1|  PREDICTED: poly [ADP-ribose] polymerase 2-A ...    205   4e-58    
ref|XP_011308727.1|  PREDICTED: poly [ADP-ribose] polymerase            207   4e-58    
ref|XP_004341800.1|  Poly(ADPribose) polymerase catalytic domain ...    208   6e-58    
gb|AFW80735.1|  hypothetical protein ZEAMMB73_284458                    195   6e-58    
ref|XP_312938.4|  AGAP003230-PA                                         207   6e-58    
gb|ETN59550.1|  poly [adp-ribose] polymerase                            207   6e-58    
ref|XP_002990236.1|  hypothetical protein SELMODRAFT_131309             201   7e-58    
gb|KHG12641.1|  Poly [ADP-ribose] polymerase 2 -like protein            204   1e-57    
ref|XP_010069905.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    202   1e-57    
gb|EAW69785.1|  poly (ADP-ribose) polymerase family, member 1, is...    206   1e-57    
ref|XP_010931665.1|  PREDICTED: poly [ADP-ribose] polymerase 2          203   1e-57    
ref|XP_006479982.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    203   1e-57    
ref|XP_008244417.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     203   1e-57    
ref|XP_010451796.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     202   1e-57    
ref|XP_008812277.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    203   2e-57    
ref|XP_001435061.1|  hypothetical protein                               202   2e-57    
ref|XP_010069904.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    203   2e-57    
ref|XP_009335700.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    201   2e-57    
ref|XP_006479984.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    202   2e-57    
gb|KDO87191.1|  hypothetical protein CISIN_1g006883mg                   202   2e-57    
ref|XP_006444375.1|  hypothetical protein CICLE_v10019312mg             202   2e-57    
ref|XP_008345247.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     194   3e-57    
ref|XP_006479981.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    202   3e-57    
ref|XP_006479983.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    202   3e-57    
gb|EJD75827.1|  WGR domain-containing protein                           204   4e-57    
ref|NP_001153714.1|  poly-(ADP-ribose) polymerase                       205   4e-57    
emb|CCD60678.1|  poly [ADP-ribose] polymerase, putative                 204   5e-57    
ref|XP_009405431.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    201   5e-57    
gb|KDO87190.1|  hypothetical protein CISIN_1g006883mg                   201   5e-57    
gb|ACF79836.1|  unknown                                                 195   5e-57    
ref|XP_007199613.1|  hypothetical protein PRUPE_ppa002806mg             201   6e-57    
ref|XP_009405432.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    201   6e-57    
gb|EFA82774.1|  polyADP-ribosyltransferase                              204   6e-57    
ref|XP_009061157.1|  hypothetical protein LOTGIDRAFT_206927             204   7e-57    
ref|XP_007050950.1|  Poly(ADP-ribose) polymerase isoform 1              201   7e-57    
ref|XP_004968713.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     201   1e-56    
ref|XP_009335699.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    201   1e-56    
gb|ENN70929.1|  hypothetical protein YQE_12331                          197   2e-56    
gb|ELK36014.1|  Poly [ADP-ribose] polymerase 1                          204   2e-56    
gb|EYU46735.1|  hypothetical protein MIMGU_mgv1a020376mg                201   2e-56    
ref|XP_003591511.1|  Poly                                               200   3e-56    
ref|XP_011459796.1|  PREDICTED: poly [ADP-ribose] polymerase 2          199   3e-56    
gb|ERL88197.1|  hypothetical protein D910_05585                         197   3e-56    
ref|XP_006644151.1|  PREDICTED: poly [ADP-ribose] polymerase 2-A-...    199   4e-56    
gb|EHJ70647.1|  poly                                                    202   4e-56    
ref|XP_005918190.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     195   5e-56    
emb|CDX91327.1|  BnaC02g27380D                                          192   5e-56    
ref|XP_008355488.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    199   5e-56    
ref|XP_007145201.1|  hypothetical protein PHAVU_007G218800g             198   5e-56    
ref|XP_008355487.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    199   6e-56    
ref|XP_009335717.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    197   7e-56    
ref|XP_007241737.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     198   1e-55    
emb|CDY55366.1|  BnaA02g36520D                                          197   2e-55    
gb|EMP24541.1|  Poly [ADP-ribose] polymerase 1                          198   2e-55    
gb|AGT29604.1|  poly [ADP-ribose] polymerase 2                          196   2e-55    
ref|XP_004495943.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     197   2e-55    
ref|XP_008345216.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     192   2e-55    
gb|AAI42935.1|  LOC100007906 protein                                    196   2e-55    
gb|EEE54532.1|  hypothetical protein OsJ_01694                          197   3e-55    
dbj|BAD52929.1|  putative poly(ADP-ribose) polymerase                   196   4e-55    
ref|XP_006792497.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     196   4e-55    
ref|XP_009335716.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    196   4e-55    
sp|Q5Z8Q9.2|PRP2A_ORYSJ  RecName: Full=Poly [ADP-ribose] polymera...    197   4e-55    
ref|XP_002961896.1|  hypothetical protein SELMODRAFT_403303             197   5e-55    
gb|KEH43217.1|  poly(ADP-ribose) polymerase domain protein              196   5e-55    
gb|ESA07314.1|  hypothetical protein GLOINDRAFT_33051                   197   5e-55    
ref|XP_002128307.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     195   5e-55    
ref|XP_004994319.1|  hypothetical protein PTSG_05004                    199   6e-55    
gb|ERG87001.1|  poly(adp-ribose) polymerase pme-1                       198   6e-55    
ref|XP_009618006.1|  PREDICTED: poly [ADP-ribose] polymerase 2          196   6e-55    
ref|NP_001191199.1|  poly [ADP-ribose] polymerase 2                     196   6e-55    
ref|NP_001133790.1|  poly (ADP-ribose) polymerase family, member 2      195   6e-55    
ref|XP_005171314.1|  PREDICTED: poly [ADP-ribose] polymerase 2 is...    196   6e-55    
dbj|GAM18341.1|  hypothetical protein SAMD00019534_015160               198   6e-55    
gb|KDP28174.1|  hypothetical protein JCGZ_13945                         195   8e-55    
ref|XP_001604917.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    198   9e-55    
ref|XP_009144575.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     195   1e-54    
ref|XP_008203357.1|  PREDICTED: poly [ADP-ribose] polymerase-like...    198   1e-54    
gb|KHN87932.1|  Poly [ADP-ribose] polymerase 2                          196   1e-54    
ref|XP_004555259.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     195   1e-54    
ref|XP_005729041.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     195   1e-54    
ref|XP_006365384.1|  PREDICTED: poly [ADP-ribose] polymerase 2-like     195   2e-54    
ref|XP_008655901.1|  PREDICTED: poly [ADP-ribose] polymerase 2          196   2e-54    
ref|XP_008355489.1|  PREDICTED: poly [ADP-ribose] polymerase 2-li...    194   2e-54    
ref|XP_010230864.1|  PREDICTED: poly [ADP-ribose] polymerase 2          196   2e-54    
emb|CAF92030.1|  unnamed protein product                                192   2e-54    
ref|XP_009793726.1|  PREDICTED: poly [ADP-ribose] polymerase 2          194   2e-54    
gb|KHN85776.1|  Poly(ADP-ribose) polymerase pme-1                       197   2e-54    
emb|CDQ67347.1|  unnamed protein product                                194   3e-54    
ref|XP_002591821.1|  hypothetical protein BRAFLDRAFT_125321             191   4e-54    
gb|KFH64843.1|  hypothetical protein MVEG_09572                         194   4e-54    



>ref|XP_009781597.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Nicotiana 
sylvestris]
Length=995

 Score =   326 bits (835),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP R+KLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  824  EGEFDKFAPHREKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADM  883

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+RKNPVGFMLLSEVALG+++ELKKA+YMDKPPKGKHSTKGLGKTVP+ S+
Sbjct  884  VSKSAQYCFTDRKNPVGFMLLSEVALGEVYELKKAKYMDKPPKGKHSTKGLGKTVPESSE  943

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRDEVVVPCGKPVPS +K SELLYNEYIVYD  QVKLQFLVKVRF YK
Sbjct  944  FVKWRDEVVVPCGKPVPSNIKNSELLYNEYIVYDTCQVKLQFLVKVRFNYK  994



>ref|XP_009781599.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X3 [Nicotiana 
sylvestris]
Length=994

 Score =   326 bits (835),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP R+KLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  823  EGEFDKFAPHREKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADM  882

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+RKNPVGFMLLSEVALG+++ELKKA+YMDKPPKGKHSTKGLGKTVP+ S+
Sbjct  883  VSKSAQYCFTDRKNPVGFMLLSEVALGEVYELKKAKYMDKPPKGKHSTKGLGKTVPESSE  942

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRDEVVVPCGKPVPS +K SELLYNEYIVYD  QVKLQFLVKVRF YK
Sbjct  943  FVKWRDEVVVPCGKPVPSNIKNSELLYNEYIVYDTCQVKLQFLVKVRFNYK  993



>ref|XP_009781598.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Nicotiana 
sylvestris]
Length=995

 Score =   325 bits (834),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP R+KLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  824  EGEFDKFAPHREKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADM  883

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+RKNPVGFMLLSEVALG+++ELKKA+YMDKPPKGKHSTKGLGKTVP+ S+
Sbjct  884  VSKSAQYCFTDRKNPVGFMLLSEVALGEVYELKKAKYMDKPPKGKHSTKGLGKTVPESSE  943

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRDEVVVPCGKPVPS +K SELLYNEYIVYD  QVKLQFLVKVRF YK
Sbjct  944  FVKWRDEVVVPCGKPVPSNIKNSELLYNEYIVYDTCQVKLQFLVKVRFNYK  994



>ref|XP_009617762.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=977

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP R+KLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  806  EGEFDKFAPHREKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADM  865

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+RKNPVGFMLLSEVALG+++ELKKA+Y+DKPPKGKHSTKGLGKTVP+ S+
Sbjct  866  VSKSAQYCFTDRKNPVGFMLLSEVALGEVYELKKAKYIDKPPKGKHSTKGLGKTVPESSE  925

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRDEVVVP GKPVPS VK SELLYNEYIVYD AQVKLQFLVKVRF YK
Sbjct  926  FVKWRDEVVVPHGKPVPSNVKNSELLYNEYIVYDTAQVKLQFLVKVRFNYK  976



>ref|XP_009617761.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Nicotiana 
tomentosiformis]
Length=994

 Score =   321 bits (823),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP R+KLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  823  EGEFDKFAPHREKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADM  882

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+RKNPVGFMLLSEVALG+++ELKKA+Y+DKPPKGKHSTKGLGKTVP+ S+
Sbjct  883  VSKSAQYCFTDRKNPVGFMLLSEVALGEVYELKKAKYIDKPPKGKHSTKGLGKTVPESSE  942

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRDEVVVP GKPVPS VK SELLYNEYIVYD AQVKLQFLVKVRF YK
Sbjct  943  FVKWRDEVVVPHGKPVPSNVKNSELLYNEYIVYDTAQVKLQFLVKVRFNYK  993



>ref|XP_007199702.1| hypothetical protein PRUPE_ppa000811mg [Prunus persica]
 gb|EMJ00901.1| hypothetical protein PRUPE_ppa000811mg [Prunus persica]
Length=997

 Score =   317 bits (813),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+RKKL NRMLLWHGSR TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  826  EGEFDKFAPYRKKLNNRMLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  885

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T++KNPVG MLLSEVALG++HELKKA YMDKPPKGKHSTKGLGK +PQES+
Sbjct  886  VSKSAQYCYTDKKNPVGLMLLSEVALGEVHELKKATYMDKPPKGKHSTKGLGKKIPQESE  945

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            YVKW+D+V+VPCGKPVPS +KASEL+YNEYIVYD AQVK+QFL+KVRF +K
Sbjct  946  YVKWKDDVIVPCGKPVPSNIKASELMYNEYIVYDKAQVKMQFLLKVRFHHK  996



>ref|XP_008235714.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Prunus mume]
Length=992

 Score =   317 bits (811),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+RKKL NRMLLWHGSR TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  821  EGEFDKFAPYRKKLNNRMLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  880

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T++KNPVG MLLSEVALG++HELKKA YMDKPPKGKHSTKGLGK +PQES+
Sbjct  881  VSKSAQYCYTDKKNPVGLMLLSEVALGEVHELKKATYMDKPPKGKHSTKGLGKKIPQESE  940

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            YVKW+D+V+VPCGKPVPS +KASEL+YNEYIVYD AQVK+QFL+KVRF +K
Sbjct  941  YVKWKDDVIVPCGKPVPSNIKASELMYNEYIVYDKAQVKMQFLLKVRFHHK  991



>ref|XP_009367708.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=966

 Score =   316 bits (810),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+RKKLKNRMLLWHGSR TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  795  EGEFDKFAPYRKKLKNRMLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  854

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T++KNPVG MLLSEVALG+++ELKKA YMDKPPKGKHSTKGLGK +PQES+
Sbjct  855  VSKSAQYCYTDKKNPVGLMLLSEVALGEVYELKKAAYMDKPPKGKHSTKGLGKKIPQESE  914

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            YVKW+D+V+VPCGKPVPS VKASEL+YNEYIVYD AQVK+Q+L+KVRF +K
Sbjct  915  YVKWKDDVIVPCGKPVPSNVKASELMYNEYIVYDTAQVKMQYLLKVRFHHK  965



>ref|XP_009367706.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=966

 Score =   316 bits (809),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+RKKLKNRMLLWHGSR TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  795  EGEFDKFAPYRKKLKNRMLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  854

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T++KNPVG MLLSEVALG+++ELKKA YMDKPPKGKHSTKGLGK +PQES+
Sbjct  855  VSKSAQYCYTDKKNPVGLMLLSEVALGEVYELKKAAYMDKPPKGKHSTKGLGKKIPQESE  914

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            YVKW+D+V+VPCGKPVPS VKASEL+YNEYIVYD AQVK+Q+L+KVRF +K
Sbjct  915  YVKWKDDVIVPCGKPVPSNVKASELMYNEYIVYDTAQVKMQYLLKVRFHHK  965



>ref|XP_006341445.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Solanum tuberosum]
Length=991

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            KGE DKF P ++KLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  820  KGEFDKFKPCKEKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADM  879

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+ KNPVGFMLLSEVALG+++ELK A+YMDKPPKGKHSTKGLGKTVP+ SD
Sbjct  880  VSKSAQYCFTDHKNPVGFMLLSEVALGEVYELKAAKYMDKPPKGKHSTKGLGKTVPERSD  939

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +V WRDEVVVPCGKPV S VK SELLYNEYIVYD AQVKLQFLVKVRF +K
Sbjct  940  FVNWRDEVVVPCGKPVTSNVKNSELLYNEYIVYDAAQVKLQFLVKVRFNFK  990



>gb|KDP21330.1| hypothetical protein JCGZ_21801 [Jatropha curcas]
Length=982

 Score =   314 bits (805),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE+DKFAP+RKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  811  EGEIDKFAPYRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  870

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT++KNPVG MLLSEVALG+++ELK A YMDKPP+GKHSTKGLGK VPQES+
Sbjct  871  VSKSAQYCFTDKKNPVGLMLLSEVALGEVYELKNAMYMDKPPQGKHSTKGLGKKVPQESE  930

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWR++V VPCGKPVPSKVKASEL+YNEYIVY  AQVK+QFL+KVRF +K
Sbjct  931  FVKWRNDVTVPCGKPVPSKVKASELMYNEYIVYSTAQVKMQFLLKVRFHHK  981



>ref|XP_004235864.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Solanum 
lycopersicum]
Length=992

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            KGE DKF P R KLKN+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  821  KGEYDKFKPCRDKLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADM  880

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+RKNPVGFMLLSEVALG+++ELK A+YMDKPPKGKHSTKGLGKTVP+ S+
Sbjct  881  VSKSAQYCFTDRKNPVGFMLLSEVALGEVYELKAAKYMDKPPKGKHSTKGLGKTVPERSE  940

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +V WRDEVVVPCGKPV S VK SELLYNEYIVY+ AQVKLQFLVKVRF +K
Sbjct  941  FVNWRDEVVVPCGKPVTSNVKNSELLYNEYIVYEAAQVKLQFLVKVRFNFK  991



>gb|ACN36904.1| unknown [Zea mays]
Length=253

 Score =   294 bits (752),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GEL+K++ ++  L N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+V
Sbjct  83   GELNKYSRYKNNLHNKMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLV  142

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+ +R NPVG MLLSEVALGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++
Sbjct  143  SKSAQYCYVDRNNPVGLMLLSEVALGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEF  202

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            VKWRD+VVVPCGKPVPS +++SEL+YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  203  VKWRDDVVVPCGKPVPSSIRSSELMYNEYIVYNTSQVKMQFLLKVRFHHK  252



>ref|XP_010318682.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Solanum 
lycopersicum]
Length=998

 Score =   314 bits (804),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/171 (85%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            KGE DKF P R KLKN+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  827  KGEYDKFKPCRDKLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADM  886

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+RKNPVGFMLLSEVALG+++ELK A+YMDKPPKGKHSTKGLGKTVP+ S+
Sbjct  887  VSKSAQYCFTDRKNPVGFMLLSEVALGEVYELKAAKYMDKPPKGKHSTKGLGKTVPERSE  946

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +V WRDEVVVPCGKPV S VK SELLYNEYIVY+ AQVKLQFLVKVRF +K
Sbjct  947  FVNWRDEVVVPCGKPVTSNVKNSELLYNEYIVYEAAQVKLQFLVKVRFNFK  997



>ref|XP_002521021.1| poly [ADP-ribose] polymerase, putative [Ricinus communis]
 gb|EEF41438.1| poly [ADP-ribose] polymerase, putative [Ricinus communis]
Length=982

 Score =   313 bits (801),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE+DKFAP+R+KLKNRMLLWHGSRLTN+VGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  811  EGEIDKFAPYRRKLKNRMLLWHGSRLTNYVGILNQGLRIAPPEAPATGYMFGKGIYFADL  870

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T++KNPVG MLLSEVALG+++ELK A YMDKPP+GKHSTKGLGK VPQES+
Sbjct  871  VSKSAQYCYTDKKNPVGLMLLSEVALGEVYELKNAMYMDKPPEGKHSTKGLGKKVPQESE  930

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRDEV VPCG+PVPSKVKASEL+YNEYIVY+ AQVK+QFL+KVRF++K
Sbjct  931  FVKWRDEVTVPCGRPVPSKVKASELMYNEYIVYNTAQVKMQFLLKVRFRHK  981



>gb|KDO68484.1| hypothetical protein CISIN_1g035625mg [Citrus sinensis]
Length=954

 Score =   311 bits (798),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKF+ +++KLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  783  EGEFDKFSSYQRKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  842

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT++KNPVG MLLSEV LG+++ELKKA+YMDKPP GKHSTKGLGKTVPQESD
Sbjct  843  VSKSAQYCFTDKKNPVGLMLLSEVGLGEVYELKKAKYMDKPPDGKHSTKGLGKTVPQESD  902

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRD+V VPCGKPVPS V+ASEL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  903  FVKWRDDVTVPCGKPVPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK  953



>ref|XP_010038006.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Eucalyptus grandis]
 gb|KCW49804.1| hypothetical protein EUGRSUZ_K03285 [Eucalyptus grandis]
Length=1000

 Score =   311 bits (798),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAPFR+ L+NRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  829  EGEFDKFAPFRQNLRNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGLYFADM  888

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT++KNPVG MLLSEVALG++HELKKA+Y+DKPP GKHSTKGLGKTVP ES+
Sbjct  889  VSKSAQYCFTDKKNPVGLMLLSEVALGEVHELKKAKYIDKPPGGKHSTKGLGKTVPLESE  948

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            Y+KW+D+V+VPCGKPV S VKASELLYNEYIVY+ AQVK+QFL+KVRF ++
Sbjct  949  YLKWKDDVIVPCGKPVSSNVKASELLYNEYIVYNTAQVKMQFLLKVRFHHR  999



>ref|XP_011457987.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Fragaria vesca subsp. 
vesca]
Length=984

 Score =   311 bits (796),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP+RK LKNRMLLWHGSR TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  813  EGEFDKYAPYRKTLKNRMLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  872

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T++KNPVG MLLSEVALG++HELKKA YMDKPPKGKHSTKGLGK  P+ESD
Sbjct  873  VSKSAQYCYTDKKNPVGLMLLSEVALGEIHELKKATYMDKPPKGKHSTKGLGKKKPEESD  932

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            YVKWRD+V VPCGKPV S V+ASEL+YNEYIVYD AQVK+QFL+KV+F +K
Sbjct  933  YVKWRDDVTVPCGKPVDSHVRASELMYNEYIVYDTAQVKMQFLLKVKFHHK  983



>gb|EYU46476.1| hypothetical protein MIMGU_mgv1a000724mg [Erythranthe guttata]
Length=1002

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 162/171 (95%), Gaps = 1/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE+DK+AP+R KLKN+MLLWHGSRLTNF+GILSQGLRIAPPEAP+TGYMFGKGVYFAD+
Sbjct  832   QGEMDKYAPYRAKLKNKMLLWHGSRLTNFIGILSQGLRIAPPEAPSTGYMFGKGVYFADL  891

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSAQYCFT+RKNPVG MLLSEVALG++HEL KAQYMDKPPKGKHSTKGLGK VP ES+
Sbjct  892   VSKSAQYCFTDRKNPVGLMLLSEVALGEVHELTKAQYMDKPPKGKHSTKGLGKKVPLESE  951

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             YV+WRD VVVPCGKPV SKVKASEL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  952   YVEWRD-VVVPCGKPVASKVKASELMYNEYIVYNTAQVKMQFLLKVRFHHK  1001



>ref|XP_006443872.1| hypothetical protein CICLE_v10018683mg [Citrus clementina]
 ref|XP_006479562.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Citrus sinensis]
 gb|ESR57112.1| hypothetical protein CICLE_v10018683mg [Citrus clementina]
Length=996

 Score =   310 bits (794),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKF+ +++KLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  825  EGEFDKFSSYQRKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  884

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT++KNPVG MLLSEV LG+++ELKKA+YMDKPP GKHSTKGLGKTVPQESD
Sbjct  885  VSKSAQYCFTDKKNPVGLMLLSEVGLGEVYELKKAKYMDKPPDGKHSTKGLGKTVPQESD  944

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRD+V VPCGKP PS V+ASEL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  945  FVKWRDDVTVPCGKPAPSNVRASELMYNEYIVYNTAQVKMQFLLKVRFHHK  995



>ref|XP_009354923.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Pyrus x bretschneideri]
Length=966

 Score =   310 bits (793),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 162/171 (95%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE +KFAP++KKLKN+MLLWHGSR TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  795  EGEFNKFAPYQKKLKNKMLLWHGSRFTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  854

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T++KNPVG MLLSEVALG+++ELKKA YMDKPPKGKHSTKGLGK +PQES+
Sbjct  855  VSKSAQYCYTDKKNPVGLMLLSEVALGEVYELKKAAYMDKPPKGKHSTKGLGKKIPQESE  914

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            YVKW+D+V+VPCGKPVPS +KASEL+YNEYIVYD AQVK+Q+L+KVRF +K
Sbjct  915  YVKWKDDVIVPCGKPVPSNIKASELMYNEYIVYDTAQVKMQYLLKVRFHHK  965



>ref|XP_010652358.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Vitis vinifera]
 emb|CBI37089.3| unnamed protein product [Vitis vinifera]
Length=996

 Score =   309 bits (792),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFA +R+KL+NRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+
Sbjct  825  EGEFDKFASYREKLQNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADL  884

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T+RKNPVG MLLSEVALG+++EL+KA YMDKPP+GKHSTKGLGK  PQ+S+
Sbjct  885  VSKSAQYCYTDRKNPVGLMLLSEVALGEVYELRKAMYMDKPPEGKHSTKGLGKKKPQDSE  944

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            YVKWRDEVVVPCGKPVPS VK++EL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  945  YVKWRDEVVVPCGKPVPSNVKSTELMYNEYIVYNTAQVKMQFLLKVRFHHK  995



>ref|XP_011080022.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Sesamum indicum]
Length=995

 Score =   308 bits (790),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE+DK+ P+R KLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+
Sbjct  824  EGEVDKYQPYRAKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADL  883

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T+RKNPVG MLLSEVALG+++EL K+QYMDKPPKGKHSTKGLGK VP ES+
Sbjct  884  VSKSAQYCYTDRKNPVGLMLLSEVALGEVYELTKSQYMDKPPKGKHSTKGLGKKVPLESE  943

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKW+DEVVVPCGKPV SKVK SEL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  944  HVKWKDEVVVPCGKPVASKVKTSELMYNEYIVYNTAQVKMQFLLKVRFHHK  994



>ref|XP_010274828.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nelumbo nucifera]
Length=987

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE DKFAP+R+KLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKG+YFAD+V
Sbjct  811  GEFDKFAPYREKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGIYFADLV  870

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+T++KNPVG M+LSEVALG+++ELKKA YM+KPPKGKHSTKGLG   PQES+Y
Sbjct  871  SKSAQYCYTDKKNPVGLMILSEVALGEVYELKKALYMEKPPKGKHSTKGLGMKKPQESEY  930

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             KWRD+V+VPCGKPV S VK+SEL+YNEYIVY+ AQVK+QFL+KVRFQ+K
Sbjct  931  AKWRDDVIVPCGKPVSSNVKSSELMYNEYIVYNTAQVKMQFLLKVRFQHK  980



>ref|XP_003554282.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Glycine max]
 gb|KHN02523.1| Poly [ADP-ribose] polymerase 1 [Glycine soja]
Length=996

 Score =   308 bits (789),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+R KL NRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+
Sbjct  825  EGEFDKFAPYRDKLGNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADL  884

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT++KNPVG MLLSEVALG+++ELKKA+YMDKPP+GKHSTKGLGK +PQES+
Sbjct  885  VSKSAQYCFTDKKNPVGLMLLSEVALGNVYELKKAKYMDKPPEGKHSTKGLGKKMPQESE  944

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            YVKWR  V VPCGKPVPS VK+SEL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  945  YVKWRGNVTVPCGKPVPSNVKSSELMYNEYIVYNTAQVKMQFLLKVRFHHK  995



>ref|XP_010918778.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Elaeis guineensis]
Length=947

 Score =   307 bits (786),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+ P+R KL+N+MLLWHGSRLTNFVGI+SQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  776  EGEYDKYTPYRDKLQNKMLLWHGSRLTNFVGIISQGLRIAPPEAPATGYMFGKGIYFADL  835

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+ ++KNPVG MLLSEVALG+++ELKKA YM+KPPKGKHSTKGLGKTVP ESD
Sbjct  836  VSKSAQYCYVDKKNPVGLMLLSEVALGEIYELKKATYMEKPPKGKHSTKGLGKTVPLESD  895

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKW+D+VVVPCGKPVPS ++ASELLYNEYIVYD AQVKLQFL+KVRF +K
Sbjct  896  FVKWQDQVVVPCGKPVPSSIRASELLYNEYIVYDTAQVKLQFLLKVRFHHK  946



>ref|XP_010679215.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=983

 Score =   307 bits (787),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFA  R+KL NRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+
Sbjct  812  EGEHDKFASQREKLGNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADL  871

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T+RKNPVG MLLSEVALG +HELKKAQYM+KPP+GKHSTKGLGK VP E+ 
Sbjct  872  VSKSAQYCYTDRKNPVGLMLLSEVALGQVHELKKAQYMEKPPRGKHSTKGLGKKVPAEAG  931

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + KW+DEVVVPCGKPV SKVK+SEL+YNEYIVYD AQVK+QFL+KVRF YK
Sbjct  932  FAKWKDEVVVPCGKPVDSKVKSSELMYNEYIVYDTAQVKMQFLLKVRFHYK  982



>ref|XP_009144226.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Brassica 
rapa]
Length=966

 Score =   306 bits (785),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  795  EGEFDKYAPHREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  854

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+++NPVG MLLSEVALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S+
Sbjct  855  VSKSAQYCFTSKENPVGLMLLSEVALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSE  914

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + KWRD+V VPCGKPVPSK KASEL+YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  915  FAKWRDDVTVPCGKPVPSKAKASELMYNEYIVYNTAQVKLQFLLKVRFKHK  965



>ref|XP_009144225.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Brassica 
rapa]
Length=967

 Score =   306 bits (785),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  796  EGEFDKYAPHREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  855

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+++NPVG MLLSEVALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S+
Sbjct  856  VSKSAQYCFTSKENPVGLMLLSEVALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSE  915

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + KWRD+V VPCGKPVPSK KASEL+YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  916  FAKWRDDVTVPCGKPVPSKAKASELMYNEYIVYNTAQVKLQFLLKVRFKHK  966



>ref|XP_011028774.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Populus euphratica]
Length=996

 Score =   306 bits (785),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE D+FAP+R+ LKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFAD+
Sbjct  824  RGEFDRFAPYRETLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADL  883

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT++KNPVG MLLSEVALG+++ELKKA YM+KPP+GKHSTKGLGK VP+ES 
Sbjct  884  VSKSAQYCFTDKKNPVGLMLLSEVALGEVYELKKATYMEKPPEGKHSTKGLGKKVPEESG  943

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             VKWR++V+VPCGKPV SKVKASEL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  944  CVKWRNDVIVPCGKPVSSKVKASELMYNEYIVYNTAQVKMQFLLKVRFHHK  994



>emb|CDY24761.1| BnaC04g13660D [Brassica napus]
Length=918

 Score =   305 bits (782),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  747  EGEFDKYAPHREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  806

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T+++NPVG MLLSEVALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S+
Sbjct  807  VSKSAQYCYTSKENPVGLMLLSEVALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSE  866

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + KWRD+V VPCGKPVPSK KASEL+YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  867  FAKWRDDVTVPCGKPVPSKAKASELMYNEYIVYNTAQVKLQFLLKVRFKHK  917



>ref|XP_008461881.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X3 [Cucumis 
melo]
Length=932

 Score =   305 bits (782),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKF PFR+KLKN+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  761  EGEFDKFVPFRQKLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  820

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T+RKNP+GFM+LSEVALG+++ELKKA+YM+KPP+GKHSTKGLGK VP  S+
Sbjct  821  VSKSAQYCYTDRKNPIGFMILSEVALGEVYELKKAEYMEKPPRGKHSTKGLGKKVPDVSE  880

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKW+++VVVPCGKPV S VKASEL+YNEYIVYD  QVK+QFL+KVRF YK
Sbjct  881  HVKWKEDVVVPCGKPVASNVKASELMYNEYIVYDTVQVKMQFLLKVRFHYK  931



>ref|XP_002302058.2| poly (ADP-ribose) polymerase family protein [Populus trichocarpa]
 gb|EEE81331.2| poly (ADP-ribose) polymerase family protein [Populus trichocarpa]
Length=996

 Score =   306 bits (785),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE D+FA +R+ LKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFAD+
Sbjct  824  RGEFDRFARYRETLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADL  883

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT++KNPVG MLLSEVALG+++ELKKA YM+KPP+GKHSTKGLGK VP+ES 
Sbjct  884  VSKSAQYCFTDKKNPVGLMLLSEVALGEVYELKKATYMEKPPEGKHSTKGLGKKVPEESG  943

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            YVKWR++V+VPCGKPV SKVKASEL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  944  YVKWRNDVIVPCGKPVSSKVKASELMYNEYIVYNTAQVKMQFLLKVRFHHK  994



>gb|KFK31229.1| hypothetical protein AALP_AA6G085200 [Arabis alpina]
Length=984

 Score =   306 bits (784),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP+R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  813  EGEFDKYAPYREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  872

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT++K+PVG MLLSEVALG++HEL KA+YMDKPP+GKHSTKGLGK VPQES+
Sbjct  873  VSKSAQYCFTSKKDPVGLMLLSEVALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQESE  932

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + KWRD+V VPCGKPV SKVKASEL+YNEYIVY+ +QVKLQFL+KVRF++K
Sbjct  933  FAKWRDDVTVPCGKPVSSKVKASELMYNEYIVYNTSQVKLQFLLKVRFKHK  983



>ref|XP_003521279.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Glycine 
max]
Length=997

 Score =   306 bits (784),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+R KL NRMLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKGVYFAD+
Sbjct  826  EGESDKFAPYRDKLGNRMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGVYFADL  885

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT++KNPVG MLLSEVALG+++ELKKA+YMDKPP+GKHSTKGLGK +PQES+
Sbjct  886  VSKSAQYCFTDKKNPVGLMLLSEVALGNVYELKKAKYMDKPPEGKHSTKGLGKKMPQESE  945

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            YVKWR  V VPCGKPVPS VK+SEL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  946  YVKWRGNVTVPCGKPVPSNVKSSELMYNEYIVYNTAQVKMQFLLKVRFHHK  996



>ref|XP_007162524.1| hypothetical protein PHAVU_001G159200g [Phaseolus vulgaris]
 gb|ESW34518.1| hypothetical protein PHAVU_001G159200g [Phaseolus vulgaris]
Length=1002

 Score =   306 bits (783),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE DKFAP+R KL NRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+
Sbjct  831   EGEFDKFAPYRDKLGNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADL  890

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSAQYCFT++KNP+G MLLSEVALG+++ELKKA+YMDKPP+GKHSTKGLGK +PQES+
Sbjct  891   VSKSAQYCFTDKKNPIGLMLLSEVALGNIYELKKAKYMDKPPEGKHSTKGLGKKMPQESE  950

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
               KWR  V VPCGKPVPS VKASEL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  951   CAKWRGNVTVPCGKPVPSNVKASELMYNEYIVYNTAQVKMQFLLKVRFHHK  1001



>ref|XP_008461878.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Cucumis 
melo]
 ref|XP_008461879.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Cucumis 
melo]
Length=980

 Score =   305 bits (782),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKF PFR+KLKN+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  809  EGEFDKFVPFRQKLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  868

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T+RKNP+GFM+LSEVALG+++ELKKA+YM+KPP+GKHSTKGLGK VP  S+
Sbjct  869  VSKSAQYCYTDRKNPIGFMILSEVALGEVYELKKAEYMEKPPRGKHSTKGLGKKVPDVSE  928

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKW+++VVVPCGKPV S VKASEL+YNEYIVYD  QVK+QFL+KVRF YK
Sbjct  929  HVKWKEDVVVPCGKPVASNVKASELMYNEYIVYDTVQVKMQFLLKVRFHYK  979



>ref|XP_010933094.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1-like [Elaeis guineensis]
Length=985

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP+R KL+N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  814  EGEYDKYAPYRDKLRNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGLYFADL  873

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+ ++KNPVG MLLSEVALG+++ELKKA YM+KPPKGKHSTKGLGKTVP E++
Sbjct  874  VSKSAQYCYVDKKNPVGLMLLSEVALGEIYELKKATYMEKPPKGKHSTKGLGKTVPLETE  933

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRD+VV+PCGKPVPS ++ASELLYNEYIVY+ AQVKLQFL+KVRF +K
Sbjct  934  FVKWRDQVVLPCGKPVPSSIRASELLYNEYIVYNTAQVKLQFLLKVRFHHK  984



>ref|XP_008461880.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Cucumis 
melo]
Length=979

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKF PFR+KLKN+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  808  EGEFDKFVPFRQKLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  867

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T+RKNP+GFM+LSEVALG+++ELKKA+YM+KPP+GKHSTKGLGK VP  S+
Sbjct  868  VSKSAQYCYTDRKNPIGFMILSEVALGEVYELKKAEYMEKPPRGKHSTKGLGKKVPDVSE  927

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKW+++VVVPCGKPV S VKASEL+YNEYIVYD  QVK+QFL+KVRF YK
Sbjct  928  HVKWKEDVVVPCGKPVASNVKASELMYNEYIVYDTVQVKMQFLLKVRFHYK  978



>gb|EMS59387.1| Poly [ADP-ribose] polymerase 1 [Triticum urartu]
Length=486

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE +K++ ++  L N+MLLWHGSRLTNF+GILSQGLRIAPPEAP TGYMFGKG+YFAD+V
Sbjct  316  GEGNKYSRYKNNLHNKMLLWHGSRLTNFIGILSQGLRIAPPEAPVTGYMFGKGLYFADLV  375

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+ +RKNP G MLLSEVALGDMHELKKA  MDKPP+GKHSTKGLGKTVP ES++
Sbjct  376  SKSAQYCYVDRKNPTGLMLLSEVALGDMHELKKATPMDKPPRGKHSTKGLGKTVPLESEF  435

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            VKWRD+VVVPCGKPVP+ ++ASELLYNEYIVY+ AQVK+QFL+KV+F++K
Sbjct  436  VKWRDDVVVPCGKPVPASIRASELLYNEYIVYNTAQVKMQFLLKVKFRHK  485



>ref|XP_010522166.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Tarenaya hassleriana]
Length=986

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+R+KL N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+
Sbjct  811  EGEFDKFAPYREKLGNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADL  870

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T+++NPVG MLLSEVALG+++EL KA+YMDKPP+GKHSTKGLGK VP E D
Sbjct  871  VSKSAQYCYTSKENPVGLMLLSEVALGEVYELTKAKYMDKPPRGKHSTKGLGKKVPHEQD  930

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRD+V VPCGKPV SKVKASEL+YNEYIVY+ AQVKLQFL+KVRF +K
Sbjct  931  FVKWRDDVTVPCGKPVASKVKASELMYNEYIVYNTAQVKLQFLLKVRFHHK  981



>emb|CDY10794.1| BnaA05g11420D [Brassica napus]
Length=1322

 Score =   307 bits (787),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE DK+AP R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  1151  EGEFDKYAPHREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  1210

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSAQYCFT+++NPVG MLLSEVALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S+
Sbjct  1211  VSKSAQYCFTSKENPVGLMLLSEVALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSE  1270

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             + KWRD+V VPCGKPVPSK KASEL+YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  1271  FAKWRDDVTVPCGKPVPSKAKASELMYNEYIVYNTAQVKLQFLLKVRFKHK  1321



>gb|KEH23887.1| poly(ADP-ribose) polymerase domain protein [Medicago truncatula]
Length=1006

 Score =   305 bits (780),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE DK+AP+R K+ NRMLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  835   EGEFDKYAPYRDKVGNRMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  894

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSAQYCFT++KNPVG MLLSEVALG+++ELKKA+YMDKPP+GKHSTKGLGK +P ES+
Sbjct  895   VSKSAQYCFTDKKNPVGLMLLSEVALGNVYELKKAKYMDKPPQGKHSTKGLGKKMPLESE  954

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             Y KWRD+VVVPCGKPV S VKASEL+YNEYIVY+ AQVKLQFL+KVRF +K
Sbjct  955   YAKWRDDVVVPCGKPVSSNVKASELMYNEYIVYNTAQVKLQFLLKVRFHHK  1005



>ref|XP_006293618.1| hypothetical protein CARUB_v10022570mg [Capsella rubella]
 gb|EOA26516.1| hypothetical protein CARUB_v10022570mg [Capsella rubella]
Length=985

 Score =   304 bits (778),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP+R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  814  EGEFDKYAPYREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  873

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T ++NPVG MLLSEVALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+SD
Sbjct  874  VSKSAQYCYTGKENPVGLMLLSEVALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSD  933

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + KWR +V VPCGKPV SKVKASEL+YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  934  FAKWRGDVTVPCGKPVSSKVKASELMYNEYIVYNTAQVKLQFLLKVRFKHK  984



>ref|NP_850165.1| poly [ADP-ribose] polymerase 2 [Arabidopsis thaliana]
 sp|Q9ZP54.2|PARP1_ARATH RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Arabidopsis thaliana]
 emb|CAA10482.1| poly(ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AAM13882.1| putative poly (ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AAN12901.1| putative poly(ADP-ribose) polymerase [Arabidopsis thaliana]
 gb|AEC08527.1| poly [ADP-ribose] polymerase 2 [Arabidopsis thaliana]
Length=983

 Score =   303 bits (775),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  812  EGEFDKYAPHREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  871

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T +KNPVG MLLSEVALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S+
Sbjct  872  VSKSAQYCYTCKKNPVGLMLLSEVALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSE  931

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + KWR +V VPCGKPV SKVKASEL+YNEYIVYD AQVKLQFL+KVRF++K
Sbjct  932  FAKWRGDVTVPCGKPVSSKVKASELMYNEYIVYDTAQVKLQFLLKVRFKHK  982



>gb|ADE76583.1| unknown [Picea sitchensis]
Length=456

 Score =   290 bits (741),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            KGE D + P++   KNRMLLWHGSR+TNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  286  KGEYDAYFPYKSNFKNRMLLWHGSRVTNFVGILSQGLRIAPPEAPATGYMFGKGLYFADL  345

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T++KNPVG MLLSEVALG++HELK A+YMDKPPKGKHSTKG+GKT P +++
Sbjct  346  VSKSAQYCYTHKKNPVGLMLLSEVALGEVHELKSAKYMDKPPKGKHSTKGVGKTKPLDTE  405

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            Y +W D+V VPCG+PVPS VK S+LLYNEYIVYD AQVKLQFL+KVRF+YK
Sbjct  406  YERWGDDVTVPCGRPVPSSVKNSDLLYNEYIVYDPAQVKLQFLLKVRFRYK  456



>ref|XP_009398035.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=959

 Score =   301 bits (772),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP R  L+N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  788  EGEFDKFAPRRDTLQNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  847

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+ ++K+PVG MLLSEVALG+++ELKKA YMDKPPKGK STKGLGKTVP ES+
Sbjct  848  VSKSAQYCYVDKKDPVGLMLLSEVALGEIYELKKATYMDKPPKGKLSTKGLGKTVPLESE  907

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKW+DEVVVPCG+PVPS V+ASELLYNEYIVYD AQVK+QFL+KVRF +K
Sbjct  908  HVKWKDEVVVPCGRPVPSSVRASELLYNEYIVYDTAQVKMQFLLKVRFHHK  958



>gb|KJB42240.1| hypothetical protein B456_007G144300 [Gossypium raimondii]
Length=992

 Score =   302 bits (773),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+R+KL NRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+
Sbjct  821  EGEFDKFAPYREKLSNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADL  880

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+RKNPVG MLLSEVALG+++EL KA+Y++K PKGKHSTKGLGK VP++SD
Sbjct  881  VSKSAQYCFTDRKNPVGLMLLSEVALGEVYELTKAKYIEKLPKGKHSTKGLGKKVPKKSD  940

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKW+D+++VPCGKPVPS VK SEL+YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  941  FVKWKDDIIVPCGKPVPSSVKESELMYNEYIVYNTSQVKMQFLLKVRFHHK  991



>gb|AAD20677.1| putative poly (ADP-ribose) polymerase [Arabidopsis thaliana]
Length=1009

 Score =   302 bits (774),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE DK+AP R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  838   EGEFDKYAPHREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  897

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSAQYC+T +KNPVG MLLSEVALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S+
Sbjct  898   VSKSAQYCYTCKKNPVGLMLLSEVALGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSE  957

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             + KWR +V VPCGKPV SKVKASEL+YNEYIVYD AQVKLQFL+KVRF++K
Sbjct  958   FAKWRGDVTVPCGKPVSSKVKASELMYNEYIVYDTAQVKLQFLLKVRFKHK  1008



>ref|XP_009398034.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=982

 Score =   301 bits (772),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP R  L+N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  811  EGEFDKFAPRRDTLQNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  870

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+ ++K+PVG MLLSEVALG+++ELKKA YMDKPPKGK STKGLGKTVP ES+
Sbjct  871  VSKSAQYCYVDKKDPVGLMLLSEVALGEIYELKKATYMDKPPKGKLSTKGLGKTVPLESE  930

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKW+DEVVVPCG+PVPS V+ASELLYNEYIVYD AQVK+QFL+KVRF +K
Sbjct  931  HVKWKDEVVVPCGRPVPSSVRASELLYNEYIVYDTAQVKMQFLLKVRFHHK  981



>ref|XP_004493762.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cicer arietinum]
Length=998

 Score =   302 bits (773),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+R KL NRMLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  827  EGEFDKFAPYRDKLGNRMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  886

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T++KNPVG MLLSEVALG+++ELKKA+YMDKPP+GKHSTKGLGK +P ES+
Sbjct  887  VSKSAQYCYTDKKNPVGLMLLSEVALGNVYELKKAKYMDKPPEGKHSTKGLGKKMPLESE  946

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            YVKWR +VVVPCGKPV S VKASEL+YNE+IVY+ AQVKLQFL+KVRF +K
Sbjct  947  YVKWRGDVVVPCGKPVSSNVKASELMYNEFIVYNTAQVKLQFLLKVRFHHK  997



>ref|XP_004151977.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cucumis sativus]
 ref|XP_004160262.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Cucumis sativus]
 gb|KGN57935.1| hypothetical protein Csa_3G398930 [Cucumis sativus]
Length=980

 Score =   301 bits (772),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 159/171 (93%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKF PFR+KLKN+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  809  EGEFDKFVPFRQKLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  868

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T+R NP+GFM+LSEVALG+++ELKKA+YM+KPP+GKHSTKGLGK VP   +
Sbjct  869  VSKSAQYCYTDRNNPIGFMILSEVALGEVYELKKAEYMEKPPRGKHSTKGLGKKVPAALE  928

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKW+++VVVPCGKPV S VKASEL+YNEYIVYD AQVK+QFL+KVRF +K
Sbjct  929  HVKWKEDVVVPCGKPVASNVKASELMYNEYIVYDTAQVKMQFLLKVRFHHK  979



>ref|XP_002881169.1| hypothetical protein ARALYDRAFT_902162 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57428.1| hypothetical protein ARALYDRAFT_902162 [Arabidopsis lyrata subsp. 
lyrata]
Length=979

 Score =   301 bits (770),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP R KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  808  EGEFDKYAPHRDKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  867

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T +KNPVG MLLSEVALG++HEL KA+YMDKPPKGKHSTKGLGK VPQ+S+
Sbjct  868  VSKSAQYCYTCKKNPVGLMLLSEVALGEIHELTKAKYMDKPPKGKHSTKGLGKKVPQDSE  927

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + KWR +V VPCGKPV SKVKASEL+YNEYIVY+ AQVKLQFL+KVRF++K
Sbjct  928  FAKWRGDVTVPCGKPVASKVKASELMYNEYIVYNTAQVKLQFLLKVRFKHK  978



>ref|XP_008794292.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Phoenix dactylifera]
Length=981

 Score =   301 bits (770),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+A +R KL N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  810  EGEYDKYASYRDKLHNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  869

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+ ++KNPVG MLLSEVALG+++ELKKA Y++KPPKGKHSTKGLGKT P ES+
Sbjct  870  VSKSAQYCYVDKKNPVGLMLLSEVALGEIYELKKATYIEKPPKGKHSTKGLGKTAPLESE  929

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRD+VVVPCGKPVPS ++ASELLYNEYIVY+ AQVKLQFL+KVRF +K
Sbjct  930  FVKWRDQVVVPCGKPVPSSIRASELLYNEYIVYNTAQVKLQFLLKVRFHHK  980



>ref|XP_008801332.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Phoenix dactylifera]
Length=901

 Score =   299 bits (766),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+ P+  KL+N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKGVYFAD+
Sbjct  730  EGEYDKYTPYTDKLQNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGVYFADL  789

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             SKSAQYC+ ++KNPVG MLLSEVALG+++ELKKA YM+K PKGKHSTKGLGKTVP ES+
Sbjct  790  ASKSAQYCYVDKKNPVGLMLLSEVALGEIYELKKATYMEKAPKGKHSTKGLGKTVPLESE  849

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKWRD+VVVPCGKPVPS ++ASEL+YNEYIVYD AQVKLQFL+KVRF +K
Sbjct  850  FVKWRDQVVVPCGKPVPSSIRASELMYNEYIVYDTAQVKLQFLLKVRFHHK  900



>ref|XP_010469693.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Camelina sativa]
Length=985

 Score =   300 bits (768),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP+R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  814  EGEFDKYAPYREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  873

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T +KNPVG MLLSEVALG++HEL KA YMDKPP+GKHSTKGLGK VPQ+S+
Sbjct  874  VSKSAQYCYTCKKNPVGLMLLSEVALGEIHELTKATYMDKPPRGKHSTKGLGKKVPQDSE  933

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + KWR +V VPCGKPV SKVKASEL+YNEYIVY+ AQVKLQ+L+KVRF++K
Sbjct  934  FAKWRGDVTVPCGKPVSSKVKASELMYNEYIVYNTAQVKLQYLLKVRFKHK  984



>ref|XP_010510210.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Camelina sativa]
Length=985

 Score =   300 bits (768),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP+R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  814  EGEFDKYAPYREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  873

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T +KNPVG MLLSEVALG++HEL KA YMDKPP+GKHSTKGLGK VPQ+S+
Sbjct  874  VSKSAQYCYTCKKNPVGLMLLSEVALGEIHELTKATYMDKPPRGKHSTKGLGKKVPQDSE  933

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + KWR +V VPCGKPV SKVKASEL+YNEYIVY+ AQVKLQ+L+KVRF++K
Sbjct  934  FAKWRGDVTVPCGKPVSSKVKASELMYNEYIVYNTAQVKLQYLLKVRFKHK  984



>gb|EPS63698.1| hypothetical protein M569_11084 [Genlisea aurea]
Length=981

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+APFRKKL NRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  810  EGETDKYAPFRKKLSNRMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGIYFADL  869

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT+  NPVG MLLSEVALG+M+EL K+QYM+KPPKGKHSTKGLGK VP ES+
Sbjct  870  VSKSAQYCFTDPDNPVGLMLLSEVALGEMYELTKSQYMEKPPKGKHSTKGLGKNVPLESE  929

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +++WRD VVVPCGK V S VK+SEL+YNEYIVYD AQVK+QFL+KVRF +K
Sbjct  930  FMQWRDGVVVPCGKAVTSGVKSSELMYNEYIVYDSAQVKMQFLLKVRFHHK  980



>ref|XP_010414140.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelina sativa]
Length=985

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK+AP+R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  814  EGEFDKYAPYREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  873

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T +KNPVG MLLSEVALG++HEL KA YMDKPP+GKHSTKGLGK VPQ+S+
Sbjct  874  VSKSAQYCYTCKKNPVGLMLLSEVALGEIHELTKATYMDKPPRGKHSTKGLGKKVPQDSE  933

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + KWR +V VPCGKPV SKVKASEL+YNEYIVY+ AQVKLQ+L+KVRF++K
Sbjct  934  FAKWRGDVSVPCGKPVSSKVKASELMYNEYIVYNTAQVKLQYLLKVRFKHK  984



>ref|XP_004959167.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Setaria italica]
Length=845

 Score =   295 bits (756),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GEL+K++ ++  L N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+V
Sbjct  675  GELNKYSRYKNNLHNKMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLV  734

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+ +R NPVG MLLSEVALGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++
Sbjct  735  SKSAQYCYVDRGNPVGLMLLSEVALGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEF  794

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            V WRD+VVVPCGKPVPS V++SELLYNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  795  VNWRDDVVVPCGKPVPSSVRSSELLYNEYIVYNTSQVKMQFLLKVRFHHK  844



>ref|XP_007050347.1| Poly(ADP-ribose) polymerase 2 isoform 1 [Theobroma cacao]
 gb|EOX94504.1| Poly(ADP-ribose) polymerase 2 isoform 1 [Theobroma cacao]
Length=976

 Score =   296 bits (758),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+R+KL NRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  805  EGEFDKFAPYREKLINRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  864

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T++++PVG MLLSEVALG+++EL KA+Y++K PKGKHSTKGLGK VPQES+
Sbjct  865  VSKSAQYCYTHKQSPVGLMLLSEVALGEVYELTKAKYIEKLPKGKHSTKGLGKKVPQESE  924

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKW+D ++VPCGKPV S+VKASEL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  925  FVKWKDNIIVPCGKPVSSRVKASELMYNEYIVYNTAQVKMQFLLKVRFHHK  975



>ref|XP_007050348.1| Poly(ADP-ribose) polymerase 2 isoform 2 [Theobroma cacao]
 gb|EOX94505.1| Poly(ADP-ribose) polymerase 2 isoform 2 [Theobroma cacao]
Length=991

 Score =   296 bits (758),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 160/171 (94%), Gaps = 0/171 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+R+KL NRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  820  EGEFDKFAPYREKLINRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  879

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T++++PVG MLLSEVALG+++EL KA+Y++K PKGKHSTKGLGK VPQES+
Sbjct  880  VSKSAQYCYTHKQSPVGLMLLSEVALGEVYELTKAKYIEKLPKGKHSTKGLGKKVPQESE  939

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +VKW+D ++VPCGKPV S+VKASEL+YNEYIVY+ AQVK+QFL+KVRF +K
Sbjct  940  FVKWKDNIIVPCGKPVSSRVKASELMYNEYIVYNTAQVKMQFLLKVRFHHK  990



>emb|CAA10889.1| poly(ADP-ribose) polymerase [Zea mays]
Length=969

 Score =   296 bits (757),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GEL+K++ ++  L N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+V
Sbjct  799  GELNKYSRYKNNLHNKMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLV  858

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+ +R NPVG MLLSEVALGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++
Sbjct  859  SKSAQYCYVDRNNPVGLMLLSEVALGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEF  918

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            VKWRD+VVVPCGKPVPS +++SEL+YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  919  VKWRDDVVVPCGKPVPSSIRSSELMYNEYIVYNTSQVKMQFLLKVRFHHK  968



>tpg|DAA39431.1| TPA: hypothetical protein ZEAMMB73_927988 [Zea mays]
Length=969

 Score =   296 bits (757),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GEL+K++ ++  L N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+V
Sbjct  799  GELNKYSRYKNNLHNKMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLV  858

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+ +R NPVG MLLSEVALGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++
Sbjct  859  SKSAQYCYVDRNNPVGLMLLSEVALGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEF  918

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            VKWRD+VVVPCGKPVPS +++SEL+YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  919  VKWRDDVVVPCGKPVPSSIRSSELMYNEYIVYNTSQVKMQFLLKVRFHHK  968



>ref|NP_001288538.1| poly [ADP-ribose] polymerase 1 [Zea mays]
 sp|Q9ZSV1.1|PARP1_MAIZE RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Zea mays]
 gb|AAC79704.1| poly(ADP)-ribose polymerase [Zea mays]
 tpg|DAA39432.1| TPA: poly [ADP-ribose] polymerase 1(NAD(+) ADP-ribosyltransferase 
1) [Zea mays]
Length=980

 Score =   296 bits (757),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GEL+K++ ++  L N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+V
Sbjct  810  GELNKYSRYKNNLHNKMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLV  869

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+ +R NPVG MLLSEVALGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++
Sbjct  870  SKSAQYCYVDRNNPVGLMLLSEVALGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEF  929

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            VKWRD+VVVPCGKPVPS +++SEL+YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  930  VKWRDDVVVPCGKPVPSSIRSSELMYNEYIVYNTSQVKMQFLLKVRFHHK  979



>ref|XP_002459755.1| hypothetical protein SORBIDRAFT_02g009900 [Sorghum bicolor]
 gb|EER96276.1| hypothetical protein SORBIDRAFT_02g009900 [Sorghum bicolor]
Length=931

 Score =   295 bits (755),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GEL+K++ ++  L N+MLLWHGSRLTNFVGILSQGLRIAPPEAP +GYMFGKG+YFAD+V
Sbjct  761  GELNKYSRYKNNLHNKMLLWHGSRLTNFVGILSQGLRIAPPEAPVSGYMFGKGLYFADLV  820

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC  +R NPVG M+LSEVALGDM+ELKKA YMDKPP+GKHSTKGLGKTVP ES++
Sbjct  821  SKSAQYCNVDRNNPVGLMILSEVALGDMNELKKATYMDKPPRGKHSTKGLGKTVPLESEF  880

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            VKWRD+VVVPCGKPVPS +++SEL+YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  881  VKWRDDVVVPCGKPVPSSIRSSELMYNEYIVYNTSQVKMQFLLKVRFHHK  930



>gb|EMT10594.1| Poly (ADP-ribose) polymerase 1 [Aegilops tauschii]
Length=607

 Score =   288 bits (736),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 169/215 (79%), Gaps = 14/215 (7%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE +K++ ++  L N+MLLWHGSRLTNF+GILSQGLRIAPPEAP TGYMFGKG+YFAD+V
Sbjct  316  GEGNKYSRYKNNLHNKMLLWHGSRLTNFIGILSQGLRIAPPEAPVTGYMFGKGLYFADLV  375

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+ +RKNP G MLLSEVALGDMHELKKA  MDKPP+GKHSTKGLGKTVP ES++
Sbjct  376  SKSAQYCYVDRKNPTGLMLLSEVALGDMHELKKATPMDKPPRGKHSTKGLGKTVPLESEF  435

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK**TKILHY*C  110
            VKWRD+VVVPCGKPVP+ ++ASELLYNEYIVY+ AQVK+QFL+K           LH  C
Sbjct  436  VKWRDDVVVPCGKPVPASIRASELLYNEYIVYNTAQVKMQFLLKYSVAS------LH--C  487

Query  109  FL-----ELYIMVEPMLDILLLSTLPFEI-AWLFG  23
             +     EL+  + P     ++ST    + +WL+G
Sbjct  488  CICNGIGELFRSLRPSQQKKIISTCKNHVSSWLYG  522



>ref|XP_006657714.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Oryza brachyantha]
Length=976

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE +K++ ++  L N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+V
Sbjct  806  GEFNKYSRYKNNLHNKMLLWHGSRLTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLV  865

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+ +RKNPVG MLLSEVALGDM+ELKKA  MDKPP+GKHSTKGLG+TVP ES++
Sbjct  866  SKSAQYCYVDRKNPVGLMLLSEVALGDMYELKKATSMDKPPRGKHSTKGLGRTVPLESEF  925

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             KWRD+VVVPCGKPVP+ +KASELLYNEYIVY+ +QVK+QFL+KVRF +K
Sbjct  926  AKWRDDVVVPCGKPVPANIKASELLYNEYIVYNTSQVKMQFLLKVRFHHK  975



>gb|EEC81908.1| hypothetical protein OsI_25738 [Oryza sativa Indica Group]
Length=977

 Score =   290 bits (743),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE +K++ ++  L N+MLLWHGSRLTN+VGILSQGLRIAPPEAP TGYMFGKG+YFAD+V
Sbjct  807  GEFNKYSRYKNNLHNKMLLWHGSRLTNYVGILSQGLRIAPPEAPVTGYMFGKGLYFADLV  866

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+ +RKNPVG MLLSEVALGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++
Sbjct  867  SKSAQYCYVDRKNPVGLMLLSEVALGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEF  926

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             KWRD+VVVPCGKPVP+ +K SEL+YNEYIVY+ +QVK+Q+L+KVRF +K
Sbjct  927  AKWRDDVVVPCGKPVPASIKTSELMYNEYIVYNTSQVKMQYLLKVRFHHK  976



>ref|NP_001059453.1| Os07g0413700 [Oryza sativa Japonica Group]
 sp|Q7EYV7.1|PARP1_ORYSJ RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; 
AltName: Full=Poly[ADP-ribose] synthase 1 [Oryza sativa Japonica 
Group]
 dbj|BAC84104.1| putative poly(ADP)-ribose polymerase [Oryza sativa Japonica Group]
 dbj|BAF21367.1| Os07g0413700 [Oryza sativa Japonica Group]
 gb|EEE67019.1| hypothetical protein OsJ_23951 [Oryza sativa Japonica Group]
Length=977

 Score =   290 bits (742),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE  K++ ++  L N+MLLWHGSRLTN+VGILSQGLRIAPPEAP TGYMFGKG+YFAD+V
Sbjct  807  GEFSKYSRYKNNLHNKMLLWHGSRLTNYVGILSQGLRIAPPEAPVTGYMFGKGLYFADLV  866

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+ +RKNPVG MLLSEVALGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++
Sbjct  867  SKSAQYCYVDRKNPVGLMLLSEVALGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEF  926

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             KWRD+VVVPCGKPVP+ +K SEL+YNEYIVY+ +QVK+Q+L+KVRF +K
Sbjct  927  AKWRDDVVVPCGKPVPASIKTSELMYNEYIVYNTSQVKMQYLLKVRFHHK  976



>emb|CDP03723.1| unnamed protein product [Coffea canephora]
Length=986

 Score =   288 bits (738),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFAP+R+KL N+MLLWHGSRLTNFVGILSQGLRIAPPEAP +GYMFGKG+YFAD+
Sbjct  817  EGEYDKFAPYREKLGNKMLLWHGSRLTNFVGILSQGLRIAPPEAPASGYMFGKGIYFADL  876

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYCFT++KNPVG MLLSEVALG+++EL  A+YM+KPP GKHSTKGLGK VPQES 
Sbjct  877  VSKSAQYCFTDKKNPVGLMLLSEVALGEVYELTNAKYMEKPPAGKHSTKGLGKNVPQESG  936

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            ++KW+ +VVVPCG+PV S +K SELLYNEYIVY+ AQVKLQFL+KVRF +K
Sbjct  937  FLKWQGDVVVPCGRPV-STLKPSELLYNEYIVYNTAQVKLQFLLKVRFHHK  986



>emb|CAN75718.1| hypothetical protein VITISV_037618 [Vitis vinifera]
Length=1016

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/157 (83%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKFA +R+KL+NRMLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+
Sbjct  837  EGEFDKFASYREKLQNRMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADL  896

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T+RKNPVG MLLSEVALG+++EL+KA YMDKPP+GKHSTKGLGK  PQ+S+
Sbjct  897  VSKSAQYCYTDRKNPVGLMLLSEVALGEVYELRKAMYMDKPPEGKHSTKGLGKKKPQDSE  956

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQ  182
            YVKWRDEVVVPCGKPVPS VK++EL+YNEYIVY+ AQ
Sbjct  957  YVKWRDEVVVPCGKPVPSNVKSTELMYNEYIVYNTAQ  993



>ref|XP_003557295.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Brachypodium distachyon]
Length=975

 Score =   286 bits (731),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE +K++ ++  L N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+V
Sbjct  805  GESNKYSRYKNNLHNKMLLWHGSRLTNFVGILSQGLRIAPPEAPMTGYMFGKGLYFADLV  864

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+ ++ NP G MLLSEVALGDMHELKKA  MDKPP+GKHSTKGLGKTVP ES++
Sbjct  865  SKSAQYCYADKNNPTGLMLLSEVALGDMHELKKAMPMDKPPRGKHSTKGLGKTVPLESEF  924

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            V+W D VVVPCGKPVP+ ++ASELLYNEYIVY+ +QVK++FL+KVRF +K
Sbjct  925  VEWSDGVVVPCGKPVPASIRASELLYNEYIVYNTSQVKMRFLLKVRFHHK  974



>gb|KHN10726.1| Poly [ADP-ribose] polymerase 1 [Glycine soja]
Length=1526

 Score =   288 bits (737),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE DKFAP+R KL NRMLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKGVYFAD+
Sbjct  1358  EGEFDKFAPYRDKLGNRMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGVYFADL  1417

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSAQYCFT++KNPVG MLLSEVALG+++ELKKA+YMDKPP+GKHSTKGLGK +PQES+
Sbjct  1418  VSKSAQYCFTDKKNPVGLMLLSEVALGNVYELKKAKYMDKPPEGKHSTKGLGKKMPQESE  1477

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQ  170
             YVKWR  V VPCGKPVPS VK+SEL+YNEYIVY+ AQV  +
Sbjct  1478  YVKWRGNVTVPCGKPVPSNVKSSELMYNEYIVYNTAQVSFK  1518



>ref|XP_006410264.1| hypothetical protein EUTSA_v10016190mg [Eutrema salsugineum]
 gb|ESQ51717.1| hypothetical protein EUTSA_v10016190mg [Eutrema salsugineum]
Length=966

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DK++P+R+KL N+MLLWHGSRLTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  804  EGEFDKYSPYREKLGNKMLLWHGSRLTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADL  863

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T ++NPVG MLLSEVALG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+SD
Sbjct  864  VSKSAQYCYTCKENPVGLMLLSEVALGEVHELTKAKYMDKPPRGKHSTKGLGKKVPQDSD  923

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQV  179
            + KWRD+V VPCGKPV SKVKASEL+YNEYIVY+ AQV
Sbjct  924  FAKWRDDVTVPCGKPVSSKVKASELMYNEYIVYNTAQV  961



>ref|XP_006827511.1| hypothetical protein AMTR_s00009p00184050 [Amborella trichopoda]
 gb|ERM94927.1| hypothetical protein AMTR_s00009p00184050 [Amborella trichopoda]
Length=849

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE DK+AP+R  LKN+MLLWHGSRLTNFVGILSQGLRIAPPEAP+TGYMFGKGVYFAD+V
Sbjct  533  GEFDKYAPYRDNLKNKMLLWHGSRLTNFVGILSQGLRIAPPEAPSTGYMFGKGVYFADLV  592

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYC+T++K+ VG +LLSEVALG+M+ELKKA+YM+ PP+GKHSTKGLG+  P   ++
Sbjct  593  SKSAQYCYTDKKDAVGLLLLSEVALGEMYELKKAKYMESPPEGKHSTKGLGQKTPNALEF  652

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKV  155
             KWRDE+ VPCG PV S V+A+EL+YNEYIVY+ AQVK+QFL+KV
Sbjct  653  EKWRDEITVPCGSPVSSGVRATELMYNEYIVYNTAQVKMQFLLKV  697



>ref|XP_010111892.1| Poly [ADP-ribose] polymerase 1 [Morus notabilis]
 gb|EXC31926.1| Poly [ADP-ribose] polymerase 1 [Morus notabilis]
Length=1022

 Score =   271 bits (693),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE DKF P R+KL N+MLLWHGSRLTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  828  QGEYDKFHPHRQKLGNKMLLWHGSRLTNFVGILSQGLRIAPPEAPATGYMFGKGIYFADL  887

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T+ KN VG +LLSEVALG+++EL KA+YMDKPP+GKHSTKGLGK VPQ+S+
Sbjct  888  VSKSAQYCYTDTKNSVGLILLSEVALGEVYELTKAKYMDKPPEGKHSTKGLGKKVPQKSE  947

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQF  167
            YVKWRD+VVVP GKPV S V+ASEL+YNEYIVY+ AQ    F
Sbjct  948  YVKWRDDVVVPAGKPVGSNVRASELMYNEYIVYNTAQCGCVF  989



>ref|XP_002969183.1| hypothetical protein SELMODRAFT_90144 [Selaginella moellendorffii]
 gb|EFJ30299.1| hypothetical protein SELMODRAFT_90144 [Selaginella moellendorffii]
Length=965

 Score =   262 bits (670),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE D +AP +  LKNRMLLWHGSR TNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+V
Sbjct  796  GEHDLYAPMKSTLKNRMLLWHGSRTTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLV  855

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYCFTNR NPVG MLLSEVALGD+ E   AQYM+KPP G  +TKG+G+T+P  S++
Sbjct  856  SKSAQYCFTNRSNPVGLMLLSEVALGDIKEYTHAQYMEKPPAGYMATKGVGRTMPDPSEF  915

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             ++ D VVVPCG+PVPS+V+ S+LLYNE+IVY  +Q++L+FL+KVRF+YK
Sbjct  916  KEFDDGVVVPCGRPVPSQVR-SDLLYNEFIVYSTSQIQLRFLLKVRFKYK  964



>ref|XP_002973881.1| hypothetical protein SELMODRAFT_100128 [Selaginella moellendorffii]
 gb|EFJ24836.1| hypothetical protein SELMODRAFT_100128 [Selaginella moellendorffii]
Length=969

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 146/170 (86%), Gaps = 1/170 (1%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE D +AP +  LKNRMLLWHGSR TNFVGILSQGLRIAPPEAP TGYMFGKGVYFAD+V
Sbjct  800  GEHDLYAPMKSTLKNRMLLWHGSRTTNFVGILSQGLRIAPPEAPATGYMFGKGVYFADLV  859

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSAQYCFTNR NPVG MLLSEVALGD+ E   AQYM+KPP G  +TKG+G+T+P  S++
Sbjct  860  SKSAQYCFTNRSNPVGLMLLSEVALGDIKEYTHAQYMEKPPAGYMATKGVGRTMPDPSEF  919

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             ++ D VVVPCG+PVPS+V+ S+LLYNE+IVY  +Q++L+FL+KVRF+YK
Sbjct  920  KEFDDGVVVPCGRPVPSQVR-SDLLYNEFIVYSTSQIQLRFLLKVRFKYK  968



>ref|XP_001769461.1| predicted protein [Physcomitrella patens]
 gb|EDQ65830.1| predicted protein [Physcomitrella patens]
Length=989

 Score =   251 bits (640),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE D FAPF+  L N MLLWHGSR TN+VGILSQGLRIAPPEAP TGYMFGKG+YFAD+
Sbjct  819  EGEADSFAPFKMCLDNHMLLWHGSRTTNYVGILSQGLRIAPPEAPVTGYMFGKGLYFADL  878

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSAQYC+T +KNP G MLLSEVALG  + LK A+YM+KP +G +ST GLGKT P E++
Sbjct  879  VSKSAQYCYTTKKNPTGLMLLSEVALGKTNNLKSAKYMEKPLRGTNSTLGLGKTKPLETE  938

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            + K+  +V VPCG+PVPS ++ S+L+YNEYIVYD AQVKL+FL+KV F++K
Sbjct  939  FKKFEGDVTVPCGQPVPSGIR-SDLMYNEYIVYDTAQVKLRFLLKVNFKHK  988



>ref|XP_007050353.1| Poly(ADP-ribose) polymerase 2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX94510.1| Poly(ADP-ribose) polymerase 2, putative isoform 1 [Theobroma 
cacao]
Length=707

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -1

Query  586  GSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLS  407
            GS LTNFVGILSQGLRIAPP+ P TGYMFGKGVYFAD+VSKS QYC+T++K+PVG MLLS
Sbjct  558  GSWLTNFVGILSQGLRIAPPQVPATGYMFGKGVYFADLVSKSDQYCYTHKKSPVGLMLLS  617

Query  406  EVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKA  227
            EVALGD++EL KA+ ++  PKGKHSTKGLGK VP+ESD++KW+D+++VPCGKPV SKVKA
Sbjct  618  EVALGDVYELTKAECIETLPKGKHSTKGLGKKVPRESDFLKWKDDIIVPCGKPVSSKVKA  677

Query  226  SELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            SEL+YNEY+VY+ AQVK+QFL+KVRF +K
Sbjct  678  SELMYNEYVVYNTAQVKMQFLLKVRFHHK  706



>ref|XP_005809620.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Xiphophorus 
maculatus]
Length=212

 Score =   228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF ++L NR LLWHGSR TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  40   EGEHQRYRPF-EELHNRQLLWHGSRATNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADM  98

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +PVG +LL+EVALG+MHELKKA ++ K PKGKHS KGLG+T P + +
Sbjct  99   VSKSANYCHTSQSDPVGLILLAEVALGNMHELKKASHITKLPKGKHSVKGLGRTAP-DPN  157

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                 + V VP GK V + +  + LLYNEYIVYD+AQ+ L++L+K+RF Y+
Sbjct  158  ASTTLNGVQVPLGKGVNTNIDDTSLLYNEYIVYDVAQINLKYLLKIRFNYQ  208



>gb|ACN58594.1| Poly synthetase 1 [Salmo salar]
Length=189

 Score =   224 bits (571),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  K+ PF+  L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  17   EGEYQKYRPFQD-LPNRQLLWHGSRATNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  75

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P G +LL EVALG+MHELKKA ++ K PKGKHS KGLG+  P  S 
Sbjct  76   VSKSANYCHTSQSDPTGLLLLGEVALGNMHELKKASHITKLPKGKHSVKGLGRNAPDPSA  135

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             V   D V VP GK   + +  + LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  136  TVTL-DGVQVPLGKGTNTNIDDTSLLYNEYIVYDVAQVNLKYLLKIKFNYQ  185



>pdb|2RD6|A Chain A, Parp Complexed With A861695
 pdb|3GJW|A Chain A, Parp Complexed With A968427
 pdb|3GN7|A Chain A, Parp Complexed With A861696
 pdb|3L3M|A Chain A, Parp Complexed With A927929
 pdb|3L3L|A Chain A, Parp Complexed With A906894
Length=350

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  181  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  239

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  240  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  299

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  300  NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  349



>pdb|4L6S|A Chain A, Parp Complexed With Benzo[1,4]oxazin-3-one Inhibitor
 pdb|4L6S|B Chain B, Parp Complexed With Benzo[1,4]oxazin-3-one Inhibitor
Length=353

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  184  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  242

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  243  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  302

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  303  NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  352



>pdb|1UK0|A Chain A, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase With A Novel Inhibitor
 pdb|1UK0|B Chain B, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase With A Novel Inhibitor
 pdb|1UK1|A Chain A, Crystal Structure Of Human Poly(Adp-Ribose) Polymerase 
Complexed With A Potent Inhibitor
 pdb|1UK1|B Chain B, Crystal Structure Of Human Poly(Adp-Ribose) Polymerase 
Complexed With A Potent Inhibitor
 pdb|1WOK|A Chain A, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase Complexed With A Quinoxaline-Type Inhibitor
 pdb|1WOK|B Chain B, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase Complexed With A Quinoxaline-Type Inhibitor
 pdb|1WOK|C Chain C, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase Complexed With A Quinoxaline-Type Inhibitor
 pdb|1WOK|D Chain D, Crystal Structure Of Catalytic Domain Of Human Poly(Adp- 
Ribose) Polymerase Complexed With A Quinoxaline-Type Inhibitor
 pdb|2RCW|A Chain A, Parp Complexed With A620223
Length=350

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  181  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  239

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  240  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  299

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  300  NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  349



>pdb|4GV7|A Chain A, Human Artd1 (parp1) - Catalytic Domain In Complex With 
Inhibitor Me0328
 pdb|4GV7|B Chain B, Human Artd1 (parp1) - Catalytic Domain In Complex With 
Inhibitor Me0328
 pdb|4GV7|C Chain C, Human Artd1 (parp1) - Catalytic Domain In Complex With 
Inhibitor Me0328
 pdb|4GV7|D Chain D, Human Artd1 (parp1) - Catalytic Domain In Complex With 
Inhibitor Me0328
Length=358

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  182  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  240

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  241  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  300

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  301  NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  350



>pdb|4HHY|A Chain A, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHY|B Chain B, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHY|C Chain C, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHY|D Chain D, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHZ|A Chain A, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHZ|B Chain B, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHZ|C Chain C, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
 pdb|4HHZ|D Chain D, Crystal Structure Of Parp Catalytic Domain In Complex 
With Novel Inhibitors
Length=355

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  186  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  244

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  245  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  304

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  305  NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  354



>pdb|4PJT|A Chain A, Structure Of Parp1 Catalytic Domain Bound To Inhibitor 
Bmn 673
 pdb|4PJT|B Chain B, Structure Of Parp1 Catalytic Domain Bound To Inhibitor 
Bmn 673
 pdb|4PJT|C Chain C, Structure Of Parp1 Catalytic Domain Bound To Inhibitor 
Bmn 673
 pdb|4PJT|D Chain D, Structure Of Parp1 Catalytic Domain Bound To Inhibitor 
Bmn 673
Length=370

 Score =   227 bits (578),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  201  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  259

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  260  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  319

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  320  NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  369



>ref|XP_004333519.1| Poly(ADPribose) polymerase catalytic domain containing protein 
[Acanthamoeba castellanii str. Neff]
 gb|ELR11506.1| Poly(ADPribose) polymerase catalytic domain containing protein 
[Acanthamoeba castellanii str. Neff]
Length=774

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE+ ++  +  KL NRMLLWHGSRLTN+ GILSQGLRIAPPEAP+TGYMFGKGVYFADM
Sbjct  605  EGEMARYEKW-AKLHNRMLLWHGSRLTNWAGILSQGLRIAPPEAPSTGYMFGKGVYFADM  663

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             SKSA YCFT+R+N VG M LSEVALGDM++L  ++YMDKPP G HSTKG G+T P  S 
Sbjct  664  ASKSANYCFTSRENNVGIMTLSEVALGDMYQLLHSKYMDKPPAGYHSTKGCGQTEPDPST  723

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             V  ++ V VPCG+P  S    S LLYNEYIVYD+ Q+ +++L+KV+F YK
Sbjct  724  AVLTKEGVKVPCGEPSKSGAVGSSLLYNEYIVYDVGQINIKYLLKVKFSYK  774



>emb|CAA46478.1| Poly(ADP-ribose) polymerase [Rattus norvegicus]
Length=492

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  320  EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  378

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  379  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTAPDPSA  438

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  439  SITL-DGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  488



>gb|KFB53217.1| AGAP003230-PA-like protein [Anopheles sinensis]
Length=361

 Score =   223 bits (567),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 128/171 (75%), Gaps = 1/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFR  L NR LLWHGSRLTNFVGILS GLRIAPPEAP TGYMFGKG+YFADM
Sbjct  191  QGEDKRYEPFRG-LHNRKLLWHGSRLTNFVGILSNGLRIAPPEAPATGYMFGKGIYFADM  249

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YCFTN  +P G MLL EVALGDM E  +A Y++K P G+HS KG+G+T P  + 
Sbjct  250  VSKSANYCFTNPADPKGLMLLCEVALGDMQEYTRANYVEKLPTGRHSVKGIGRTQPDPTA  309

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                 D V +P GK V ++   S LLYNE+IVYD+AQV  Q+L+K++F YK
Sbjct  310  SHTRPDGVEIPLGKGVTNENMDSSLLYNEFIVYDVAQVNCQYLLKMKFLYK  360



>pdb|4DQY|C Chain C, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break
 pdb|4DQY|F Chain F, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break
Length=506

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  326  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  384

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  385  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  444

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  445  NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  494



>pdb|4OPX|C Chain C, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2r)-5-fluoro-2-methyl-2,3-dihydro-1-benzofuran-7- 
Carboxamide
 pdb|4OPX|F Chain F, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2r)-5-fluoro-2-methyl-2,3-dihydro-1-benzofuran-7- 
Carboxamide
 pdb|4OQA|C Chain C, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2z)-2-(2,4-dihydroxybenzylidene)-3-oxo-2,3-dihydro-1- 
Benzofuran-7-carboxamide
 pdb|4OQA|F Chain F, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2z)-2-(2,4-dihydroxybenzylidene)-3-oxo-2,3-dihydro-1- 
Benzofuran-7-carboxamide
 pdb|4OQB|C Chain C, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2z)-2-{4-[2-(morpholin-4-yl)ethoxy]benzylidene}-3-oxo- 
2,3-dihydro-1-benzofuran-7-carboxamide
 pdb|4OQB|F Chain F, Structure Of Human Parp-1 Bound To A Dna Double Strand 
Break In Complex With (2z)-2-{4-[2-(morpholin-4-yl)ethoxy]benzylidene}-3-oxo- 
2,3-dihydro-1-benzofuran-7-carboxamide
Length=505

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  325  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  383

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  384  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  443

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  444  NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  493



>dbj|BAE88881.1| unnamed protein product [Macaca fascicularis]
Length=411

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  239  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  297

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G ++L EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  298  VSKSANYCHTSQGDPIGLIVLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  357

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  358  SISL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  407



>ref|XP_011165140.1| PREDICTED: poly [ADP-ribose] polymerase-like [Solenopsis invicta]
 gb|EFZ14625.1| hypothetical protein SINV_00499 [Solenopsis invicta]
Length=979

 Score =   231 bits (590),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  +F PF KKL NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  809  QGEEQRFKPF-KKLHNRKLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  867

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T+ ++P G ++L EVALG+M+E  ++ Y++K PKGKHST G G+T P   D
Sbjct  868  VSKSANYCCTHSQSPTGLLMLCEVALGNMYERYQSDYIEKLPKGKHSTMGCGQTHPDPQD  927

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              K  D V VP GK VP+K+K S LLYNEYIVYD+AQVK+++L+K+ F+YK
Sbjct  928  VYKTEDGVEVPYGKGVPAKIKNSALLYNEYIVYDVAQVKVRYLIKMNFKYK  978



>gb|AAF61293.1|AF126717_1 msPARP [Mus musculus]
Length=492

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  320  EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  378

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G ++L EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  379  VSKSANYCHTSQGDPIGLIMLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  438

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  439  SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  488



>gb|AAB35557.1| NAD+:protein(ADP-ribosyl)-transferase, ADPRT [mice, Peptide Partial, 
606 aa]
Length=606

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  434  EGESQRYKPFRQ-LHNRFLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  492

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G ++L EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  493  VSKSANYCHTSQGDPIGLIMLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  552

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  553  SITL-EGVEVPLGTGIPSGVNDTALLYNEYIVYDIAQVNLKYLLKLKFNFK  602



>gb|AAA51599.1| poly(ADP-ribose) polymerase, partial [Homo sapiens]
Length=574

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  402  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  460

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  461  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  520

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  521  NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  570



>ref|XP_003971725.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Takifugu rubripes]
Length=1013

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF ++L NR LLWHGSR TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  841   EGEHQRYRPF-EELHNRQLLWHGSRATNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++  PVGF+LL+EVALG+MHELKKA ++ K PKGKHS KGLG+T P  S 
Sbjct  900   VSKSANYCHTSQSEPVGFLLLAEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   D V VP G  V + +  + LLYNEYIVYD+AQ+ L++L+KVRF Y+
Sbjct  960   TVTL-DGVQVPLGNGVNTNIDDTSLLYNEYIVYDVAQINLKYLLKVRFNYQ  1009



>ref|XP_004083528.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Oryzias latipes]
Length=1015

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  +F PF ++L NR LLWHGSR TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  843   EGERQRFRPF-EELHNRQLLWHGSRATNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADM  901

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL+EVALG+MHELKKA ++ K PKGKHS KGLG+T P  S 
Sbjct  902   VSKSANYCHTSQSDPVGLILLAEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPSA  961

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   D V VP GK V + +  + LLYNEYIVYD+AQ+ L++L+K++F Y+
Sbjct  962   TVTL-DGVQVPLGKGVQTNIDDTSLLYNEYIVYDVAQINLKYLLKIKFNYQ  1011



>ref|XP_008311174.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Cynoglossus 
semilaevis]
Length=1021

 Score =   230 bits (586),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  +F PF ++L NR LLWHGSR TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  849   EGEHQRFRPF-EELHNRQLLWHGSRTTNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADM  907

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL+EVALG+MHELKKA ++ K PKGKHS KGLG+T P   D
Sbjct  908   VSKSANYCHTSQSDPVGLLLLAEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPRD  967

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                  D V VP GK V + +  + LLYNEYIVYD+AQ+ +++L+K RF Y+
Sbjct  968   SFNM-DGVQVPLGKGVSTNIDDTSLLYNEYIVYDVAQINMKYLLKTRFNYQ  1017



>ref|XP_008311175.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Cynoglossus 
semilaevis]
Length=1015

 Score =   229 bits (585),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  +F PF ++L NR LLWHGSR TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  843   EGEHQRFRPF-EELHNRQLLWHGSRTTNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADM  901

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL+EVALG+MHELKKA ++ K PKGKHS KGLG+T P   D
Sbjct  902   VSKSANYCHTSQSDPVGLLLLAEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPRD  961

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                  D V VP GK V + +  + LLYNEYIVYD+AQ+ +++L+K RF Y+
Sbjct  962   SFNM-DGVQVPLGKGVSTNIDDTSLLYNEYIVYDVAQINMKYLLKTRFNYQ  1011



>ref|XP_007253978.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Astyanax mexicanus]
Length=1024

 Score =   229 bits (585),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  852   EGEYQRYRPF-KELPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  910

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+MHELKKA ++ K PKGKHS KGLG+T P +  
Sbjct  911   VSKSANYCHTSQADPVGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDQGA  970

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V  +  V +P GK V + +  + LLYNEYIVYD+AQV L++L+K+RF Y+
Sbjct  971   TVSLKG-VDIPLGKGVNTNIDDTSLLYNEYIVYDVAQVNLKYLLKIRFNYQ  1020



>ref|XP_009025261.1| hypothetical protein HELRODRAFT_95414 [Helobdella robusta]
 gb|ESN96355.1| hypothetical protein HELRODRAFT_95414 [Helobdella robusta]
Length=1045

 Score =   229 bits (585),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = -1

Query  649   GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
             GE   +  F K L NRMLLWHGSRLTN+ GILS+GLRIAP EAP+TGYMFGKG+YFADM 
Sbjct  873   GESKVYESF-KSLHNRMLLWHGSRLTNYAGILSKGLRIAPKEAPSTGYMFGKGIYFADMA  931

Query  469   SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
             SKSA YCFT+RK+P G MLLSEVALG+MHEL +A ++ + P+GKHS KGLG T P     
Sbjct  932   SKSANYCFTSRKDPTGLMLLSEVALGNMHELTQANFITELPRGKHSVKGLGTTAPDPKQN  991

Query  289   VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                 D VV+P GK V +KVK + LLYNEYIVYD+AQV +++L+K+ F+YK
Sbjct  992   YVCEDGVVIPMGKGVKTKVKLTSLLYNEYIVYDVAQVNMKYLLKLNFKYK  1041



>ref|XP_001638875.1| predicted protein [Nematostella vectensis]
 gb|EDO46812.1| predicted protein, partial [Nematostella vectensis]
Length=968

 Score =   229 bits (584),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 130/171 (76%), Gaps = 1/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE   F PF K+L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  796  EGEEALFKPF-KQLHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  854

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T+  N +G +LL EVALG+MHELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  855  VSKSANYCCTSPSNNIGLLLLCEVALGNMHELKHASFIKKVPKGKHSVKGLGKTAPDPSA  914

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
               + D  +VP GK  P+ VK S LLYNEYIVYD AQ+ +++L+K +F+YK
Sbjct  915  THTFEDGTIVPKGKGCPAPVKDSSLLYNEYIVYDTAQINMKYLLKTKFKYK  965



>ref|XP_003396806.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase-like 
[Bombus terrestris]
Length=990

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE ++F PF KKL NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  819  QGEDNRFKPF-KKLHNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  877

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T+  NP G +LL EVALG+MHE  +A Y++K P GKHST G G+T P    
Sbjct  878  VSKSANYCCTHSGNPTGLLLLCEVALGNMHERYRADYIEKLPSGKHSTWGRGRTQPDPET  937

Query  292  YVKWRDEVVVPCGKPVPSKV-KASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              K +D V VP G PV +K+ K S+LLYNEYIVYD+AQVK Q+L+K+ F+YK
Sbjct  938  VYKMKDGVEVPYGVPVSAKLPKKSDLLYNEYIVYDVAQVKAQYLLKMNFKYK  989



>ref|XP_002163577.2| PREDICTED: poly [ADP-ribose] polymerase 1-like [Hydra vulgaris]
Length=398

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 128/169 (76%), Gaps = 1/169 (1%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE  ++ PF K L N+ LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADM 
Sbjct  229  GEKQRYRPF-KDLFNKKLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADMA  287

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSA YC T R N  G MLL EVALG+M+ELK+++++ K P GKHS KGLG T P  S  
Sbjct  288  SKSANYCCTTRSNNTGLMLLCEVALGNMYELKQSEHISKLPPGKHSCKGLGSTSPDPSMD  347

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQY  143
                 EV+VP GKP+ + +K S LLYNEYIVYD+AQV +++LV+++F Y
Sbjct  348  KVIDGEVLVPLGKPISTNIKDSTLLYNEYIVYDVAQVNIKYLVQLKFNY  396



>ref|XP_007071821.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Chelonia mydas]
Length=992

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFR+ L NR LLWHGSR TNF GI SQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  820  EGENQRYKPFRQ-LHNRQLLWHGSRATNFAGIFSQGLRIAPPEAPVTGYMFGKGIYFADM  878

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+MHELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  879  VSKSANYCHTSQTDPIGLILLGEVALGNMHELKNASHITKLPKGKHSVKGLGKTAPDPSA  938

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V +P G  +PS +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  939  TITL-DGVDIPLGNGIPSGISDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  988



>ref|XP_001177436.2| PREDICTED: poly [ADP-ribose] polymerase 1-like [Strongylocentrotus 
purpuratus]
Length=988

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 130/169 (77%), Gaps = 1/169 (1%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE  +F PF KKL NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMV
Sbjct  819  GEGTRFKPF-KKLHNRQLLWHGSRKTNFGGILSQGLRIAPPEAPATGYMFGKGLYFADMV  877

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            +KSA YC+ N  + +G M+LS+VALGDM+EL  A+ M KPP GKHSTKGLG+T P  S  
Sbjct  878  TKSANYCYANASSNIGLMILSDVALGDMYELYGAKGMSKPPAGKHSTKGLGRTCPDPSGL  937

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQY  143
            V   D + VP GK   S +  + LLYNEYIVYD+AQV++++L+K++F Y
Sbjct  938  VTIEDNLQVPMGKGCDSNINNTSLLYNEYIVYDVAQVQMRYLIKMKFNY  986



>ref|XP_005289622.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Chrysemys 
picta bellii]
Length=1011

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GI SQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  839   EGENQRYKPFRQ-LHNRQLLWHGSRATNFAGIFSQGLRIAPPEAPVTGYMFGKGIYFADM  897

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+MHELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  898   VSKSANYCHTSQTDPIGLILLGEVALGNMHELKNASHITKLPKGKHSVKGLGKTAPDPTA  957

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V +P G  +PS V  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  958   TITL-DGVDIPLGNGIPSGVSDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  1007



>ref|XP_005289623.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Chrysemys 
picta bellii]
Length=969

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFR+ L NR LLWHGSR TNF GI SQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  797  EGENQRYKPFRQ-LHNRQLLWHGSRATNFAGIFSQGLRIAPPEAPVTGYMFGKGIYFADM  855

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+MHELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  856  VSKSANYCHTSQTDPIGLILLGEVALGNMHELKNASHITKLPKGKHSVKGLGKTAPDPTA  915

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V +P G  +PS V  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  916  TITL-DGVDIPLGNGIPSGVSDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  965



>ref|XP_004605484.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Sorex araneus]
Length=1015

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  843   EGENQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  901

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+MHELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  902   VSKSANYCHTSQGDPIGLILLGEVALGNMHELKHASHISKLPKGKHSVKGLGKTTPDPSA  961

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  +PS V  + LLYNEYI+YDIAQV L++L+K++F +K
Sbjct  962   SITM-DGVEVPLGTGIPSGVNDTCLLYNEYIIYDIAQVNLKYLLKLKFNFK  1011



>ref|XP_007552911.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Poecilia formosa]
Length=1015

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 136/171 (80%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  +++PF ++L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  843   EGEHQRYSPF-EELHNRQLLWHGSRATNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  901

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL+EVALG+MHELKKA ++ K PKGKHS KGLG+T P + +
Sbjct  902   VSKSANYCHTSQSDPVGLILLAEVALGNMHELKKASHITKLPKGKHSVKGLGRTAP-DPN  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                  + V VP GK V + +  + LLYNEYIVYD+AQ+ L++L+K+RF Y+
Sbjct  961   ASATLNGVQVPLGKGVNTNIDDTSLLYNEYIVYDVAQINLKYLLKIRFNYQ  1011



>gb|AAB35560.1| NAD+:protein(ADP-ribosyl)-transferase, ADPRT [Xenopus, Peptide 
Partial, 607 aa]
Length=607

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 129/171 (75%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  434  EGEYQRYKPF-KQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  492

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC     +P+G +LL EVALG+MHELK A  + K PKGKHS KGLG+T P  S 
Sbjct  493  VSKSANYCHAMPGSPIGLILLGEVALGNMHELKAASQITKLPKGKHSVKGLGRTAPDPSA  552

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             V+  D V VP GK   + +  + LLYNEYIVYDIAQV L++L+K++F YK
Sbjct  553  TVQL-DGVDVPLGKGTSANISDTSLLYNEYIVYDIAQVNLKYLLKLKFNYK  602



>ref|XP_006118141.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Pelodiscus sinensis]
Length=1173

 Score =   229 bits (583),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GI SQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  1001  EGESQRYKPF-KQLHNRQLLWHGSRTTNFAGIFSQGLRIAPPEAPVTGYMFGKGVYFADM  1059

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+MHELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  1060  VSKSANYCHTSQTDPIGLILLGEVALGNMHELKNASHISKLPKGKHSVKGLGKTAPDPSA  1119

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V +P G  +PS +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  1120  TITL-DGVDIPLGNGIPSGISDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  1169



>gb|KFD59055.1| hypothetical protein M513_00218 [Trichuris suis]
 gb|KFD73096.1| hypothetical protein M514_00218 [Trichuris suis]
Length=892

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 134/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
             E  ++ PF KKL+NRMLLWHGSR +N+ GIL QGLRIAPPEAP TGYMFGKG+YFADMV
Sbjct  724  NEQKRYRPF-KKLQNRMLLWHGSRNSNYAGILCQGLRIAPPEAPVTGYMFGKGIYFADMV  782

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            +KSA YC+  +  P G++LL EVALG++ ELK A+Y++K P GKHS KG+G+T+P  ++ 
Sbjct  783  TKSANYCYATKDEPYGYLLLCEVALGNVLELKNAKYLEKLPTGKHSVKGIGETMPDPAEQ  842

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                D VV+P GKPV S VK + LLYNEYIVYDI+Q+ ++FLVK++F +K
Sbjct  843  ETTDDGVVIPLGKPVASNVKKTSLLYNEYIVYDISQLHIKFLVKLKFNFK  892



>ref|XP_006625727.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Lepisosteus oculatus]
Length=1007

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  835   EGEYQRYKPF-KDLPNRQLLWHGSRATNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  893

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T+  +PVG +LL+EVALG+MHELK+A ++ K PKGKHS KG+GKT P  S 
Sbjct  894   VSKSANYCHTSTTDPVGLILLAEVALGNMHELKRASHITKLPKGKHSVKGVGKTAPDPSS  953

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   D + VP GK + + ++ + LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  954   TVTL-DGMQVPLGKGINTNIQDTSLLYNEYIVYDVAQVNLKYLLKIKFNYQ  1003



>ref|NP_037195.1| poly [ADP-ribose] polymerase 1 [Rattus norvegicus]
 sp|P27008.4|PARP1_RAT RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Rattus 
norvegicus]
 gb|AAC53544.1| poly(ADP-ribose) polymerase [Rattus norvegicus]
 gb|AAH85765.1| Poly (ADP-ribose) polymerase 1 [Rattus norvegicus]
 gb|EDL94827.1| poly (ADP-ribose) polymerase family, member 1 [Rattus norvegicus]
Length=1014

 Score =   228 bits (580),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTAPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SITL-DGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_010732988.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Larimichthys crocea]
Length=1014

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF ++L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  842   EGERQRYRPF-EELHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL+EVALG+MHELKKA ++ K PKGKHS KG+G+T P  S 
Sbjct  901   VSKSANYCHTSQSDPVGLLLLAEVALGNMHELKKASHITKLPKGKHSVKGVGRTAPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   D V VP GK   + +  + LLYNEYIVYD+AQV +++L+K++F Y+
Sbjct  961   AVTL-DGVQVPLGKGAHTNIDDTSLLYNEYIVYDVAQVNMKYLLKIKFNYQ  1010



>gb|KHJ46115.1| Poly(ADP-ribose) polymerase catalytic domain protein [Trichuris 
suis]
Length=959

 Score =   227 bits (578),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 134/170 (79%), Gaps = 1/170 (1%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
             E  ++ PF KKL+NRMLLWHGSR +N+ GIL QGLRIAPPEAP TGYMFGKG+YFADMV
Sbjct  791  NEQKRYRPF-KKLQNRMLLWHGSRNSNYAGILCQGLRIAPPEAPVTGYMFGKGIYFADMV  849

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            +KSA YC+  +  P G++LL EVALG++ ELK A+Y++K P GKHS KG+G+T+P  ++ 
Sbjct  850  TKSANYCYATKDEPYGYLLLCEVALGNVLELKNAKYLEKLPTGKHSVKGIGETMPDPAEQ  909

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                D VV+P GKPV S VK + LLYNEYIVYDI+Q+ ++FLVK++F +K
Sbjct  910  ETTDDGVVIPLGKPVASNVKKTSLLYNEYIVYDISQLHIKFLVKLKFNFK  959



>gb|AAB35558.1| NAD+:protein(ADP-ribosyl)-transferase, ADPRT [cattle, Peptide 
Partial, 607 aa]
Length=607

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  435  EGESQRYKPF-KQLHNRFLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  493

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL E ALG+M+ELK A+++ K PKGKHS KGLGKT P  S 
Sbjct  494  VSKSANYCHTSQGDPIGLILLGEAALGNMYELKHARHISKLPKGKHSVKGLGKTTPDPSA  553

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  554  SITV-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  603



>pdb|1EFY|A Chain A, Crystal Structure Of The Catalytic Fragment Of Poly 
(Adp- Ribose) Polymerase Complexed With A Benzimidazole Inhibitor
Length=350

 Score =   216 bits (551),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  181  EGESQRYKPF-KQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  239

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  240  VSKSANYCHTSQADPIGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTA  299

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                 D V VP G  + + +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  300  TTTL-DGVEVPLGNGISTGINDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  349



>ref|XP_010972367.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelus bactrianus]
Length=1016

 Score =   227 bits (578),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  844   EGETQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  902

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  903   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  962

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  963   SITM-DGVDVPLGTGIPSGVSDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1012



>pdb|1A26|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase 
Complexed With Carba-Nad
 pdb|1PAX|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase 
Complexed With 3,4-Dihydro-5-Methyl-Isoquinolinone
 pdb|2PAW|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase
 pdb|2PAX|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase 
Complexed With 4-Amino-1,8-Naphthalimide
 pdb|3PAX|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase 
Complexed With 3-Methoxybenzamide
 pdb|4PAX|A Chain A, The Catalytic Fragment Of Poly(Adp-Ribose) Polymerase 
Complexed With 8-Hydroxy-2-Methyl-3-Hydro-Quinazolin-4-One
Length=361

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  189  EGESQRYKPF-KQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  247

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  248  VSKSANYCHTSQADPIGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTA  307

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                 D V VP G  + + +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  308  TTTL-DGVEVPLGNGISTGINDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  357



>ref|XP_006744107.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Leptonychotes weddellii]
Length=686

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  514  EGESRRYEPFRQ-LHNRRLLWHGSRATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  572

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +PVG +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  573  VSKSANYCRTSQADPVGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPAA  632

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  633  SITM-DGVEVPLGTGISSGVSDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  682



>ref|XP_004690817.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Condylura cristata]
Length=1033

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  861   EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  919

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  920   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  979

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   D V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  980   SVTM-DGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1029



>ref|XP_005454773.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X2 [Oreochromis 
niloticus]
Length=1012

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF ++L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  840   EGEHQRYRPF-EELHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  898

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+MHELKKA ++ K PKGKHS KGLG+T P  + 
Sbjct  899   VSKSANYCHTSQSDPVGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPNA  958

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   + V VP GK V + +  + LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  959   TVTL-NGVQVPLGKGVHTNIDDTSLLYNEYIVYDVAQVNLKYLLKIKFNYQ  1008



>ref|XP_010158766.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Eurypyga 
helias]
Length=255

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  83   EGESQRYKPF-KQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  141

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  142  VSKSANYCHTSQADPIGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTA  201

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                   V VP G  + + +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  202  TTTLGG-VEVPLGNGISTGINDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  251



>ref|XP_003449904.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Oreochromis 
niloticus]
Length=1014

 Score =   226 bits (577),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF ++L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  842   EGEHQRYRPF-EELHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+MHELKKA ++ K PKGKHS KGLG+T P  + 
Sbjct  901   VSKSANYCHTSQSDPVGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPNA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   + V VP GK V + +  + LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  961   TVTL-NGVQVPLGKGVHTNIDDTSLLYNEYIVYDVAQVNLKYLLKIKFNYQ  1010



>ref|XP_003999138.2| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Felis catus]
Length=1013

 Score =   226 bits (577),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L+NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPF-KQLRNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHAAHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  +PS V  + LLYNEYIVYD+AQV L++L+K++F +K
Sbjct  960   SITM-DGVEVPLGTGIPSGVNDTCLLYNEYIVYDVAQVNLKYLLKLKFNFK  1009



>ref|XP_010780561.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Notothenia coriiceps]
Length=802

 Score =   225 bits (574),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF ++L NR LLWHGSR TN+ GI+SQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  630  EGERQRYRPF-EELNNRQLLWHGSRKTNYAGIMSQGLRIAPPEAPVTGYMFGKGVYFADM  688

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +PVG +LL+EVALG+MHELKKA ++ K PKGKHS KG+G+T P  S 
Sbjct  689  VSKSANYCHTSQSDPVGLLLLAEVALGNMHELKKASHITKVPKGKHSVKGVGRTAPDPSA  748

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             V   D V VP GK   + +  + LLYNEYIVYD++QV +++L+K++F Y+
Sbjct  749  SVTL-DGVQVPLGKGSNTNIDDTSLLYNEYIVYDVSQVNMKYLLKIKFNYQ  798



>ref|XP_011289117.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Felis catus]
Length=985

 Score =   226 bits (577),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L+NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  813  EGESQRYKPF-KQLRNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  871

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  872  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHAAHISKLPKGKHSVKGLGKTTPDPSA  931

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  +PS V  + LLYNEYIVYD+AQV L++L+K++F +K
Sbjct  932  SITM-DGVEVPLGTGIPSGVNDTCLLYNEYIVYDVAQVNLKYLLKLKFNFK  981



>ref|XP_005734478.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X2 [Pundamilia 
nyererei]
Length=1012

 Score =   226 bits (577),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF ++L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  840   EGEHQRYRPF-EELHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  898

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+MHELKKA ++ K PKGKHS KGLG+T P  + 
Sbjct  899   VSKSANYCHTSQSDPVGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPNA  958

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   + V VP GK V + +  + LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  959   TVTL-NGVQVPLGKGVHTNIDDTSLLYNEYIVYDVAQVNLKYLLKIKFNYQ  1008



>ref|XP_005914567.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Haplochromis 
burtoni]
Length=1014

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF ++L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  842   EGEHQRYRPF-EELHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+MHELKKA ++ K PKGKHS KGLG+T P  + 
Sbjct  901   VSKSANYCHTSQSDPVGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPNA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   + V VP GK V + +  + LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  961   TVTL-NGVQVPLGKGVHTNIDDTSLLYNEYIVYDVAQVNLKYLLKIKFNYQ  1010



>ref|XP_004541848.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Maylandia zebra]
 ref|XP_005734477.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X1 [Pundamilia 
nyererei]
Length=1014

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF ++L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  842   EGEHQRYRPF-EELHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+MHELKKA ++ K PKGKHS KGLG+T P  + 
Sbjct  901   VSKSANYCHTSQSDPVGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPNA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   + V VP GK V + +  + LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  961   TVTL-NGVQVPLGKGVHTNIDDTSLLYNEYIVYDVAQVNLKYLLKIKFNYQ  1010



>ref|XP_005914568.1| PREDICTED: poly [ADP-ribose] polymerase 1-like isoform X2 [Haplochromis 
burtoni]
Length=1012

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF ++L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  840   EGEHQRYRPF-EELHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  898

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+MHELKKA ++ K PKGKHS KGLG+T P  + 
Sbjct  899   VSKSANYCHTSQSDPVGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPNA  958

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   + V VP GK V + +  + LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  959   TVTL-NGVQVPLGKGVHTNIDDTSLLYNEYIVYDVAQVNLKYLLKIKFNYQ  1008



>ref|XP_006797147.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Neolamprologus 
brichardi]
Length=1014

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF ++L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  842   EGEHQRYRPF-EELHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+MHELKKA ++ K PKGKHS KGLG+T P  + 
Sbjct  901   VSKSANYCHTSQSDPVGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRTAPDPNA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   + V VP GK V + +  + LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  961   TVTL-NGVQVPLGKGVHTNIDDTSLLYNEYIVYDVAQVNLKYLLKIKFNYQ  1010



>ref|XP_010990763.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelus dromedarius]
Length=1013

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGETQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITM-DGVDVPLGTGIPSGVSDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_006188179.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Camelus ferus]
Length=1013

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGETQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITM-DGVDVPLGTGIPSGVSDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_005906361.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Bos 
mutus]
 gb|ELR48662.1| Poly [ADP-ribose] polymerase 1, partial [Bos mutus]
Length=676

 Score =   223 bits (569),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  504  EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  562

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  563  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  622

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  623  SITV-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  672



>ref|XP_011232467.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ailuropoda melanoleuca]
Length=975

 Score =   226 bits (576),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  803  EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  861

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  862  VSKSANYCHTSQADPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  921

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K+RF +K
Sbjct  922  SITM-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLRYLLKLRFNFK  971



>gb|EFB29647.1| hypothetical protein PANDA_016433 [Ailuropoda melanoleuca]
Length=981

 Score =   226 bits (576),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  809  EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  867

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  868  VSKSANYCHTSQADPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  927

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K+RF +K
Sbjct  928  SITM-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLRYLLKLRFNFK  977



>ref|XP_006198888.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Vicugna pacos]
Length=1018

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  846   EGETQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  904

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  905   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  964

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  965   SITM-DGVDVPLGTGIPSGVSDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1014



>ref|XP_011063716.1| PREDICTED: poly [ADP-ribose] polymerase isoform X1 [Acromyrmex 
echinatior]
 gb|EGI59706.1| Poly [ADP-ribose] polymerase [Acromyrmex echinatior]
Length=981

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 134/172 (78%), Gaps = 2/172 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  +F PF KKL NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  810  QGEEQRFKPF-KKLPNRKLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  868

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T+ +NP G +LL EVALG+M+E  +A Y++K PKGKHST G G+T P    
Sbjct  869  VSKSANYCCTHSQNPTGLLLLCEVALGNMYEKYQADYIEKLPKGKHSTLGRGQTQPDPQT  928

Query  292  YVKWRDEVVVPCGKPVPSKV-KASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              K +D + VP GK VP+K+   S LLYNEYIVYDIAQVK+++LVK+ F+YK
Sbjct  929  VYKTKDGIEVPYGKGVPAKLNNTSALLYNEYIVYDIAQVKVRYLVKMNFKYK  980



>ref|XP_011254366.1| PREDICTED: poly [ADP-ribose] polymerase [Camponotus floridanus]
 gb|EFN69632.1| Poly [ADP-ribose] polymerase [Camponotus floridanus]
Length=983

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  +F PF KKL NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  812  QGEEQRFKPF-KKLPNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  870

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T+ ++P G +LL EVALG+MHE  KA Y++K PKGKHST G G+T P   D
Sbjct  871  VSKSANYCCTHSQSPTGLLLLCEVALGNMHERYKADYIEKLPKGKHSTLGRGQTEPDPKD  930

Query  292  YVKWRDEVVVPCGKPVP-SKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              K  D V VP G  VP +  K S+LLYNEYIVYD+AQVK+++L+++ F+YK
Sbjct  931  VHKLDDGVEVPYGMGVPATHNKKSDLLYNEYIVYDVAQVKVRYLIRMNFKYK  982



>ref|XP_008396025.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Poecilia reticulata]
Length=1015

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 135/171 (79%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF ++L N+ LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  843   EGEQQRYRPF-EELHNQQLLWHGSRATNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  901

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL+EVALG+MHELKKA ++ K PKGKHS KGLG+T P + +
Sbjct  902   VSKSANYCHTSQSDPVGLILLAEVALGNMHELKKASHISKLPKGKHSVKGLGRTAP-DPN  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                  + V VP GK V + +  + LLYNEYIVYD+AQ+ L++L+K+RF Y+
Sbjct  961   ASATLNGVQVPLGKGVNTNIDDTSLLYNEYIVYDVAQINLKYLLKIRFNYQ  1011



>ref|XP_005349022.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Microtus ochrogaster]
Length=1013

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLLLLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  VPS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITL-EGVEVPLGTGVPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>gb|AAH37545.1| Poly (ADP-ribose) polymerase 1 [Homo sapiens]
 gb|ABM85752.1| poly (ADP-ribose) polymerase family, member 1 [synthetic construct]
Length=1014

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>gb|AAA60137.1| poly(ADP-ribose) polymerase [Homo sapiens]
Length=1014

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|NP_001609.2| poly [ADP-ribose] polymerase 1 [Homo sapiens]
 sp|P09874.4|PARP1_HUMAN RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Homo 
sapiens]
 gb|AAM75364.1|AF524947_1 ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase) [Homo 
sapiens]
 gb|AAA51663.1| NAD+ ADP-ribosyltransferase [Homo sapiens]
 gb|EAW69783.1| poly (ADP-ribose) polymerase family, member 1, isoform CRA_a 
[Homo sapiens]
 gb|EAW69784.1| poly (ADP-ribose) polymerase family, member 1, isoform CRA_a 
[Homo sapiens]
Length=1014

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>dbj|BAG35260.1| unnamed protein product [Homo sapiens]
Length=1014

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>gb|AAB59447.1| poly(ADP-ribose) synthetase [Homo sapiens]
Length=1014

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>dbj|BAE39743.1| unnamed protein product [Mus musculus]
Length=1014

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>gb|ABM82562.1| poly (ADP-ribose) polymerase family, member 1 [synthetic construct]
Length=1014

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_004653313.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Jaculus jaculus]
Length=1014

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 134/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK+A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKQASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>dbj|BAE41080.1| unnamed protein product [Mus musculus]
Length=1014

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>dbj|BAG10250.1| poly [ADP-ribose] polymerase-1 [synthetic construct]
Length=1014

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>sp|P11103.3|PARP1_MOUSE RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1; Short=msPARP 
[Mus musculus]
 emb|CAA32421.1| unnamed protein product [Mus musculus]
Length=1013

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G ++L EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLIMLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITL-EGVEVPLGTGIPSGVNDTALLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>dbj|BAE35080.1| unnamed protein product [Mus musculus]
Length=1014

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_006897812.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Elephantulus edwardii]
Length=1014

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF++ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGETQRYKPFQQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  901   VSKSANYCHTSQGDPVGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPAA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  VPS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   TINL-DGVEVPLGTGVPSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  1010



>dbj|BAE27352.1| unnamed protein product [Mus musculus]
Length=1014

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>dbj|BAG64403.1| unnamed protein product [Homo sapiens]
Length=993

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  821  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  879

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  880  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  939

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  940  NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  989



>ref|XP_010863533.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Esox lucius]
Length=1011

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF+  L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  839   EGEYQRYRPFQD-LPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  897

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P G +LL EVALG+MHELKKA ++ K PKGKHS KGLG+  P  S 
Sbjct  898   VSKSANYCHTSQSDPTGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRNAPDPSA  957

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   D V VP GK + + +  + LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  958   TVTL-DGVQVPLGKGINTNIDDTSLLYNEYIVYDVAQVNLKYLLKIKFNYQ  1007



>ref|XP_003357689.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Sus scrofa]
Length=1018

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  846   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  904

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  905   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPAA  964

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  965   SITM-DGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1014



>ref|NP_031441.2| poly [ADP-ribose] polymerase 1 [Mus musculus]
 gb|AAH12041.1| Poly (ADP-ribose) polymerase family, member 1 [Mus musculus]
 dbj|BAC27173.1| unnamed protein product [Mus musculus]
 dbj|BAC40500.1| unnamed protein product [Mus musculus]
 gb|EDL13152.1| poly (ADP-ribose) polymerase family, member 1 [Mus musculus]
Length=1014

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>gb|ERE73581.1| poly [ADP-ribose] polymerase 1 [Cricetulus griseus]
Length=920

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  748  EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  806

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  807  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  866

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  867  SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  916



>ref|XP_003487068.1| PREDICTED: poly [ADP-ribose] polymerase-like [Bombus impatiens]
Length=990

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE +++ PF KKL NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  819  QGEDNRYKPF-KKLHNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  877

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T+  +P G +LL EVALG+MHE  +A Y++K P GKHST G G+T P    
Sbjct  878  VSKSANYCCTHSGSPTGLLLLCEVALGNMHERYRADYIEKLPSGKHSTWGRGRTQPDPET  937

Query  292  YVKWRDEVVVPCGKPVPSKV-KASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              K +D V VP G PV +K+ K S+LLYNEYIVYD+AQVK Q+L+K+ F+YK
Sbjct  938  VYKMKDGVEVPYGVPVSAKLPKKSDLLYNEYIVYDVAQVKAQYLLKMNFKYK  989



>ref|XP_003275213.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nomascus leucogenys]
Length=955

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  783  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  841

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  842  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  901

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  902  SISL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  951



>emb|CDQ76498.1| unnamed protein product [Oncorhynchus mykiss]
Length=1013

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  K+ PF+  L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  841   EGEYQKYRPFQD-LPNRQLLWHGSRATNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P G +LL EVALG+MHELKKA ++ K PKGKHS KGLG+  P  S 
Sbjct  900   VSKSANYCHTSQSDPTGLLLLGEVALGNMHELKKASHITKLPKGKHSVKGLGRNAPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   D V VP GK   + +  + LLYNEYIVYD+AQV L++L+K++F Y+
Sbjct  960   TVTL-DGVQVPLGKGTNTNIDDTSLLYNEYIVYDVAQVNLKYLLKIKFNYQ  1009



>ref|XP_008559441.1| PREDICTED: poly [ADP-ribose] polymerase-like [Microplitis demolitor]
Length=985

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 132/172 (77%), Gaps = 2/172 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            KGE  ++ PF  KL N+ LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  814  KGEDKRYKPF-AKLPNKKLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  872

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC TN +NP G +LL EVALG+M+E  KA Y++K PKGKHST G G+T P  + 
Sbjct  873  VSKSANYCCTNSQNPTGLLLLCEVALGNMYERLKADYIEKLPKGKHSTFGKGQTGPDPNQ  932

Query  292  YVKWRDEVVVPCGKPVPSKV-KASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +K  D V VPCG PV  KV   + LLYNEYIVYD+AQVK ++LV++ F+YK
Sbjct  933  ALKTPDGVEVPCGPPVDQKVPSTASLLYNEYIVYDVAQVKARYLVRMNFKYK  984



>ref|XP_009960357.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Leptosomus 
discolor]
 ref|XP_010127952.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Chlamydotis 
macqueenii]
Length=296

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  124  EGESQRYKPF-KQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  182

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  183  VSKSANYCHTSQADPIGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTA  242

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                   V VP G  + + +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  243  TTTLGG-VEVPLGNGISTGINDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  292



>gb|EGW11182.1| Poly [ADP-ribose] polymerase 1 [Cricetulus griseus]
Length=971

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  799  EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  857

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  858  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  917

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  918  SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  967



>ref|XP_007534861.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Erinaceus europaeus]
Length=937

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  765  EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  823

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  824  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  883

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             V   + + VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  884  SVTM-EGIEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  933



>ref|XP_010589425.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Loxodonta africana]
Length=1000

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  828  EGENQRYKPFRQ-LHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  886

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  887  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  946

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  947  SITL-DGVEVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  996



>ref|XP_004065376.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Gorilla gorilla gorilla]
Length=1021

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  849   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  907

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  908   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  967

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  968   NISL-DGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  1017



>ref|XP_005078195.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Mesocricetus auratus]
Length=1013

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_004375937.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Trichechus 
manatus latirostris]
 ref|XP_004375938.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 2 [Trichechus 
manatus latirostris]
Length=1013

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGETQRYKPFRQ-LHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|NP_001233650.1| poly [ADP-ribose] polymerase 1 [Cricetulus griseus]
 sp|Q9R152.3|PARP1_CRIGR RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1 [Cricetulus 
griseus]
 gb|AAD45817.1|AF168781_1 poly ADP-ribose polymerase [Cricetulus griseus]
Length=1013

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_008579018.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Galeopterus 
variegatus]
Length=975

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  803  EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  861

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  862  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  921

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  922  SITL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  971



>ref|XP_002941174.2| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Xenopus 
(Silurana) tropicalis]
Length=1013

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  838   EGEYQRYKPF-KQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  896

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC     NP+G +LL EVALG+MHEL+ A ++ K PKGKHS KGLG+T P  S 
Sbjct  897   VSKSANYCNAMPGNPIGLILLGEVALGNMHELRAASHITKLPKGKHSVKGLGRTAPDPSA  956

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              VK  D V VP GK   + +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  957   TVKL-DGVDVPLGKGSATNITDASLLYNEYIVYDVAQVNLKYLLKLKFNYK  1006



>ref|XP_003216114.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Anolis carolinensis]
Length=1006

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  834   EGEYQRYKPFRE-LHNRQLLWHGSRATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  892

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ + VG +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  893   VSKSANYCHTSQTDSVGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPSA  952

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K+ F+YK
Sbjct  953   TVSL-NGVDVPLGSGIPSGVSNTCLLYNEYIVYDIAQVNLKYLLKLDFKYK  1002



>ref|XP_008058853.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Tarsius syrichta]
Length=919

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  747  EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  805

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  806  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  865

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             V   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  866  SVTL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  915



>ref|XP_002809428.2| PREDICTED: poly [ADP-ribose] polymerase 1 [Pongo abelii]
Length=972

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  800  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  858

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  859  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  918

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  919  SISL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  968



>ref|XP_006157311.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Tupaia chinensis]
Length=1014

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SITL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_009976244.1| PREDICTED: poly [ADP-ribose] polymerase 1, partial [Tauraco erythrolophus]
Length=324

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  152  EGESQRYKPF-KQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  210

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  211  VSKSANYCHTSQADPIGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTA  270

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                   V VP G  + + +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  271  TTTLGG-VEVPLGNGISTGINDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  320



>ref|XP_002760624.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Callithrix jacchus]
Length=1013

 Score =   224 bits (571),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_008820594.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Nannospalax galili]
Length=1013

 Score =   224 bits (571),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_008266574.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Oryctolagus cuniculus]
Length=1013

 Score =   224 bits (571),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 132/170 (78%), Gaps = 2/170 (1%)
 Frame = -1

Query  649   GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
             GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMV
Sbjct  842   GESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMV  900

Query  469   SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
             SKSA YC T++ +P+G +LL EVALG+M+ELK+A ++ K PKGKHS KGLGKT P  S  
Sbjct  901   SKSANYCHTSQGDPIGLILLGEVALGNMYELKQASHISKLPKGKHSVKGLGKTTPDPSAS  960

Query  289   VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   ITL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_003791037.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Otolemur garnettii]
Length=1014

 Score =   224 bits (571),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SVTL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_004761981.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X5 [Mustela 
putorius furo]
 ref|XP_004805440.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Mustela 
putorius furo]
Length=1013

 Score =   224 bits (571),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPFRQ-LHNRRLLWHGSRATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC  ++ +PVG +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHASQADPVGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  V S V  + LLYNEYI+YD+AQV L++L+K+RF +K
Sbjct  960   SITM-DGVEVPLGTGVSSGVNDTCLLYNEYIIYDVAQVNLKYLLKLRFNFK  1009



>ref|XP_011359180.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Pteropus vampyrus]
Length=948

 Score =   223 bits (569),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  776  EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  834

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC   + +PVG +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  835  VSKSANYCHAFQGDPVGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  894

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  VPS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  895  SITL-DGVEVPLGTGVPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  944



>ref|XP_006974251.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Peromyscus maniculatus 
bairdii]
Length=1013

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGEGQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>ref|XP_004271024.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Orcinus orca]
Length=1013

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITM-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVSLKYLLKLKFNFK  1009



>ref|XP_007102732.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Physeter catodon]
Length=1013

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITM-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVSLKYLLKLKFNFK  1009



>ref|XP_011499146.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
[Ceratosolen solmsi marchali]
Length=995

 Score =   223 bits (569),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE  ++ PF KKL NR LLWHGSR+TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMV
Sbjct  825  GEERRYKPF-KKLSNRKLLWHGSRVTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMV  883

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSA YC TN K+  G +LL +VALG+MHEL  A Y++K P GKHST G GKT P     
Sbjct  884  SKSANYCCTNAKDSKGLLLLCDVALGNMHELYHADYIEKLPHGKHSTWGRGKTQPDPEKS  943

Query  289  VKWRDEVVVPCGKPVPSKVKA-SELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +K +  V VPCG  + +++K  S LLYNE+IVYD+AQVK++++VK+ F+YK
Sbjct  944  IKLKSGVEVPCGPAISAELKKDSSLLYNEFIVYDVAQVKVEYIVKLDFKYK  994



>ref|XP_001491507.4| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Equus caballus]
Length=999

 Score =   223 bits (569),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  827  EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  885

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  886  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  945

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             V   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  946  SVT-MDGVEVPLGTGISSGVSDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  995



>ref|XP_003814976.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Pan paniscus]
Length=1014

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+  NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQFHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V +P G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   NISL-DGVDIPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_007464233.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Lipotes vexillifer]
Length=1013

 Score =   223 bits (569),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITM-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVSLKYLLKLKFNFK  1009



>gb|ELW49552.1| Poly [ADP-ribose] polymerase 1 [Tupaia chinensis]
Length=1081

 Score =   224 bits (571),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  909   EGESQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  967

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  968   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  1027

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  1028  SITL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1077



>ref|XP_004761979.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X3 [Mustela 
putorius furo]
Length=1024

 Score =   224 bits (570),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  852   EGESQRYKPFRQ-LHNRRLLWHGSRATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  910

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC  ++ +PVG +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  911   VSKSANYCHASQADPVGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  970

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  V S V  + LLYNEYI+YD+AQV L++L+K+RF +K
Sbjct  971   SITM-DGVEVPLGTGVSSGVNDTCLLYNEYIIYDVAQVNLKYLLKLRFNFK  1020



>ref|XP_007167258.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Balaenoptera acutorostrata scammoni]
Length=1021

 Score =   223 bits (569),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  849   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  907

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  908   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  967

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  968   SITM-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVSLKYLLKLKFNFK  1017



>ref|XP_003770730.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Sarcophilus harrisii]
Length=1115

 Score =   224 bits (571),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  943   EGESQRYKPF-KQLHNRRLLWHGSRATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  1001

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  1002  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTAPDPTA  1061

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   D V +P G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  1062  SVTL-DGVEIPLGTGIPSGVSDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1111



>ref|XP_011138702.1| PREDICTED: poly [ADP-ribose] polymerase [Harpegnathos saltator]
 gb|EFN84955.1| Poly [ADP-ribose] polymerase [Harpegnathos saltator]
Length=983

 Score =   223 bits (569),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 132/171 (77%), Gaps = 1/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF KKL NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  813  QGEEQRYKPF-KKLPNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  871

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC TN  N  G +LL EVALG+++E  +A Y++K PKGKHST G G+T P   +
Sbjct  872  VSKSANYCCTNSSNSTGLLLLCEVALGNIYERYQADYIEKLPKGKHSTMGRGQTHPDPEN  931

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              K +D V VP G+ V + +K S LLYNEYIVYD+AQVK+++L+++ F+YK
Sbjct  932  VYKTKDGVEVPYGEGVSANIKKSALLYNEYIVYDVAQVKVRYLIRMDFKYK  982



>ref|XP_006268817.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Alligator mississippiensis]
Length=1011

 Score =   223 bits (569),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  839   EGESQRYKPFRQ-LHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  897

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  898   VSKSANYCHTSQADPVGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTA  957

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              + + + V VP G  + + +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  958   TISY-EGVEVPLGNGMSTGINDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  1007



>ref|XP_006914334.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Pteropus alecto]
 gb|ELK10638.1| Poly [ADP-ribose] polymerase 1 [Pteropus alecto]
Length=1011

 Score =   223 bits (569),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  839   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  897

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC   + +PVG +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  898   VSKSANYCHAFQGDPVGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  957

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  VPS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  958   SITL-DGVEVPLGTGVPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1007



>ref|XP_009808696.1| PREDICTED: poly [ADP-ribose] polymerase 1-like, partial [Gavia 
stellata]
Length=360

 Score =   213 bits (543),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  188  EGESQRYKPF-KQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  246

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  247  VSKSANYCHTSQADPIGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTA  306

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                   V VP G  + + +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  307  TTTLGG-VEVPLGNGISTGINDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  356



>gb|AAI00002.1| Poly (ADP-ribose) polymerase family, member 1 [Danio rerio]
Length=1011

 Score =   223 bits (569),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  839   EGEYQRYRPF-KELPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  897

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+MHELKKA ++ K PKGKHS KGLG++ P    
Sbjct  898   VSKSANYCHTSQADPVGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRSAPDPRA  957

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   + V +P GK + + +  + LLYNEYIVYD++QV L++L+K+RF Y+
Sbjct  958   TVSL-NGVDIPLGKGMNTNIDDTSLLYNEYIVYDVSQVNLKYLLKIRFNYQ  1007



>ref|XP_007935170.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Orycteropus afer afer]
Length=1016

 Score =   223 bits (569),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  844   EGENQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  902

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  903   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  962

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S +  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  963   SITL-DGVEVPLGTGISSGINDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1012



>ref|XP_004439616.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ceratotherium simum 
simum]
Length=971

 Score =   223 bits (568),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  799  EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  857

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  858  VSKSANYCHTSQGDPIGLVLLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  917

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             V   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  918  SVTL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  967



>ref|XP_003930339.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Saimiri boliviensis 
boliviensis]
Length=1013

 Score =   223 bits (569),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITL-DGVEVPLGIGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>gb|EHH15492.1| hypothetical protein EGK_01593 [Macaca mulatta]
Length=1014

 Score =   223 bits (569),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G ++L EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLIVLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SISL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_004393605.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Odobenus rosmarus 
divergens]
Length=1014

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYEPFRQ-LHNRRLLWHGSRATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  901   VSKSANYCRTSQADPVGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPAA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SITM-DGVEVPLGTGISSGVSDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_004354000.1| Poly(ADPribose) polymerase catalytic domain containing protein, 
partial [Acanthamoeba castellanii str. Neff]
 gb|ELR24303.1| Poly(ADPribose) polymerase catalytic domain containing protein, 
partial [Acanthamoeba castellanii str. Neff]
Length=216

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 127/170 (75%), Gaps = 1/170 (1%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE ++F P+   L N+ LLWHGSRLTN++GILSQGLRIAPPEAP+TGYMFGKGVYFAD+V
Sbjct  48   GEEERFKPY-AALGNQQLLWHGSRLTNWMGILSQGLRIAPPEAPSTGYMFGKGVYFADLV  106

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            +KSA YC  +R+NPVG MLLS VALG  ++  +A++M+    G  STKG G T P  ++ 
Sbjct  107  TKSANYCHASRENPVGVMLLSRVALGKTYDCTQAEFMNANKPGFDSTKGCGATGPDPAEN  166

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            V   D  VVP GKPVP+    + LLYNE+IVYD+AQ+ +++LV V F+Y 
Sbjct  167  VTMADGTVVPLGKPVPTGTSNTSLLYNEFIVYDVAQLLIKYLVVVEFKYS  216



>ref|XP_006871190.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Chrysochloris 
asiatica]
Length=1013

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGENQRYKPFRQ-LHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S +  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITL-DGVEVPLGTGISSGINDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|NP_001038407.1| poly [ADP-ribose] polymerase 1 [Danio rerio]
Length=1013

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  841   EGEYQRYRPF-KELPNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+MHELKKA ++ K PKGKHS KGLG++ P    
Sbjct  900   VSKSANYCHTSQADPVGLILLGEVALGNMHELKKASHITKLPKGKHSVKGLGRSAPDPRA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V   + V +P GK + + +  + LLYNEYIVYD++QV L++L+K+RF Y+
Sbjct  960   TVSL-NGVDIPLGKGMNTNIDDTSLLYNEYIVYDVSQVNLKYLLKIRFNYQ  1009



>ref|XP_006012380.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Latimeria chalumnae]
Length=746

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF++ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  574  EGESQRYKPFQQ-LHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  632

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +PVG +LL EVALG+M+ELK+A ++ K PKGKHS KGLG+T P    
Sbjct  633  VSKSANYCHTSQADPVGLILLGEVALGNMYELKRANHITKLPKGKHSVKGLGRTGPDPGT  692

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             V   D V VP GK     ++ + LLYNEYIVYDIAQV L++L+K++F YK
Sbjct  693  SVML-DGVQVPLGKGTSMGIEDASLLYNEYIVYDIAQVNLKYLLKLKFNYK  742



>ref|XP_001090984.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 4 [Macaca mulatta]
Length=1014

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G ++L EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLIVLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SISL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_005541069.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Macaca fascicularis]
 gb|EHH50496.1| hypothetical protein EGM_01339 [Macaca fascicularis]
Length=1014

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G ++L EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLIVLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SISL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_005404552.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Chinchilla lanigera]
Length=1013

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPFRQ-LHNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDSSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +  +  V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SITLQG-VEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1009



>ref|XP_010380279.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Rhinopithecus roxellana]
Length=1014

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G ++L EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLIVLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SISL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_001090628.2| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Macaca mulatta]
Length=993

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  821  EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  879

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G ++L EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  880  VSKSANYCHTSQGDPIGLIVLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  939

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  940  SISL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  989



>ref|XP_007670669.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ornithorhynchus anatinus]
Length=1002

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  830  EGESQRYKPF-KQLHNRQLLWHGSRATNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  888

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  889  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKNASHISKLPKGKHSVKGLGKTAPDPSA  948

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  949  SITL-DGVEVPLGTGISSGVSDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  998



>ref|XP_010611507.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Fukomys damarensis]
Length=991

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  819  EGESQRYKPF-KQLHNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  877

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A +++K PKGKHS KGLGKT P  S 
Sbjct  878  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHINKLPKGKHSVKGLGKTTPDPST  937

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +  +  V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  938  SITLQG-VEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  987



>ref|XP_007986456.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1 [Chlorocebus sabaeus]
Length=1014

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G ++L EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLIVLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SISL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>ref|XP_006016655.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Alligator sinensis]
Length=1049

 Score =   223 bits (568),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKGVYFADM
Sbjct  877   EGESQRYKPFRQ-LHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGVYFADM  935

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +PVG +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  936   VSKSANYCHTSQADPVGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTA  995

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              + + + V VP G  + + +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  996   TISY-EGVEVPLGNGMSTGINDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  1045



>emb|CBY18306.1| unnamed protein product [Oikopleura dioica]
Length=999

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 126/169 (75%), Gaps = 1/169 (1%)
 Frame = -1

Query  646  ELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVS  467
            E  KF PF K  +NR LLWHGSRLTN+ GILSQGLRIAPPEAP TGYMFGKG+YFADMVS
Sbjct  827  EAKKFKPFSK-FENRQLLWHGSRLTNYAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVS  885

Query  466  KSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYV  287
            KSA YCF +  N  G +LL EVALG+MHELK A+Y++K PKG HS KGLG T P  +   
Sbjct  886  KSANYCFASPDNSRGLLLLGEVALGNMHELKAAEYIEKLPKGCHSVKGLGSTEPDPACVR  945

Query  286  KWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            +  +   VPCGK VPS    + LLYNEYIVYD AQV L++L+  +F++K
Sbjct  946  ELPNGTKVPCGKGVPSNADNTSLLYNEYIVYDAAQVNLKYLIDFKFKFK  994



>ref|XP_005014800.1| PREDICTED: LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 
1, partial [Anas platyrhynchos]
Length=877

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  705  EGESQRYKPF-KQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  763

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  + 
Sbjct  764  VSKSANYCHTSQADPIGLILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTA  823

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                 D V VP G  + + +  + LLYNEYIVYD+AQV L++L+K++F YK
Sbjct  824  TTSL-DGVEVPLGNGISTGINDTCLLYNEYIVYDVAQVNLKYLLKLKFNYK  873



>ref|XP_003462410.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Cavia porcellus]
Length=1011

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  839   EGESQRYKPFRQ-LHNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  897

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  898   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  957

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +  +  V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  958   SITLQG-VEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1007



>ref|XP_010851175.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Bison bison 
bison]
Length=1013

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SIT-VDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>sp|P31669.1|PARP1_XENLA RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: 
Full=ADP-ribosyltransferase diphtheria toxin-like 1; 
Short=ARTD1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; 
Short=ADPRT 1; AltName: Full=Poly[ADP-ribose] synthase 1, partial 
[Xenopus laevis]
 emb|CAA78126.1| NAD(+) ADP-ribosyltransferase [Xenopus laevis]
Length=998

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 129/171 (75%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  825  EGEYQRYKPF-KQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  883

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC     +P+G +LL EVALG+MHELK A  + K PKGKHS KGLG+T P  S 
Sbjct  884  VSKSANYCHAMPGSPIGLILLGEVALGNMHELKAASQITKLPKGKHSVKGLGRTAPDPSA  943

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             V+  D V VP GK   + +  + LLYNEYIVYDIAQV L++L+K++F YK
Sbjct  944  TVQL-DGVDVPLGKGTSANISDTSLLYNEYIVYDIAQVNLKYLLKLKFNYK  993



>ref|XP_004013685.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ovis aries]
Length=1013

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGEGQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SIT-MDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>ref|XP_010851174.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Bison bison 
bison]
Length=1016

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  844   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  902

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  903   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  962

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  963   SIT-VDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  1012



>ref|XP_005690590.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Capra hircus]
Length=1016

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  844   EGEGQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  902

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  903   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  962

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  963   SIT-MDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  1012



>ref|XP_005959159.1| PREDICTED: poly [ADP-ribose] polymerase 1-like [Pantholops hodgsonii]
Length=993

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  821  EGEGQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  879

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  880  VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  939

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  940  SIT-MDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  989



>dbj|BAE38574.1| unnamed protein product [Mus musculus]
Length=1014

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PFR+ L NR LLWHGS  TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYKPFRQ-LHNRRLLWHGSMTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  +PS V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SITL-EGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



>gb|KFO19690.1| Poly [ADP-ribose] polymerase 1 [Fukomys damarensis]
Length=1015

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  843   EGESQRYKPF-KQLHNRKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  901

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A +++K PKGKHS KGLGKT P  S 
Sbjct  902   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHINKLPKGKHSVKGLGKTTPDPST  961

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +  +  V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  962   SITLQG-VEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1011



>ref|XP_547506.3| PREDICTED: poly [ADP-ribose] polymerase 1 isoform 1 [Canis lupus 
familiaris]
Length=1043

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  871   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  929

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  930   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  989

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  990   SITL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1039



>ref|XP_005216853.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Bos taurus]
Length=1013

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SIT-VDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>ref|NP_001081571.1| poly [ADP-ribose] polymerase 1 [Xenopus laevis]
 gb|AAI10779.1| PARP protein [Xenopus laevis]
Length=1011

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 129/171 (75%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  838   EGEYQRYKPF-KQLHNRQLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  896

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC     +P+G +LL EVALG+MHELK A  + K PKGKHS KGLG+T P  S 
Sbjct  897   VSKSANYCHAMPGSPIGLILLGEVALGNMHELKAASQITKLPKGKHSVKGLGRTAPDPSA  956

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              V+  D V VP GK   + +  + LLYNEYIVYDIAQV L++L+K++F YK
Sbjct  957   TVQL-DGVDVPLGKGTSANISDTSLLYNEYIVYDIAQVNLKYLLKLKFNYK  1006



>tpg|DAA21368.1| TPA: poly [ADP-ribose] polymerase 1 [Bos taurus]
Length=1016

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  844   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  902

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  903   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  962

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  963   SIT-VDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  1012



>ref|XP_005690591.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Capra hircus]
Length=1013

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGEGQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SIT-MDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>ref|XP_003707671.1| PREDICTED: poly [ADP-ribose] polymerase-like [Megachile rotundata]
Length=991

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PFRK L N+ LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  820  QGEDSRYKPFRK-LSNKKLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  878

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC TN +NP G +LL EVALG++++  +A ++ K P+GKHST G G+T P    
Sbjct  879  VSKSANYCCTNSENPTGLLLLCEVALGNIYDRYQADFITKLPQGKHSTMGHGQTQPDPQC  938

Query  292  YVKWRDEVVVPCGKPVPSKV-KASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              K +D V VP G PVP+K+ K S LLYNEYIVYD+AQVK ++LVK+ F+YK
Sbjct  939  VHKMKDGVEVPYGPPVPAKLPKKSSLLYNEYIVYDVAQVKARYLVKMHFKYK  990



>ref|XP_006046141.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X2 [Bubalus 
bubalis]
Length=1013

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  841   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  899

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  900   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  959

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  960   SIT-VDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  1009



>ref|XP_006046140.1| PREDICTED: poly [ADP-ribose] polymerase 1 isoform X1 [Bubalus 
bubalis]
Length=1016

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  844   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  902

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  903   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  962

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  963   SIT-VDGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVHLKYLLKLKFNFK  1012



>ref|XP_009184638.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Papio anubis]
Length=1085

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  913   EGECQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  971

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G ++L EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  972   VSKSANYCHTSQGDPIGLIVLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  1031

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   D V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  1032  SISL-DGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1081



>gb|ELT93548.1| hypothetical protein CAPTEDRAFT_223861 [Capitella teleta]
Length=994

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE  +F PFR  L NR LLWHGSR TN+ GILSQGLRIAPPEAP TGYMFGKG+YFADMV
Sbjct  825  GEAKRFRPFRD-LHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGLYFADMV  883

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSA YC   + +P G +LL +VALG+MHELK A+Y+ K PKGKHSTKG G T P+ S +
Sbjct  884  SKSANYCRATKTDPTGLLLLCDVALGNMHELKAAEYVQKLPKGKHSTKGCGMTTPEPSTF  943

Query  289  VKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
                D VV P G+   + +  S LLYNEYIVYD +QV++++++KV+F +K
Sbjct  944  YTNNDGVVYPIGEGTEADIGQSSLLYNEYIVYDQSQVQIKYMLKVKFGFK  993



>ref|XP_008159430.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Eptesicus fuscus]
Length=972

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652  KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
            +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  800  EGEHQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  858

Query  472  VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
            VSKSA YC T++ +PVG +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  859  VSKSANYCHTSQGDPVGLILLGEVALGNMYELKHALHVSKLPKGKHSVKGLGKTTPDPSA  918

Query  292  YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
             +   D V VP G  V S V  + LLYNEYIVYD AQV L++L+K++F +K
Sbjct  919  SITL-DGVEVPLGTGVSSGVDDTSLLYNEYIVYDTAQVNLKYLLKLKFNFK  968



>ref|XP_003424731.1| PREDICTED: poly [ADP-ribose] polymerase [Nasonia vitripennis]
Length=992

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  649  GELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMV  470
            GE  ++ PF KKL NR LLWHGSR+TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMV
Sbjct  822  GEESRYRPF-KKLPNRKLLWHGSRVTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMV  880

Query  469  SKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDY  290
            SKSA YC TN +N  G +LL +VALG+M+E   A Y++K P GKHST G GKT+P     
Sbjct  881  SKSANYCCTNSQNSTGLLLLCDVALGNMYERYNADYIEKLPHGKHSTWGRGKTMPDPEKS  940

Query  289  VKWRDEVVVPCGKPVPSKVKA-SELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
            VK +  V VPCG  + + +K  S LLYNE+IVYD+AQVK+++LVK+ F+YK
Sbjct  941  VKLKSGVEVPCGPGIQADLKEKSSLLYNEFIVYDVAQVKVEYLVKMNFKYK  991



>ref|XP_005326600.1| PREDICTED: poly [ADP-ribose] polymerase 1 [Ictidomys tridecemlineatus]
Length=1014

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 2/171 (1%)
 Frame = -1

Query  652   KGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADM  473
             +GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG+YFADM
Sbjct  842   EGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM  900

Query  472   VSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESD  293
             VSKSA YC T++ +P+G +LL EVALG+M+ELK A ++ K PKGKHS KGLGKT P  S 
Sbjct  901   VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA  960

Query  292   YVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK  140
              +   + V VP G  + S V  + LLYNEYIVYDIAQV L++L+K++F +K
Sbjct  961   SITL-EGVEVPLGTGISSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFK  1010



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250