BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF037E04

Length=735
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011083841.1|  PREDICTED: thioredoxin-like 4, chloroplastic       251   1e-79   Sesamum indicum [beniseed]
ref|XP_009594381.1|  PREDICTED: thioredoxin-like 4, chloroplastic       231   5e-72   Nicotiana tomentosiformis
ref|XP_009775491.1|  PREDICTED: thioredoxin-like 4, chloroplastic       228   5e-71   Nicotiana sylvestris
ref|XP_002284743.1|  PREDICTED: thioredoxin-like 4, chloroplastic       228   9e-71   Vitis vinifera
gb|EYU25424.1|  hypothetical protein MIMGU_mgv1a013495mg                228   1e-70   Erythranthe guttata [common monkey flower]
ref|XP_010320331.1|  PREDICTED: thioredoxin-like 4, chloroplastic       227   1e-70   Solanum lycopersicum
ref|XP_007017237.1|  Thioredoxin superfamily protein isoform 2          226   2e-70   
gb|AFH68081.1|  thioredoxin-like protein 3                              224   3e-70   Populus tremula x Populus tremuloides
ref|XP_010108614.1|  Thioredoxin-like 4                                 226   3e-70   Morus notabilis
ref|XP_008444622.1|  PREDICTED: thioredoxin-like 4, chloroplastic       226   4e-70   Cucumis melo [Oriental melon]
ref|XP_007017236.1|  Thioredoxin superfamily protein isoform 1          226   5e-70   
ref|XP_003523931.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    226   6e-70   Glycine max [soybeans]
ref|XP_006354885.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    225   7e-70   Solanum tuberosum [potatoes]
ref|XP_004150883.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    225   9e-70   Cucumis sativus [cucumbers]
ref|XP_006581243.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    225   1e-69   
ref|XP_006374938.1|  hypothetical protein POPTR_0014s02920g             224   2e-69   
ref|XP_006374940.1|  hypothetical protein POPTR_0014s02920g             225   2e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010059934.1|  PREDICTED: thioredoxin-like 4, chloroplastic       223   4e-69   Eucalyptus grandis [rose gum]
ref|XP_006434766.1|  hypothetical protein CICLE_v10002686mg             223   4e-69   Citrus clementina [clementine]
ref|XP_006473325.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    223   5e-69   Citrus sinensis [apfelsine]
gb|KJB58475.1|  hypothetical protein B456_009G211800                    223   6e-69   Gossypium raimondii
ref|XP_007136685.1|  hypothetical protein PHAVU_009G065200g             223   7e-69   Phaseolus vulgaris [French bean]
ref|XP_011029989.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    223   8e-69   Populus euphratica
ref|XP_011029982.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    223   2e-68   Populus euphratica
gb|KDP38336.1|  hypothetical protein JCGZ_04261                         221   2e-68   Jatropha curcas
ref|XP_009359520.1|  PREDICTED: thioredoxin-like 4, chloroplastic       222   3e-68   Pyrus x bretschneideri [bai li]
ref|XP_008393810.1|  PREDICTED: thioredoxin-like 4, chloroplastic       221   4e-68   
ref|XP_009401435.1|  PREDICTED: thioredoxin-like 4, chloroplastic       220   7e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010525983.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    219   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_009348702.1|  PREDICTED: thioredoxin-like 4, chloroplastic       219   2e-67   Pyrus x bretschneideri [bai li]
ref|XP_008351997.1|  PREDICTED: thioredoxin-like 4, chloroplastic       219   2e-67   
emb|CDP01361.1|  unnamed protein product                                218   4e-67   Coffea canephora [robusta coffee]
ref|XP_006838053.1|  hypothetical protein AMTR_s00091p00126620          217   6e-67   
ref|XP_004501566.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    217   1e-66   Cicer arietinum [garbanzo]
ref|XP_008375989.1|  PREDICTED: thioredoxin-like 4, chloroplastic       216   2e-66   
ref|XP_008777942.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    216   3e-66   Phoenix dactylifera
ref|XP_010263549.1|  PREDICTED: thioredoxin-like 4, chloroplastic       215   7e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010943054.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    214   1e-65   
ref|XP_002510215.1|  Thioredoxin, putative                              214   2e-65   Ricinus communis
ref|XP_002889657.1|  predicted protein                                  213   3e-65   Arabidopsis lyrata subsp. lyrata
ref|XP_008220226.1|  PREDICTED: thioredoxin-like 4, chloroplastic       213   5e-65   
gb|AGV54863.1|  thioredoxin-like 4 chloroplastic-like protein           213   6e-65   Phaseolus vulgaris [French bean]
gb|AFK47986.1|  unknown                                                 213   7e-65   Lotus japonicus
gb|AES73296.2|  thioredoxin                                             212   9e-65   Medicago truncatula
ref|XP_003603045.1|  Thioredoxin H-type 3                               210   1e-64   
ref|XP_010487849.1|  PREDICTED: thioredoxin-like 4, chloroplastic       211   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006304213.1|  hypothetical protein CARUB_v10010324mg             211   2e-64   Capsella rubella
ref|XP_010667621.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    211   2e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010667619.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    211   2e-64   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS71637.1|  hypothetical protein M569_03123                         208   3e-64   Genlisea aurea
ref|XP_007223464.1|  hypothetical protein PRUPE_ppa011634mg             211   3e-64   Prunus persica
ref|XP_010475538.1|  PREDICTED: thioredoxin-like 4, chloroplastic       209   8e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009137448.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    207   9e-64   Brassica rapa
emb|CDX92634.1|  BnaC07g38920D                                          207   9e-64   
ref|NP_563794.1|  thioredoxin family protein                            209   9e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413425.1|  hypothetical protein EUTSA_v10026224mg             209   1e-63   Eutrema salsugineum [saltwater cress]
emb|CDY11014.1|  BnaA03g46730D                                          208   3e-63   Brassica napus [oilseed rape]
ref|NP_973781.1|  thioredoxin family protein                            208   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137446.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    208   3e-63   Brassica rapa
ref|XP_006647405.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    207   1e-62   Oryza brachyantha
gb|AIN39829.1|  hypothetical protein                                    206   3e-62   Zoysia matrella [Japanese carpet grass]
ref|XP_010235574.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    204   1e-61   Brachypodium distachyon [annual false brome]
dbj|BAJ99374.1|  predicted protein                                      203   2e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003575193.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    203   3e-61   Brachypodium distachyon [annual false brome]
ref|XP_002454035.1|  hypothetical protein SORBIDRAFT_04g023500          202   5e-61   Sorghum bicolor [broomcorn]
gb|EMT00850.1|  Thioredoxin                                             202   6e-61   
ref|XP_011458932.1|  PREDICTED: thioredoxin-like 4, chloroplastic       202   6e-61   Fragaria vesca subsp. vesca
ref|XP_010235573.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    202   6e-61   Brachypodium distachyon [annual false brome]
gb|AFW71917.1|  thioredoxin-like 2                                      200   3e-60   
gb|EEC73438.1|  hypothetical protein OsI_07725                          199   2e-59   Oryza sativa Indica Group [Indian rice]
ref|NP_001151688.1|  thioredoxin-like 2                                 198   3e-59   
ref|XP_004952710.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    197   6e-59   Setaria italica
ref|NP_001047177.1|  Os02g0567100                                       195   5e-58   
ref|XP_001764331.1|  predicted protein                                  179   6e-53   
ref|XP_006374939.1|  hypothetical protein POPTR_0014s02920g             181   1e-52   
ref|XP_001780167.1|  predicted protein                                  172   2e-50   
ref|XP_010943060.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    173   1e-49   
ref|XP_010525984.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    164   8e-46   Tarenaya hassleriana [spider flower]
ref|XP_010525980.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    164   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_010525985.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    162   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_010525982.1|  PREDICTED: uncharacterized protein LOC104803...    163   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_006578025.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    162   2e-45   Glycine max [soybeans]
gb|KDO84169.1|  hypothetical protein CISIN_1g0278901mg                  162   2e-45   Citrus sinensis [apfelsine]
ref|XP_006434771.1|  hypothetical protein CICLE_v10002686mg             162   3e-45   
gb|KDO84170.1|  hypothetical protein CISIN_1g0278901mg                  160   3e-45   Citrus sinensis [apfelsine]
gb|KCW66422.1|  hypothetical protein EUGRSUZ_F00226                     158   4e-44   Eucalyptus grandis [rose gum]
ref|XP_010943061.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    157   1e-43   
ref|XP_008777945.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    156   1e-43   Phoenix dactylifera
ref|NP_973780.1|  thioredoxin family protein                            155   3e-43   
ref|XP_008777943.1|  PREDICTED: thioredoxin-like 4, chloroplastic...    156   4e-43   Phoenix dactylifera
ref|XP_002879039.1|  thioredoxin family protein                         150   2e-41   
ref|XP_006434767.1|  hypothetical protein CICLE_v10002686mg             134   7e-35   
ref|XP_006434769.1|  hypothetical protein CICLE_v10002686mg             131   4e-34   
gb|KDO84176.1|  hypothetical protein CISIN_1g0278901mg                  129   2e-33   Citrus sinensis [apfelsine]
ref|XP_006374941.1|  hypothetical protein POPTR_0014s02920g             130   2e-33   
gb|EMS47929.1|  Thioredoxin-like 4, chloroplastic                       122   5e-31   Triticum urartu
dbj|BAJ87532.1|  predicted protein                                      123   7e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006413424.1|  hypothetical protein EUTSA_v10026224mg             120   9e-30   
ref|XP_005647696.1|  hypothetical protein COCSUDRAFT_15621              117   2e-29   Coccomyxa subellipsoidea C-169
gb|AAF75085.1|AC007583_21  It contains thioredoxin domain PF|0008...    117   6e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KIY93685.1|  hypothetical protein MNEG_14276                       99.0    4e-22   Monoraphidium neglectum
gb|KHN22321.1|  Thioredoxin-like 4, chloroplastic                     95.5    1e-21   Glycine soja [wild soybean]
emb|CDY57282.1|  BnaC06g41190D                                        94.4    4e-21   Brassica napus [oilseed rape]
ref|XP_002888177.1|  hypothetical protein ARALYDRAFT_338394           79.3    3e-15   
gb|ACG42177.1|  thioredoxin H-type                                    72.0    2e-12   Zea mays [maize]
ref|XP_002461568.1|  hypothetical protein SORBIDRAFT_02g004850        71.6    2e-12   
ref|NP_001147192.1|  thioredoxin H-type                               70.5    5e-12   
ref|XP_005642754.1|  hypothetical protein COCSUDRAFT_45478            71.2    1e-11   Coccomyxa subellipsoidea C-169
gb|KDO84167.1|  hypothetical protein CISIN_1g0278902mg                66.2    3e-11   Citrus sinensis [apfelsine]
ref|NP_001091381.1|  uncharacterized protein LOC100037235             66.6    9e-11   Xenopus laevis [clawed frog]
ref|XP_007563716.1|  PREDICTED: thioredoxin-like                      65.9    2e-10   Poecilia formosa
ref|XP_003557458.1|  PREDICTED: thioredoxin H1-like                   65.9    2e-10   Brachypodium distachyon [annual false brome]
gb|AEM42995.1|  thioredoxin H                                         65.5    4e-10   Siraitia grosvenorii [arhat fruit]
ref|XP_005837151.1|  hypothetical protein GUITHDRAFT_85403            65.9    4e-10   Guillardia theta CCMP2712
ref|XP_003447583.1|  PREDICTED: thioredoxin-like                      64.3    7e-10   Oreochromis niloticus
dbj|BAK38716.1|  thioredoxin                                          63.9    9e-10   Oplegnathus fasciatus [striped knifejaw]
ref|XP_005537392.1|  similar to thioredoxin f                         65.1    1e-09   Cyanidioschyzon merolae strain 10D
pdb|2YOI|A  Chain A, Crystal Structure Of Ancestral Thioredoxin R...  63.5    1e-09   synthetic construct
ref|XP_011397516.1|  Thioredoxin H-type                               63.9    1e-09   Auxenochlorella protothecoides
ref|XP_001509068.1|  PREDICTED: thioredoxin-like isoform X1           63.5    1e-09   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_005944628.1|  PREDICTED: thioredoxin-like                      63.2    2e-09   Haplochromis burtoni
pdb|2J23|A  Chain A, Cross-Reactivity And Crystal Structure Of Ma...  63.5    2e-09   Malassezia sympodialis
ref|XP_006657515.1|  PREDICTED: thioredoxin H1-like                   63.5    2e-09   Oryza brachyantha
ref|XP_005844786.1|  hypothetical protein CHLNCDRAFT_138664           64.3    2e-09   Chlorella variabilis
ref|XP_003447577.1|  PREDICTED: thioredoxin-like                      63.2    2e-09   
ref|NP_001085522.1|  MGC80314 protein                                 62.8    2e-09   Xenopus laevis [clawed frog]
gb|KFP55656.1|  Thioredoxin                                           62.8    2e-09   Cathartes aura
gb|KFO84041.1|  Thioredoxin                                           62.8    2e-09   Buceros rhinoceros silvestris
ref|XP_008426203.1|  PREDICTED: thioredoxin-like                      62.8    2e-09   Poecilia reticulata
ref|XP_010304587.1|  PREDICTED: thioredoxin                           62.4    2e-09   Balearica regulorum gibbericeps
gb|KFO12770.1|  Thioredoxin                                           62.4    3e-09   Balearica regulorum gibbericeps
ref|XP_010141764.1|  PREDICTED: thioredoxin                           62.8    3e-09   Buceros rhinoceros silvestris
ref|XP_009038965.1|  hypothetical protein AURANDRAFT_29236            62.8    3e-09   Aureococcus anophagefferens
ref|XP_008627424.1|  PREDICTED: thioredoxin                           62.8    3e-09   
ref|XP_006809689.1|  PREDICTED: thioredoxin-like                      62.4    3e-09   Neolamprologus brichardi [lyretail cichlid]
ref|NP_001059069.1|  Os07g0186000                                     62.4    4e-09   
ref|XP_007563715.1|  PREDICTED: thioredoxin-like                      62.0    4e-09   Poecilia formosa
ref|XP_004574216.1|  PREDICTED: thioredoxin-like isoform X2           62.0    4e-09   Maylandia zebra
pdb|1WMJ|A  Chain A, Solution Structure Of Thioredoxin Type H Fro...  62.4    4e-09   Oryza sativa [red rice]
ref|XP_005020456.1|  PREDICTED: thioredoxin                           62.8    5e-09   
ref|NP_001105811.1|  thioredoxin h homolog2                           62.0    5e-09   Zea mays [maize]
gb|ACQ58191.1|  Thioredoxin                                           61.6    5e-09   Anoplopoma fimbria
ref|XP_002595942.1|  hypothetical protein BRAFLDRAFT_268611           61.6    6e-09   Branchiostoma floridae
gb|ACF81437.1|  unknown                                               62.0    6e-09   Zea mays [maize]
ref|XP_008281601.1|  PREDICTED: thioredoxin                           61.6    6e-09   Stegastes partitus
gb|ACG30866.1|  thioredoxin H-type                                    62.0    7e-09   Zea mays [maize]
ref|XP_009488383.1|  PREDICTED: thioredoxin                           61.6    7e-09   Pelecanus crispus
ref|XP_003447575.1|  PREDICTED: thioredoxin-like                      61.6    7e-09   Oreochromis niloticus
ref|XP_002180660.1|  thioredoxin h                                    61.2    7e-09   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009505960.1|  PREDICTED: thioredoxin                           61.2    8e-09   Phalacrocorax carbo [common cormorant]
gb|ACG29437.1|  thioredoxin H-type                                    61.6    8e-09   Zea mays [maize]
ref|XP_002863443.1|  hypothetical protein ARALYDRAFT_916860           60.1    1e-08   
ref|XP_010179037.1|  PREDICTED: thioredoxin                           60.8    1e-08   Mesitornis unicolor
ref|NP_001123670.1|  uncharacterized protein LOC100170420             60.8    1e-08   Xenopus tropicalis [western clawed frog]
emb|CCU98198.1|  allergen                                             60.8    1e-08   Malassezia sympodialis ATCC 42132
emb|CAI78451.1|  thioredoxin                                          60.8    1e-08   Malassezia sympodialis
gb|KFQ32124.1|  Thioredoxin                                           60.8    1e-08   Mesitornis unicolor
gb|AAU93947.1|  thioredoxin H                                         61.2    1e-08   Helicosporidium sp. ex Simulium jonesi
ref|XP_009409351.1|  PREDICTED: thioredoxin-like 2, chloroplastic...  62.8    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001268482.1|  thioredoxin                                      60.8    1e-08   Melopsittacus undulatus
ref|XP_005807281.1|  PREDICTED: thioredoxin-like                      60.8    1e-08   Xiphophorus maculatus
ref|XP_005807280.1|  PREDICTED: thioredoxin-like                      60.8    1e-08   Xiphophorus maculatus
gb|KFW92622.1|  Thioredoxin                                           60.5    1e-08   Phalacrocorax carbo [common cormorant]
ref|XP_006118910.1|  PREDICTED: thioredoxin-like                      60.5    1e-08   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005530816.1|  PREDICTED: thioredoxin                           60.5    1e-08   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_001695633.1|  thioredoxin-like protein                         62.4    2e-08   Chlamydomonas reinhardtii
gb|KFQ52792.1|  Thioredoxin                                           60.5    2e-08   Nestor notabilis
ref|XP_010399629.1|  PREDICTED: thioredoxin                           60.5    2e-08   Corvus cornix cornix
ref|XP_009817975.1|  PREDICTED: thioredoxin                           60.5    2e-08   Gavia stellata
gb|KFO55691.1|  Thioredoxin                                           60.5    2e-08   Corvus brachyrhynchos
ref|XP_004574213.1|  PREDICTED: thioredoxin-like isoform X1           60.5    2e-08   
ref|XP_004574214.1|  PREDICTED: thioredoxin-like isoform X2           60.5    2e-08   Maylandia zebra
ref|XP_009571594.1|  PREDICTED: thioredoxin                           60.1    2e-08   Fulmarus glacialis
gb|KFM12228.1|  Thioredoxin                                           60.1    2e-08   Aptenodytes forsteri
gb|KFV60183.1|  Thioredoxin                                           60.1    2e-08   Gavia stellata
ref|XP_008426201.1|  PREDICTED: thioredoxin-like                      60.5    2e-08   Poecilia reticulata
ref|XP_003557457.1|  PREDICTED: thioredoxin H1-like                   60.5    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_010016344.1|  PREDICTED: thioredoxin                           60.5    2e-08   Nestor notabilis
gb|KFP66023.1|  Thioredoxin                                           59.7    2e-08   Cariama cristata
ref|XP_009095010.1|  PREDICTED: thioredoxin                           60.1    2e-08   Serinus canaria [canary]
ref|NP_990784.1|  thioredoxin                                         60.1    2e-08   Gallus gallus [bantam]
ref|XP_009700412.1|  PREDICTED: thioredoxin                           59.7    3e-08   Cariama cristata
ref|XP_002461569.1|  hypothetical protein SORBIDRAFT_02g004860        60.1    3e-08   
ref|XP_009327272.1|  PREDICTED: thioredoxin                           59.7    3e-08   Pygoscelis adeliae
ref|XP_003213740.2|  PREDICTED: LOW QUALITY PROTEIN: thioredoxin      60.1    3e-08   Meleagris gallopavo [common turkey]
gb|KGL75115.1|  Thioredoxin                                           59.7    3e-08   Tinamus guttatus
gb|AEC03316.1|  thioredoxin H-type 2                                  60.1    3e-08   Hevea brasiliensis [jebe]
emb|CCQ38253.1|  thioredoxin H-type protein                           60.1    3e-08   Schiedea jacobii
pdb|2YPM|A  Chain A, Crystal Structure Of Ancestral Thioredoxin R...  59.7    3e-08   synthetic construct
emb|CCQ38247.1|  thioredoxin H-type protein                           60.1    3e-08   Schiedea haleakalensis
ref|XP_005494692.1|  PREDICTED: thioredoxin                           59.7    3e-08   Zonotrichia albicollis
ref|XP_002117789.1|  expressed hypothetical protein                   59.7    3e-08   Trichoplax adhaerens
gb|AAR83852.1|  thioredoxin                                           59.7    4e-08   Capsicum annuum
gb|AAL67139.1|  thioredoxin H                                         59.7    4e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006281332.1|  hypothetical protein CARUB_v10027387mg           59.7    4e-08   Capsella rubella
emb|CCQ38251.1|  thioredoxin H-type protein                           60.1    4e-08   Schiedea mannii
ref|XP_009872080.1|  PREDICTED: thioredoxin                           59.3    4e-08   Apaloderma vittatum
ref|XP_002510456.1|  Thioredoxin H-type, putative                     59.3    5e-08   Ricinus communis
emb|CBJ28369.1|  similar to thioredoxin-like protein                  59.3    5e-08   Ectocarpus siliculosus
ref|NP_035790.1|  thioredoxin                                         58.9    5e-08   Mus musculus [mouse]
emb|CCQ38271.1|  thioredoxin H-type protein                           59.7    5e-08   Schiedea apokremnos
emb|CCQ38258.1|  thioredoxin H-type protein                           59.3    6e-08   Schiedea sarmentosa
ref|XP_005425401.1|  PREDICTED: thioredoxin                           59.7    6e-08   
ref|XP_007233862.1|  PREDICTED: thioredoxin-like                      58.9    6e-08   
ref|XP_006292776.1|  hypothetical protein CARUB_v10019026mg           58.9    6e-08   Capsella rubella
pdb|1XWA|A  Chain A, Drospohila Thioredoxin, Oxidized, P41212         58.9    7e-08   Drosophila melanogaster
ref|XP_010442091.1|  PREDICTED: thioredoxin H3-like                   58.9    7e-08   Camelina sativa [gold-of-pleasure]
gb|ABK26043.1|  unknown                                               59.3    7e-08   Picea sitchensis
dbj|BAB25256.1|  unnamed protein product                              58.5    7e-08   Mus musculus [mouse]
ref|XP_008444759.1|  PREDICTED: thioredoxin H1-like                   58.9    7e-08   Cucumis melo [Oriental melon]
ref|XP_010209801.1|  PREDICTED: thioredoxin                           59.3    8e-08   Tinamus guttatus
gb|KFP93174.1|  Thioredoxin                                           58.5    8e-08   Haliaeetus albicilla
ref|NP_001132192.1|  hypothetical protein                             58.9    8e-08   Zea mays [maize]
gb|KFQ65367.1|  Thioredoxin                                           58.5    8e-08   Pelecanus crispus
ref|XP_009284533.1|  PREDICTED: thioredoxin H2-1-like                 60.1    8e-08   
ref|NP_523526.1|  thioredoxin-2, isoform A                            58.5    8e-08   Drosophila melanogaster
ref|XP_010292094.1|  PREDICTED: thioredoxin                           58.2    8e-08   Phaethon lepturus
gb|KGL90929.1|  Thioredoxin                                           58.2    8e-08   Charadrius vociferus
ref|XP_004574215.1|  PREDICTED: thioredoxin-like isoform X1           58.5    9e-08   
emb|CCQ71730.1|  thioredoxin                                          58.5    9e-08   Channa striata [banded snakehead]
ref|NP_001266774.1|  thioredoxin                                      58.9    9e-08   
gb|KFQ81561.1|  Thioredoxin                                           58.2    1e-07   Phaethon lepturus
ref|XP_008444760.1|  PREDICTED: thioredoxin H-type 1                  58.5    1e-07   Cucumis melo [Oriental melon]
dbj|BAK82164.1|  thioredoxin 2                                        58.5    1e-07   Sebastes schlegelii [black rockfish]
sp|Q9V429.2|THIO2_DROME  RecName: Full=Thioredoxin-2; Short=DmTrx-2   58.5    1e-07   
gb|AGG17889.1|  thioredoxin                                           57.8    1e-07   Cristaria plicata
pdb|2VM1|A  Chain A, Crystal Structure Of Barley Thioredoxin H Is...  58.2    1e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002180517.1|  thioredoxin f                                    58.9    1e-07   Phaeodactylum tricornutum CCAP 1055/1
emb|CCQ38255.1|  thioredoxin H-type protein                           58.5    1e-07   Schiedea obovata
ref|XP_004335509.1|  thioredoxin-1, putative                          57.8    2e-07   Acanthamoeba castellanii str. Neff
gb|KDO17028.1|  hypothetical protein SPRG_17331                       57.8    2e-07   Saprolegnia parasitica CBS 223.65
ref|XP_004703244.1|  PREDICTED: thioredoxin-like                      57.8    2e-07   
ref|NP_199112.1|  thioredoxin H3                                      58.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
sp|Q6XHI1.1|THIO2_DROYA  RecName: Full=Thioredoxin-2; Short=Trx-2     57.8    2e-07   Drosophila yakuba
ref|XP_008619027.1|  hypothetical protein SDRG_14659                  57.8    2e-07   Saprolegnia diclina VS20
gb|KDN52836.1|  thioredoxin                                           57.8    2e-07   Tilletiaria anomala UBC 951
gb|KFO81555.1|  Thioredoxin                                           57.4    2e-07   Cuculus canorus
gb|AAV73827.1|  thioredoxin                                           57.8    2e-07   Azumapecten farreri [Farrer's scallop]
ref|XP_010576482.1|  PREDICTED: thioredoxin                           57.8    2e-07   Haliaeetus leucocephalus
ref|XP_009880427.1|  PREDICTED: LOW QUALITY PROTEIN: thioredoxin      57.8    2e-07   Charadrius vociferus
dbj|BAC21264.1|  thioredoxin h                                        57.8    2e-07   Cucurbita maxima [Boston marrow]
ref|NP_190672.1|  thioredoxin H1                                      57.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494264.1|  PREDICTED: thioredoxin H3                        57.8    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010481919.1|  PREDICTED: thioredoxin H3                        57.8    2e-07   Camelina sativa [gold-of-pleasure]
ref|XP_004079889.1|  PREDICTED: thioredoxin                           57.4    2e-07   Oryzias latipes [Japanese rice fish]
ref|XP_004702285.1|  PREDICTED: thioredoxin-like                      57.4    2e-07   
ref|XP_009566503.1|  PREDICTED: thioredoxin                           57.4    2e-07   Cuculus canorus
ref|XP_010113482.1|  Thioredoxin H-type                               57.4    2e-07   Morus notabilis
ref|NP_001266925.1|  thioredoxin                                      57.8    2e-07   
ref|NP_001237535.1|  thioredoxin h1                                   57.4    2e-07   
ref|XP_002118196.1|  hypothetical protein TRIADDRAFT_62226            57.4    2e-07   Trichoplax adhaerens
ref|XP_002036354.1|  GM17580                                          57.4    3e-07   Drosophila sechellia
gb|KJB14466.1|  hypothetical protein B456_002G126200                  57.4    3e-07   Gossypium raimondii
ref|XP_002118173.1|  hypothetical protein TRIADDRAFT_62217            57.4    3e-07   Trichoplax adhaerens
ref|XP_008464899.1|  PREDICTED: thioredoxin H-type-like               57.4    3e-07   Cucumis melo [Oriental melon]
gb|KFV82279.1|  Thioredoxin                                           57.0    3e-07   Struthio camelus australis
ref|WP_038696189.1|  thioredoxin                                      57.0    3e-07   Paenibacillus
gb|KFP38788.1|  Thioredoxin                                           57.0    3e-07   Chlamydotis macqueenii
pdb|1XFL|A  Chain A, Solution Structure Of Thioredoxin H1 From Ar...  57.4    3e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AEW43599.1|  thioredoxin                                           57.0    3e-07   Epinephelus coioides [estuary cod]
gb|ACO09971.1|  Thioredoxin                                           57.4    3e-07   Osmerus mordax
gb|ADU56183.1|  thioredoxin H-type                                    57.4    3e-07   Jatropha curcas
ref|NP_446252.1|  thioredoxin                                         57.0    3e-07   Rattus norvegicus [brown rat]
ref|XP_006027765.1|  PREDICTED: thioredoxin isoform X1                57.0    3e-07   Alligator sinensis
ref|XP_002182008.1|  predicted protein                                60.5    3e-07   
ref|XP_010433541.1|  PREDICTED: thioredoxin-like 2-1, chloroplastic   58.9    3e-07   Camelina sativa [gold-of-pleasure]
gb|KHG18714.1|  Thioredoxin H-type                                    57.0    3e-07   Gossypium arboreum [tree cotton]
ref|XP_002182007.1|  predicted protein                                60.5    3e-07   Phaeodactylum tricornutum CCAP 1055/1
gb|KFV77244.1|  Thioredoxin                                           56.6    3e-07   Struthio camelus australis
ref|XP_006259272.1|  PREDICTED: thioredoxin-like isoform X1           57.0    3e-07   Alligator mississippiensis
ref|XP_009665485.1|  PREDICTED: thioredoxin                           56.6    3e-07   Struthio camelus australis
ref|XP_004955694.1|  PREDICTED: thioredoxin H1-like                   57.0    3e-07   Setaria italica
ref|XP_009675097.1|  PREDICTED: thioredoxin-like                      57.0    4e-07   Struthio camelus australis
ref|XP_006630132.1|  PREDICTED: thioredoxin-like                      57.0    4e-07   
gb|ACJ12082.1|  thioredoxin                                           56.6    4e-07   Bombina orientalis [Oriental fire-bellied toad]
ref|XP_004500971.1|  PREDICTED: thioredoxin H-type-like               57.0    4e-07   Cicer arietinum [garbanzo]
gb|KFU95557.1|  Thioredoxin                                           56.6    4e-07   Chaetura pelagica
ref|XP_003705823.1|  PREDICTED: thioredoxin-2-like                    56.6    4e-07   Megachile rotundata
gb|ACU14225.1|  unknown                                               57.0    4e-07   Glycine max [soybeans]
ref|XP_004152676.1|  PREDICTED: thioredoxin H-type-like               57.0    4e-07   
emb|CEF60816.1|  Thioredoxin family and Thioredoxin-like fold dom...  56.6    4e-07   
emb|CDY28996.1|  BnaC07g32020D                                        56.6    4e-07   
ref|XP_011077970.1|  PREDICTED: thioredoxin-like 2, chloroplastic...  58.2    4e-07   
ref|XP_010538107.1|  PREDICTED: thioredoxin H5-like                   57.0    4e-07   
gb|KFK29124.1|  hypothetical protein AALP_AA7G092000                  58.2    4e-07   
gb|KJA28343.1|  hypothetical protein HYPSUDRAFT_33706                 56.6    4e-07   
gb|ESA20361.1|  hypothetical protein GLOINDRAFT_343676                56.6    4e-07   
ref|XP_002132022.1|  PREDICTED: thioredoxin-2 isoform X1              56.6    4e-07   
pdb|3ZZX|A  Chain A, Crystallographic Structure Of Thioredoxin Fr...  56.6    5e-07   
ref|XP_011137851.1|  PREDICTED: thioredoxin-2-like isoform X2         56.2    5e-07   
ref|XP_003507020.2|  PREDICTED: thioredoxin isoform X1                56.2    5e-07   
gb|KIY50532.1|  thioredoxin                                           56.6    5e-07   
ref|XP_011083162.1|  PREDICTED: thioredoxin H-type                    56.6    5e-07   
ref|XP_007158610.1|  hypothetical protein PHAVU_002G167100g           56.6    5e-07   
ref|XP_011137850.1|  PREDICTED: thioredoxin-2-like isoform X1         56.2    5e-07   
gb|KFR02723.1|  Thioredoxin                                           56.2    6e-07   
ref|XP_010426645.1|  PREDICTED: thioredoxin H1                        56.6    6e-07   
gb|ADV36299.1|  thioredoxin                                           56.2    6e-07   
ref|XP_009633525.1|  PREDICTED: thioredoxin                           56.6    6e-07   
gb|KHF97866.1|  Thioredoxin H-type                                    56.6    6e-07   
gb|KFW80450.1|  Thioredoxin                                           56.2    6e-07   
ref|XP_004372237.1|  PREDICTED: thioredoxin                           56.2    6e-07   
ref|XP_009136581.1|  PREDICTED: thioredoxin H1-like                   56.2    6e-07   
ref|XP_010127681.1|  PREDICTED: thioredoxin domain-containing pro...  57.0    6e-07   
ref|XP_005061207.1|  PREDICTED: thioredoxin-like                      57.0    7e-07   
ref|XP_007523736.1|  PREDICTED: thioredoxin                           56.2    7e-07   
ref|XP_008782550.1|  PREDICTED: thioredoxin-like 2, chloroplastic...  57.4    7e-07   
gb|AEM37700.1|  putative uncharacterized protein A                    56.2    7e-07   
ref|XP_004960923.1|  PREDICTED: thioredoxin-like 2, chloroplastic...  58.2    7e-07   
ref|XP_010003764.1|  PREDICTED: thioredoxin                           56.2    7e-07   
ref|NP_001238579.1|  uncharacterized protein LOC100499701             56.2    7e-07   
ref|XP_009115784.1|  PREDICTED: thioredoxin H1 isoform X1             56.2    7e-07   
gb|KFP12958.1|  Thioredoxin                                           55.8    7e-07   
gb|KFR06385.1|  Thioredoxin                                           55.8    7e-07   
emb|CDX77974.1|  BnaA09g31690D                                        56.2    8e-07   
emb|CCQ38254.1|  thioredoxin H-type protein                           56.2    8e-07   
ref|XP_004149944.1|  PREDICTED: thioredoxin H-type-like               55.8    8e-07   
ref|XP_003396074.1|  PREDICTED: thioredoxin-2-like                    55.8    8e-07   
gb|EOB00726.1|  Thioredoxin                                           55.5    8e-07   
gb|ACG48941.1|  thioredoxin-like 6                                    57.8    8e-07   
gb|KDP32674.1|  hypothetical protein JCGZ_13672                       56.2    8e-07   
ref|XP_007616620.1|  PREDICTED: thioredoxin isoform X2                55.8    8e-07   
ref|XP_004172945.1|  PREDICTED: thioredoxin H-type-like               55.8    9e-07   
gb|AAZ32865.1|  thioredoxin h                                         55.8    9e-07   
emb|CAC42084.1|  thioredoxin h                                        55.8    9e-07   
emb|CBY23869.1|  unnamed protein product                              55.8    9e-07   
gb|ACQ59118.1|  Trx1                                                  55.8    9e-07   
ref|XP_005820852.1|  hypothetical protein GUITHDRAFT_81021            55.8    9e-07   
emb|CAG05767.1|  unnamed protein product                              55.8    9e-07   
ref|XP_008921576.1|  PREDICTED: thioredoxin                           55.8    9e-07   
gb|KEH36212.1|  thioredoxin H-type 1 protein                          55.8    9e-07   
ref|XP_008782549.1|  PREDICTED: thioredoxin-like 2, chloroplastic...  57.8    9e-07   
ref|XP_003529085.1|  PREDICTED: thioredoxin-like 2, chloroplastic...  57.4    1e-06   
ref|XP_008466520.1|  PREDICTED: thioredoxin H-type-like               55.8    1e-06   
ref|XP_002287462.1|  thioredoxin f                                    56.2    1e-06   
ref|XP_011077969.1|  PREDICTED: thioredoxin-like 2, chloroplastic...  57.8    1e-06   
gb|AII71795.1|  thioredoxin                                           55.8    1e-06   
ref|XP_003490398.1|  PREDICTED: thioredoxin-2-like                    55.5    1e-06   
gb|AIC37511.1|  thioredoxin                                           55.5    1e-06   
ref|XP_009412224.1|  PREDICTED: thioredoxin-like 2, chloroplastic     57.4    1e-06   
gb|ACU18560.1|  unknown                                               57.4    1e-06   
ref|XP_008209873.1|  PREDICTED: thioredoxin-2-like isoform X2         55.5    1e-06   
gb|KFK34349.1|  hypothetical protein AALP_AA5G133700                  55.5    1e-06   
ref|NP_001088487.1|  thioredoxin                                      55.5    1e-06   
ref|XP_002493699.1|  Cytoplasmic thioredoxin isoenzyme of the thi...  55.5    1e-06   
gb|ACX30746.1|  thioredoxin                                           55.5    1e-06   
gb|EMD44590.1|  thioredoxin, putative                                 55.5    1e-06   
ref|XP_003568764.1|  PREDICTED: thioredoxin-like 2, chloroplastic...  57.4    1e-06   
ref|XP_005755985.1|  PREDICTED: thioredoxin-like                      55.5    1e-06   
gb|KCW82496.1|  hypothetical protein EUGRSUZ_C03890                   57.4    1e-06   
gb|ELT90043.1|  hypothetical protein CAPTEDRAFT_206416                55.5    1e-06   
gb|KJB43364.1|  hypothetical protein B456_007G198800                  55.5    1e-06   
ref|XP_010174588.1|  PREDICTED: thioredoxin                           55.1    1e-06   
ref|XP_010547452.1|  PREDICTED: thioredoxin H1                        55.5    1e-06   
ref|XP_004709586.1|  PREDICTED: thioredoxin-like                      55.5    1e-06   
ref|XP_010915239.1|  PREDICTED: thioredoxin-like 2, chloroplastic     57.4    1e-06   
emb|CDI55083.1|  related to TRX2-thioredoxin II                       58.9    1e-06   
ref|XP_010503780.1|  PREDICTED: thioredoxin H1-like                   56.2    1e-06   
ref|XP_002865467.1|  thioredoxin H-type 3                             55.5    1e-06   
ref|XP_005996498.1|  PREDICTED: thioredoxin-like                      55.1    1e-06   
ref|NP_956317.1|  uncharacterized protein LOC336637                   55.1    1e-06   
ref|XP_011074624.1|  PREDICTED: thioredoxin H-type 1-like             55.5    1e-06   
ref|XP_724442.1|  thioredoxin                                         55.1    1e-06   
dbj|BAJ86908.1|  predicted protein                                    57.0    1e-06   
ref|XP_001976949.1|  GG18503                                          55.8    1e-06   
ref|XP_010110009.1|  Thioredoxin H-type 1                             56.2    2e-06   
ref|XP_009072814.1|  PREDICTED: thioredoxin                           55.1    2e-06   
ref|XP_002021871.1|  GL14330                                          56.2    2e-06   
gb|KFZ54392.1|  Thioredoxin                                           54.7    2e-06   
gb|KFP72076.1|  Thioredoxin                                           54.7    2e-06   
gb|EPS32604.1|  hypothetical protein PDE_07564                        55.8    2e-06   
ref|XP_656895.1|  thioredoxin                                         55.1    2e-06   
gb|EMC77271.1|  Thioredoxin                                           54.7    2e-06   
gb|AAG35777.1|AF273844_1  thioredoxin-h-like protein 1                55.1    2e-06   
gb|KFV95655.1|  Thioredoxin                                           54.7    2e-06   
ref|NP_001288844.1|  thioredoxin H-type                               55.1    2e-06   
ref|XP_008857069.1|  thioredoxin, putative                            55.1    2e-06   
ref|XP_010205782.1|  PREDICTED: thioredoxin                           55.1    2e-06   
gb|ACV52592.1|  thioredoxin H-type 1                                  55.1    2e-06   
sp|P68176.1|TRXH_BRAOL  RecName: Full=Thioredoxin H-type; Short=T...  55.1    2e-06   
ref|XP_009471465.1|  PREDICTED: thioredoxin-like                      55.5    2e-06   
gb|EPS64408.1|  hypothetical protein M569_10377                       55.1    2e-06   
gb|EST08820.1|  hypothetical protein PSEUBRA_SCAF14g01579             58.2    2e-06   
ref|XP_004291829.1|  PREDICTED: thioredoxin H-type                    55.1    2e-06   
gb|KFP26996.1|  Thioredoxin                                           54.7    2e-06   
gb|EZF33056.1|  thioredoxin                                           56.2    2e-06   
gb|AAK62378.1|AF386933_1  Thioredoxin-like protein                    55.1    2e-06   
emb|CDR15486.1|  thioredoxin 1, putative                              54.7    2e-06   
ref|XP_001355410.1|  ThioredoxinT                                     55.8    2e-06   
ref|XP_006412820.1|  hypothetical protein EUTSA_v10026102mg           57.0    2e-06   
ref|XP_005362270.1|  PREDICTED: thioredoxin isoform X1                54.7    2e-06   
ref|XP_001419941.1|  predicted protein                                54.7    2e-06   
ref|XP_009942709.1|  PREDICTED: thioredoxin-like                      55.5    2e-06   
ref|XP_006403964.1|  hypothetical protein EUTSA_v10010795mg           55.5    2e-06   
gb|KFK44092.1|  hypothetical protein AALP_AA1G215000                  54.7    2e-06   
ref|XP_734809.1|  thioredoxin                                         54.3    2e-06   
gb|KFM74253.1|  Thioredoxin                                           54.7    2e-06   
ref|XP_010155731.1|  PREDICTED: LOW QUALITY PROTEIN: thioredoxin      54.7    2e-06   
emb|CCG82164.1|  Thioredoxin-1                                        54.7    2e-06   
ref|XP_008166974.1|  PREDICTED: thioredoxin                           54.7    2e-06   
emb|CDO97924.1|  unnamed protein product                              56.2    2e-06   
gb|AEC03321.1|  thioredoxin H-type 6                                  54.7    2e-06   
ref|XP_010500182.1|  PREDICTED: thioredoxin H5-like                   54.7    2e-06   
ref|XP_010672607.1|  PREDICTED: thioredoxin H-type 1-like             54.7    2e-06   
ref|NP_001187021.1|  thioredoxin                                      54.7    2e-06   
ref|XP_006906153.1|  PREDICTED: thioredoxin                           54.7    2e-06   
sp|Q98TX1.3|THIO_OPHHA  RecName: Full=Thioredoxin; Short=Trx          54.3    3e-06   
ref|XP_009956390.1|  PREDICTED: thioredoxin                           54.3    3e-06   
ref|XP_007253776.1|  PREDICTED: thioredoxin-like isoform X1           54.3    3e-06   
ref|XP_002534131.1|  Thioredoxin H-type                               54.7    3e-06   
gb|AAZ98842.1|  thioredoxin h1                                        54.7    3e-06   
emb|CDS50301.1|  thioredoxin 1, putative                              54.3    3e-06   
gb|AEC03323.1|  thioredoxin H-type 8                                  54.7    3e-06   
gb|EGT31835.1|  hypothetical protein CAEBREN_15234                    57.4    3e-06   
ref|XP_006425591.1|  hypothetical protein CICLE_v10026781mg           54.7    3e-06   
gb|AAM62605.1|  putative thioredoxin                                  56.2    3e-06   
ref|XP_005499276.1|  PREDICTED: thioredoxin                           55.1    3e-06   
ref|XP_004335504.1|  thioredoxin, putative                            57.4    3e-06   
ref|XP_002605993.1|  hypothetical protein BRAFLDRAFT_100902           54.3    3e-06   
ref|XP_676088.1|  thioredoxin                                         53.9    3e-06   
ref|XP_006284496.1|  hypothetical protein CARUB_v10005688mg           56.2    3e-06   
ref|XP_004149946.1|  PREDICTED: thioredoxin H-type-like               54.3    3e-06   
gb|EYB84105.1|  hypothetical protein Y032_0323g2506                   53.9    3e-06   
gb|ACA60746.1|  thioredoxin 1                                         54.3    3e-06   
ref|XP_010438280.1|  PREDICTED: thioredoxin-like 2-2, chloroplastic   56.2    3e-06   
gb|ABW04626.1|  thioredoxin                                           54.3    3e-06   
ref|XP_006451583.1|  hypothetical protein CICLE_v10010759mg           54.3    3e-06   
ref|NP_194346.1|  atypical CYS  HIS rich thioredoxin 1                56.2    3e-06   
dbj|GAC94829.1|  thioredoxin                                          57.4    3e-06   
ref|XP_006341987.1|  PREDICTED: thioredoxin H-type 1-like             54.3    4e-06   
ref|XP_008852851.1|  PREDICTED: thioredoxin                           53.9    4e-06   
gb|EUD71443.1|  thioredoxin                                           53.9    4e-06   
ref|XP_006858375.1|  hypothetical protein AMTR_s00064p00202170        56.2    4e-06   
emb|CCX16789.1|  Similar to Thioredoxin; acc. no. P29429              54.7    4e-06   
gb|ABK93640.1|  unknown                                               54.3    4e-06   
ref|XP_002677569.1|  thioredoxin domain-containing protein            57.0    4e-06   
ref|XP_004711097.1|  PREDICTED: TPR repeat-containing thioredoxin...  56.2    4e-06   
gb|AAM63418.1|  thioredoxin-like protein                              56.2    4e-06   
gb|AAD35006.1|AF144388_1  thioredoxin-like 2                          55.8    4e-06   
gb|KEI38683.1|  hypothetical protein L969DRAFT_24271                  53.9    4e-06   
emb|CBI35967.3|  unnamed protein product                              55.8    4e-06   
ref|NP_567831.1|  thioredoxin-like 2-2                                56.2    4e-06   
ref|XP_001602650.3|  PREDICTED: thioredoxin-2-like isoform X1         54.3    4e-06   
gb|KJB71005.1|  hypothetical protein B456_011G100200                  54.3    4e-06   
ref|XP_008464898.1|  PREDICTED: thioredoxin H1-like                   53.9    4e-06   
ref|XP_009401926.1|  PREDICTED: thioredoxin-like 2, chloroplastic     55.8    4e-06   
ref|XP_010498395.1|  PREDICTED: thioredoxin H4                        54.3    4e-06   
ref|XP_002869625.1|  hypothetical protein ARALYDRAFT_492196           55.8    4e-06   
ref|XP_010459650.1|  PREDICTED: thioredoxin H4-like                   53.9    4e-06   
gb|ACF35502.1|  putative thioredoxin                                  53.5    4e-06   
ref|XP_011028925.1|  PREDICTED: thioredoxin H1-like                   53.9    4e-06   
emb|CDP07462.1|  unnamed protein product                              54.3    5e-06   
ref|NP_849469.1|  thioredoxin-like 2-2                                55.8    5e-06   
ref|XP_007046793.1|  Thioredoxin H-type 1, H1,TRX1                    53.9    5e-06   
ref|XP_002300738.1|  thioredoxin h family protein                     53.9    5e-06   
ref|XP_010866970.1|  PREDICTED: thioredoxin-like                      53.9    5e-06   
gb|EJK73176.1|  hypothetical protein THAOC_05213                      53.9    5e-06   
ref|XP_002100028.1|  GE16820                                          54.7    5e-06   
gb|KFP02396.1|  Thioredoxin                                           53.5    5e-06   
ref|XP_007271163.1|  thioredoxin                                      53.5    5e-06   
ref|XP_008221338.1|  PREDICTED: thioredoxin H-type-like               54.3    5e-06   
ref|XP_007160713.1|  hypothetical protein PHAVU_001G010800g           53.9    5e-06   
ref|XP_009761049.1|  PREDICTED: thioredoxin H-type 1                  53.9    5e-06   
ref|XP_002118197.1|  hypothetical protein TRIADDRAFT_62227            53.9    5e-06   
gb|EQB49288.1|  thioredoxin                                           53.9    5e-06   
gb|KHN32916.1|  Thioredoxin-like 2, chloroplastic                     55.5    5e-06   
ref|XP_007860675.1|  thioredoxin                                      53.5    5e-06   
ref|XP_004147847.1|  PREDICTED: thioredoxin H-type-like               53.5    5e-06   
ref|XP_007152984.1|  hypothetical protein PHAVU_004G176700g           55.5    5e-06   
ref|XP_008494074.1|  PREDICTED: thioredoxin                           53.9    5e-06   
ref|XP_009107463.1|  PREDICTED: thioredoxin H5                        53.9    5e-06   
ref|XP_007873093.1|  hypothetical protein PNEG_01178                  56.2    5e-06   
emb|CDY06790.1|  BnaC01g08890D                                        56.6    6e-06   
gb|AET44428.1|  thioredoxin                                           53.5    6e-06   
gb|AFK36486.1|  unknown                                               55.1    6e-06   
ref|XP_007424609.1|  PREDICTED: thioredoxin-like                      54.3    6e-06   
ref|XP_003648031.1|  hypothetical protein Ecym_7388                   53.5    6e-06   
gb|EYB84104.1|  hypothetical protein Y032_0323g2506                   53.5    6e-06   
ref|XP_007934914.1|  PREDICTED: thioredoxin                           53.5    6e-06   
ref|XP_010586323.1|  PREDICTED: thioredoxin                           56.2    6e-06   
ref|XP_003055126.1|  hypothetical protein MICPUCDRAFT_24412           53.9    6e-06   
emb|CBQ69001.1|  related to TRX2-thioredoxin II                       56.6    6e-06   
ref|XP_008337832.1|  PREDICTED: thioredoxin H-type                    53.5    6e-06   
ref|XP_005852743.1|  thioredoxin f                                    53.9    6e-06   
ref|XP_004521006.1|  PREDICTED: thioredoxin-T-like                    53.9    6e-06   
ref|XP_003517423.1|  PREDICTED: thioredoxin-like 2, chloroplastic...  55.1    6e-06   
gb|ACU19208.1|  unknown                                               55.1    6e-06   
gb|ACV87221.1|  Pi-ta variant KPt.1                                   56.6    6e-06   
ref|NP_001066574.1|  Os12g0281300                                     56.6    6e-06   
gb|ABK26938.1|  unknown                                               54.7    6e-06   
gb|KDO57744.1|  hypothetical protein CISIN_1g026887mg                 55.1    7e-06   
gb|AEC03317.1|  thioredoxin H-type 3                                  53.5    7e-06   
gb|EEC69093.1|  hypothetical protein OsI_37989                        56.6    7e-06   
ref|XP_009599959.1|  PREDICTED: thioredoxin H-type 2-like             53.5    7e-06   
ref|XP_008361428.1|  PREDICTED: thioredoxin H-type                    53.5    7e-06   
pdb|1TI3|A  Chain A, Solution Structure Of The Thioredoxin H1 Fro...  53.5    7e-06   
ref|XP_011014007.1|  PREDICTED: thioredoxin-like 2, chloroplastic     55.5    7e-06   
ref|XP_004238306.1|  PREDICTED: thioredoxin H-type 1                  53.5    7e-06   
gb|ACI69156.2|  Thioredoxin                                           53.1    7e-06   
ref|XP_004712917.1|  PREDICTED: thioredoxin-like                      53.1    7e-06   



>ref|XP_011083841.1| PREDICTED: thioredoxin-like 4, chloroplastic [Sesamum indicum]
Length=220

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 139/160 (87%), Gaps = 6/160 (4%)
 Frame = -2

Query  719  KQICAVXSSRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKAKQT  540
            K   A+  S+I S  ++NV+EL +   +      LCPV+CVREFNTDEEFSRI+EKAK++
Sbjct  62   KVTSALKLSKIKSTLDENVEELSDDDDE------LCPVDCVREFNTDEEFSRILEKAKES  115

Query  539  GALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRI  360
             ALVVVDFYRTSCGSCKYIEQGF+KLCKGSGD+EAPVVFLKHNVLDEYDEQSEVAERLRI
Sbjct  116  NALVVVDFYRTSCGSCKYIEQGFMKLCKGSGDQEAPVVFLKHNVLDEYDEQSEVAERLRI  175

Query  359  RSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQD  240
            R+VPLFHFYKNGVLLEAFPTRDKERIL AILKY+ S+PQ+
Sbjct  176  RTVPLFHFYKNGVLLEAFPTRDKERILEAILKYTASAPQE  215



>ref|XP_009594381.1| PREDICTED: thioredoxin-like 4, chloroplastic [Nicotiana tomentosiformis]
Length=215

 Score =   231 bits (588),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  614  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEA  435
            CPVECVREF TDEEFS I+EKAK+ G+LVVVDFYRT+CGSCKYIEQGF KLC+G+GDE+A
Sbjct  90   CPVECVREFKTDEEFSIILEKAKKAGSLVVVDFYRTACGSCKYIEQGFAKLCRGAGDEQA  149

Query  434  PVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSG  255
            PV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNGVLLEAFPTRDKERIL+AILKYS 
Sbjct  150  PVIFLKHNVIDEYDEQSEVAERLRIKTVPLFHFYKNGVLLEAFPTRDKERILAAILKYSA  209

Query  254  SSPQDA  237
             +  DA
Sbjct  210  PASADA  215



>ref|XP_009775491.1| PREDICTED: thioredoxin-like 4, chloroplastic [Nicotiana sylvestris]
 ref|XP_009775492.1| PREDICTED: thioredoxin-like 4, chloroplastic [Nicotiana sylvestris]
Length=215

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  614  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEA  435
            CPVECVREF TDEEFS I+EKAK+ G+LVVVDFYRT+CGSCKYIEQGF KLC+G+GDE+A
Sbjct  90   CPVECVREFKTDEEFSIILEKAKKAGSLVVVDFYRTACGSCKYIEQGFAKLCRGAGDEQA  149

Query  434  PVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSG  255
            PV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNGVLLEAFPTRDKERIL+AILKYS 
Sbjct  150  PVIFLKHNVIDEYDEQSEVAERLRIKTVPLFHFYKNGVLLEAFPTRDKERILAAILKYSA  209

Query  254  SSPQD  240
             +  D
Sbjct  210  PASAD  214



>ref|XP_002284743.1| PREDICTED: thioredoxin-like 4, chloroplastic [Vitis vinifera]
 ref|XP_010664571.1| PREDICTED: thioredoxin-like 4, chloroplastic [Vitis vinifera]
 emb|CBI19519.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   228 bits (580),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 130/157 (83%), Gaps = 6/157 (4%)
 Frame = -2

Query  710  CAVXSSRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKAKQTGAL  531
            C    + + SV  +N  EL +   +      LCPV+CVREF TDEEFSRI+EKAK+T +L
Sbjct  65   CTFRQAEVRSVAYENEGELSDEDDE------LCPVDCVREFKTDEEFSRILEKAKETNSL  118

Query  530  VVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRSV  351
            VVVDFYRTSCGSCKYIEQGF KLCKGSGDEEA V+FLKHNV+DEYDE+SEVAERLRI++V
Sbjct  119  VVVDFYRTSCGSCKYIEQGFAKLCKGSGDEEAAVIFLKHNVIDEYDEESEVAERLRIKAV  178

Query  350  PLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQD  240
            PLFHFYK+GVLLE+FPTRDKERI++AILKY+  + QD
Sbjct  179  PLFHFYKDGVLLESFPTRDKERIIAAILKYTSPASQD  215



>gb|EYU25424.1| hypothetical protein MIMGU_mgv1a013495mg [Erythranthe guttata]
Length=219

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF TDEEF+ IMEKA +  ALV+VDFYRTSCGSCKYIEQGF KLCKGSG++E
Sbjct  89   LCPVDCVREFQTDEEFAGIMEKANEVNALVIVDFYRTSCGSCKYIEQGFAKLCKGSGNQE  148

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APVVFLKHNVLDEYDEQSEVAERLRI++VPLFHFYKNGVLLEAF TRDKERIL++ILKY+
Sbjct  149  APVVFLKHNVLDEYDEQSEVAERLRIKTVPLFHFYKNGVLLEAFATRDKERILASILKYT  208

Query  257  GSSPQD  240
             S+ Q+
Sbjct  209  ASASQE  214



>ref|XP_010320331.1| PREDICTED: thioredoxin-like 4, chloroplastic [Solanum lycopersicum]
 ref|XP_010320332.1| PREDICTED: thioredoxin-like 4, chloroplastic [Solanum lycopersicum]
Length=215

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  614  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEA  435
            CPVECVREF TDEEFS I+EKAK+ G+LVVVDF+RT+CGSCKYIEQGF KLC+G+GDE+A
Sbjct  90   CPVECVREFKTDEEFSIILEKAKKAGSLVVVDFFRTACGSCKYIEQGFQKLCRGAGDEQA  149

Query  434  PVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSG  255
            PV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNGVLLEAFPTRDKERIL+AILKYS 
Sbjct  150  PVIFLKHNVIDEYDEQSEVAERLRIKTVPLFHFYKNGVLLEAFPTRDKERILAAILKYSA  209

Query  254  SSPQDA  237
             +  DA
Sbjct  210  PASADA  215



>ref|XP_007017237.1| Thioredoxin superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY14462.1| Thioredoxin superfamily protein isoform 2 [Theobroma cacao]
Length=194

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF TDEEF +I++KAK+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSGDEE
Sbjct  69   LCPVDCVREFKTDEEFLKILDKAKETNSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDEE  128

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNVLDEYDEQSEVAERLRIR+VPLFHFYKNGVLLEAFPTRDKERI+ AILKY+
Sbjct  129  AAVIFLKHNVLDEYDEQSEVAERLRIRAVPLFHFYKNGVLLEAFPTRDKERIVEAILKYT  188

Query  257  GSSPQDA  237
             ++ QDA
Sbjct  189  CTT-QDA  194



>gb|AFH68081.1| thioredoxin-like protein 3 [Populus tremula x Populus tremuloides]
Length=172

 Score =   224 bits (572),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 129/164 (79%), Gaps = 6/164 (4%)
 Frame = -2

Query  728  NVEKQICAVXSSRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKA  549
            N  K   A    RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+EKA
Sbjct  15   NFPKNSGAWRPGRIKAVVDENPAELSDEDDD------LCPVDCVREFKTDEEFLRILEKA  68

Query  548  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAER  369
            K+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+EA V FLKHNV+DEYDEQSEVAER
Sbjct  69   KETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQEAAVTFLKHNVIDEYDEQSEVAER  128

Query  368  LRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQDA  237
            LRI++VPLFHFYK GVL+E+FPTRDKERIL AILKY+  + QD 
Sbjct  129  LRIKTVPLFHFYKKGVLVESFPTRDKERILGAILKYTSPAAQDT  172



>ref|XP_010108614.1| Thioredoxin-like 4 [Morus notabilis]
 gb|EXC19770.1| Thioredoxin-like 4 [Morus notabilis]
Length=206

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEEF +I++KAK+T +LVVVDFYRTSCGSCKYIEQGF KLC+GSGDEE
Sbjct  80   LCPVECVREFKTDEEFLKILDKAKETDSLVVVDFYRTSCGSCKYIEQGFAKLCRGSGDEE  139

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNGVLLEAFPTRDKERIL AI KY+
Sbjct  140  AAVIFLKHNVIDEYDEQSEVAERLRIKTVPLFHFYKNGVLLEAFPTRDKERILEAIRKYA  199

Query  257  GSSPQD  240
             S  QD
Sbjct  200  YSGSQD  205



>ref|XP_008444622.1| PREDICTED: thioredoxin-like 4, chloroplastic [Cucumis melo]
Length=206

 Score =   226 bits (575),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF TDEEF +I++KAK+ G LVVVDFYRTSCGSCKYIEQGF KLCKGSGD++
Sbjct  81   LCPVDCVREFKTDEEFIKILDKAKENGGLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQQ  140

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVAERLRI+SVPLFHFYK+GVLLEAFPTRDKERIL+AI KYS
Sbjct  141  APVIFLKHNVMDEYDEQSEVAERLRIKSVPLFHFYKDGVLLEAFPTRDKERILTAITKYS  200

Query  257  GSSPQ  243
             S  Q
Sbjct  201  SSPLQ  205



>ref|XP_007017236.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY14461.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao]
Length=216

 Score =   226 bits (575),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF TDEEF +I++KAK+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSGDEE
Sbjct  91   LCPVDCVREFKTDEEFLKILDKAKETNSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDEE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNVLDEYDEQSEVAERLRIR+VPLFHFYKNGVLLEAFPTRDKERI+ AILKY+
Sbjct  151  AAVIFLKHNVLDEYDEQSEVAERLRIRAVPLFHFYKNGVLLEAFPTRDKERIVEAILKYT  210

Query  257  GSSPQDA  237
             ++ QDA
Sbjct  211  CTT-QDA  216



>ref|XP_003523931.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X1 
[Glycine max]
 gb|KHN04499.1| Thioredoxin-like 4, chloroplastic [Glycine soja]
Length=215

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEEFS+I++KAK+TG+LVVVDF+RTSCGSCKYIEQGF KLCK SGD E
Sbjct  87   LCPVECVREFTTDEEFSKILDKAKETGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSGDHE  146

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVA+RLRIR+VPLFHFYK+GVLLEAFPTRDK+RIL+AILKYS
Sbjct  147  APVIFLKHNVMDEYDEQSEVADRLRIRAVPLFHFYKDGVLLEAFPTRDKDRILAAILKYS  206

Query  257  GSSPQD  240
                +D
Sbjct  207  SLEAED  212



>ref|XP_006354885.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X1 
[Solanum tuberosum]
 ref|XP_006354886.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X2 
[Solanum tuberosum]
Length=215

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  614  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEA  435
            CPVECVREF TDEEFS I+EKAK+ G+LVVVDF+RT+CGSCKYIEQGF KLC+G+GDE++
Sbjct  90   CPVECVREFKTDEEFSIILEKAKKAGSLVVVDFFRTACGSCKYIEQGFQKLCRGAGDEQS  149

Query  434  PVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSG  255
            PV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNGVLLEAFPTRDKERIL+AILKYS 
Sbjct  150  PVIFLKHNVIDEYDEQSEVAERLRIKTVPLFHFYKNGVLLEAFPTRDKERILAAILKYSA  209

Query  254  SSPQDA  237
             +  DA
Sbjct  210  PASVDA  215



>ref|XP_004150883.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Cucumis sativus]
 ref|XP_004168318.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Cucumis sativus]
 gb|KGN62507.1| hypothetical protein Csa_2G357300 [Cucumis sativus]
Length=206

 Score =   225 bits (573),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF TDEEF +I++KAK+ G LVVVDFYRTSCGSCKYIEQGF KLCKGSGD++
Sbjct  81   LCPVDCVREFKTDEEFIKILDKAKENGGLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQQ  140

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYK+GVLLEAFPTRDKERIL+AI KYS
Sbjct  141  APVIFLKHNVMDEYDEQSEVAERLRIKTVPLFHFYKDGVLLEAFPTRDKERILTAITKYS  200

Query  257  GSSPQ  243
             S  Q
Sbjct  201  SSPLQ  205



>ref|XP_006581243.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Glycine max]
Length=222

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEEFS+I++KAK+TG+LVVVDF+RTSCGSCKYIEQGF KLCK SGD E
Sbjct  94   LCPVECVREFTTDEEFSKILDKAKETGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSGDHE  153

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVA+RLRIR+VPLFHFYK+GVLLEAFPTRDK+RI++AILKYS
Sbjct  154  APVIFLKHNVMDEYDEQSEVADRLRIRAVPLFHFYKDGVLLEAFPTRDKDRIVAAILKYS  213

Query  257  GSSPQD  240
                +D
Sbjct  214  SLERED  219



>ref|XP_006374938.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
 gb|ERP52735.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
Length=217

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 129/164 (79%), Gaps = 6/164 (4%)
 Frame = -2

Query  728  NVEKQICAVXSSRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKA  549
            N  K   A    RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+EKA
Sbjct  60   NFPKNNVASRPGRIKAVVDENPGELSDEDDD------LCPVDCVREFKTDEEFLRILEKA  113

Query  548  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAER  369
            K+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+EA V FLKHNV+DEYDEQSEVAER
Sbjct  114  KETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQEAAVTFLKHNVIDEYDEQSEVAER  173

Query  368  LRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQDA  237
            LRI++VPLFHFYK GVL+E+FPTRDKERIL AILKY+  + QD 
Sbjct  174  LRIKTVPLFHFYKKGVLVESFPTRDKERILGAILKYTSPAAQDT  217



>ref|XP_006374940.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
 gb|ERP52737.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
Length=241

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 129/164 (79%), Gaps = 6/164 (4%)
 Frame = -2

Query  728  NVEKQICAVXSSRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKA  549
            N  K   A    RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+EKA
Sbjct  84   NFPKNNVASRPGRIKAVVDENPGELSDEDDD------LCPVDCVREFKTDEEFLRILEKA  137

Query  548  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAER  369
            K+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+EA V FLKHNV+DEYDEQSEVAER
Sbjct  138  KETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQEAAVTFLKHNVIDEYDEQSEVAER  197

Query  368  LRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQDA  237
            LRI++VPLFHFYK GVL+E+FPTRDKERIL AILKY+  + QD 
Sbjct  198  LRIKTVPLFHFYKKGVLVESFPTRDKERILGAILKYTSPAAQDT  241



>ref|XP_010059934.1| PREDICTED: thioredoxin-like 4, chloroplastic [Eucalyptus grandis]
 ref|XP_010059935.1| PREDICTED: thioredoxin-like 4, chloroplastic [Eucalyptus grandis]
 gb|KCW66418.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
 gb|KCW66419.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
 gb|KCW66420.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
 gb|KCW66421.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
Length=216

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF TDEEF RI+ KAK+T ALVVVDFYRTSCGSCKYIEQGF KLCKG+GD+E
Sbjct  94   LCPVDCVREFKTDEEFLRILGKAKETNALVVVDFYRTSCGSCKYIEQGFAKLCKGAGDQE  153

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVAERLRIR+VPLFHFYKNGVLLEAFPTRDKERI  AILKYS
Sbjct  154  ASVIFLKHNVIDEYDEQSEVAERLRIRAVPLFHFYKNGVLLEAFPTRDKERITEAILKYS  213

Query  257  GSS  249
             S+
Sbjct  214  SSA  216



>ref|XP_006434766.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 ref|XP_006434768.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48006.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48008.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
Length=217

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVAERL+I++VPLFHFYKNG L+EAFPTRDKERI +AILKY+
Sbjct  151  APVIFLKHNVIDEYDEQSEVAERLKIKTVPLFHFYKNGALVEAFPTRDKERIDAAILKYT  210

Query  257  GSSPQD  240
             ++  D
Sbjct  211  STTSND  216



>ref|XP_006473325.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Citrus sinensis]
Length=217

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVAERL+I++VPLFHFYKNG L+EAFPTRDKERI +AILKY+
Sbjct  151  APVIFLKHNVIDEYDEQSEVAERLKIKTVPLFHFYKNGALVEAFPTRDKERIDAAILKYT  210

Query  257  GSSPQD  240
             ++  D
Sbjct  211  STTSND  216



>gb|KJB58475.1| hypothetical protein B456_009G211800 [Gossypium raimondii]
 gb|KJB58476.1| hypothetical protein B456_009G211800 [Gossypium raimondii]
Length=214

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 118/127 (93%), Gaps = 1/127 (1%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF TDEEF +I+EKAK+T +LVVVDFYRTSCGSCKYIEQGF KLCKG+GDE+
Sbjct  89   LCPVDCVREFKTDEEFLKILEKAKETNSLVVVDFYRTSCGSCKYIEQGFSKLCKGAGDED  148

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVAERLRIR+VPLFHFYKNGVLLEAFPTRDKERI+ AI+KY+
Sbjct  149  AGVIFLKHNVIDEYDEQSEVAERLRIRAVPLFHFYKNGVLLEAFPTRDKERIVEAIMKYT  208

Query  257  GSSPQDA  237
             S+ QD 
Sbjct  209  -STTQDT  214



>ref|XP_007136685.1| hypothetical protein PHAVU_009G065200g [Phaseolus vulgaris]
 gb|ESW08679.1| hypothetical protein PHAVU_009G065200g [Phaseolus vulgaris]
Length=212

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF +DEEFS+I+EKAK+ G+LVVVDF+RTSCGSCKYIEQGF KLCK SG+ E
Sbjct  84   LCPVECVREFTSDEEFSKILEKAKERGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSGNHE  143

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVA+RLRIR+VPLFHFYK+GVLLEAFPTRDKERI++AILKYS
Sbjct  144  APVIFLKHNVMDEYDEQSEVADRLRIRAVPLFHFYKDGVLLEAFPTRDKERIIAAILKYS  203

Query  257  GSSPQD  240
                +D
Sbjct  204  TLEAED  209



>ref|XP_011029989.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Populus 
euphratica]
 ref|XP_011029997.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Populus 
euphratica]
Length=217

 Score =   223 bits (567),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 129/164 (79%), Gaps = 6/164 (4%)
 Frame = -2

Query  728  NVEKQICAVXSSRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKA  549
            N  K   A    RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+EKA
Sbjct  60   NFPKNNDAWRPGRIKAVVDENPGELSDEDDD------LCPVDCVREFKTDEEFLRILEKA  113

Query  548  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAER  369
            K+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+EA V FLKHNV+DEYDEQSEVAER
Sbjct  114  KETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQEAAVTFLKHNVIDEYDEQSEVAER  173

Query  368  LRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQDA  237
            LRI++VPLFHFYK GVL+E+FPTRDKERIL AILKY+  + QD 
Sbjct  174  LRIKTVPLFHFYKRGVLVESFPTRDKERILGAILKYTSPAAQDT  217



>ref|XP_011029982.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Populus 
euphratica]
Length=241

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 129/164 (79%), Gaps = 6/164 (4%)
 Frame = -2

Query  728  NVEKQICAVXSSRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKA  549
            N  K   A    RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+EKA
Sbjct  84   NFPKNNDAWRPGRIKAVVDENPGELSDEDDD------LCPVDCVREFKTDEEFLRILEKA  137

Query  548  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAER  369
            K+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+EA V FLKHNV+DEYDEQSEVAER
Sbjct  138  KETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQEAAVTFLKHNVIDEYDEQSEVAER  197

Query  368  LRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQDA  237
            LRI++VPLFHFYK GVL+E+FPTRDKERIL AILKY+  + QD 
Sbjct  198  LRIKTVPLFHFYKRGVLVESFPTRDKERILGAILKYTSPAAQDT  241



>gb|KDP38336.1| hypothetical protein JCGZ_04261 [Jatropha curcas]
Length=209

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 124/148 (84%), Gaps = 6/148 (4%)
 Frame = -2

Query  695  SRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKAKQTGALVVVDF  516
             RI  V + N  EL +   D      LCP +CVREF TDEEF +I+EKAK+TG+LVVVDF
Sbjct  68   GRIKGVADGNPGELSDEDED------LCPADCVREFKTDEEFLKIIEKAKETGSLVVVDF  121

Query  515  YRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHF  336
            YRTSCGSCKYIEQGF KLC+G+GDEEA V+FLKHNV+DEYDEQSEVAERLRI++VPLFHF
Sbjct  122  YRTSCGSCKYIEQGFAKLCRGAGDEEAAVIFLKHNVIDEYDEQSEVAERLRIKTVPLFHF  181

Query  335  YKNGVLLEAFPTRDKERILSAILKYSGS  252
            YKNGVLLEAFPTRDKERI +AILKY+ +
Sbjct  182  YKNGVLLEAFPTRDKERITAAILKYTST  209



>ref|XP_009359520.1| PREDICTED: thioredoxin-like 4, chloroplastic [Pyrus x bretschneideri]
Length=238

 Score =   222 bits (565),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECVREF+TD EFS+I+E AK+TGALVVVDFYRTSCGSCKYIEQGF KLCKG+GD E
Sbjct  109  VCPVECVREFSTDAEFSKILETAKETGALVVVDFYRTSCGSCKYIEQGFSKLCKGAGDGE  168

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVA+RLRI++VPLFHFYK+G+LLEAFPTRDKERI +AI KY+
Sbjct  169  AAVIFLKHNVIDEYDEQSEVADRLRIKTVPLFHFYKDGILLEAFPTRDKERITAAISKYT  228

Query  257  GSSPQD  240
              + QD
Sbjct  229  SPASQD  234



>ref|XP_008393810.1| PREDICTED: thioredoxin-like 4, chloroplastic [Malus domestica]
Length=238

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECVREF+TD EFS+I+E AK+TGALVVVDFYRTSCGSCKYIEQGF KLCKG+GD E
Sbjct  109  VCPVECVREFSTDAEFSKILETAKETGALVVVDFYRTSCGSCKYIEQGFSKLCKGAGDGE  168

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVA+RLRI++VPLFHFYK+G+LLEAFPTRDKERI +AI KY+
Sbjct  169  AAVIFLKHNVIDEYDEQSEVADRLRIKTVPLFHFYKDGILLEAFPTRDKERITAAISKYT  228

Query  257  GSSPQD  240
              + QD
Sbjct  229  SPASQD  234



>ref|XP_009401435.1| PREDICTED: thioredoxin-like 4, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=209

 Score =   220 bits (560),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF T+EEF+RI++KAK  G+LVVVDFYR SCGSCKYIEQGF KLCKGSGD++
Sbjct  87   LCPVDCVREFKTEEEFARILDKAKAAGSLVVVDFYRASCGSCKYIEQGFAKLCKGSGDQQ  146

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A VVFLKHNV+DEYDEQSEVAERLRI+SVPLF FYKNGVLLEAFPTRDKERI++AILKY+
Sbjct  147  AEVVFLKHNVIDEYDEQSEVAERLRIKSVPLFQFYKNGVLLEAFPTRDKERIIAAILKYT  206

Query  257  GSS  249
             SS
Sbjct  207  SSS  209



>ref|XP_010525983.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X3 [Tarenaya 
hassleriana]
Length=219

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEEF RI+EKAK+  +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVECVREFKTDEEFQRILEKAKEASSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFY+NGVLLEAF TR+KERI +AI KY+
Sbjct  151  APVIFLKHNVIDEYDEQSEVAERLRIKAVPLFHFYRNGVLLEAFATREKERIDTAIFKYT  210

Query  257  GSSPQDA  237
             S   D 
Sbjct  211  SSKCSDT  217



>ref|XP_009348702.1| PREDICTED: thioredoxin-like 4, chloroplastic [Pyrus x bretschneideri]
 ref|XP_009348716.1| PREDICTED: thioredoxin-like 4, chloroplastic [Pyrus x bretschneideri]
Length=211

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECVREF TD EFS+I+E+A+++GALVVVDFYRTSCGSCKYIEQGF KLCKG+GD E
Sbjct  85   VCPVECVREFRTDAEFSKILERARESGALVVVDFYRTSCGSCKYIEQGFAKLCKGAGDGE  144

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVA+RLRI++VPLFHFYK+GVLLEAFPTRDKERI +AI KY+
Sbjct  145  AAVIFLKHNVIDEYDEQSEVADRLRIKTVPLFHFYKDGVLLEAFPTRDKERITAAISKYT  204

Query  257  GSSPQD  240
              + Q+
Sbjct  205  TPASQE  210



>ref|XP_008351997.1| PREDICTED: thioredoxin-like 4, chloroplastic [Malus domestica]
Length=238

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPV CVREF+TD EFS+I+E AK+TGALVVVDFYRTSCGSCKYIEQGF KLCKG+GD E
Sbjct  109  VCPVXCVREFSTDAEFSKILETAKETGALVVVDFYRTSCGSCKYIEQGFSKLCKGAGDGE  168

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVA+RLRI++VPLFHFYK+G+LLEAFPTRDKERI +AI KY+
Sbjct  169  AAVIFLKHNVIDEYDEQSEVADRLRIKTVPLFHFYKDGILLEAFPTRDKERITAAISKYT  228

Query  257  GSSPQD  240
              + QD
Sbjct  229  SPASQD  234



>emb|CDP01361.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -2

Query  614  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEA  435
            CPV+CV+EF T+EEF +I+EKA++  +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+EA
Sbjct  89   CPVDCVKEFQTNEEFFQILEKAEKANSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQEA  148

Query  434  PVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSG  255
            PV+FLKHNV++EYDE+SEVAERLRIRSVPLFHFYKNG LLEAF TRDKERIL+AILKY+ 
Sbjct  149  PVIFLKHNVINEYDEESEVAERLRIRSVPLFHFYKNGTLLEAFATRDKERILAAILKYTS  208

Query  254  SSPQDA  237
            +  +DA
Sbjct  209  APSEDA  214



>ref|XP_006838053.1| hypothetical protein AMTR_s00091p00126620 [Amborella trichopoda]
 gb|ERN00622.1| hypothetical protein AMTR_s00091p00126620 [Amborella trichopoda]
Length=182

 Score =   217 bits (552),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 116/126 (92%), Gaps = 2/126 (2%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TD EFS+I+EKAK +  LVVVDFYRTSCGSCKYIEQGF KLCKGSG++E
Sbjct  58   LCPVECVREFMTDMEFSKILEKAKDS--LVVVDFYRTSCGSCKYIEQGFSKLCKGSGNKE  115

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
             PV+FLKHNV+DEYDEQ+EVAERL+IR+VPLFHFYKNG LLEAFPTRDKERI++AILKY+
Sbjct  116  TPVIFLKHNVIDEYDEQTEVAERLKIRAVPLFHFYKNGKLLEAFPTRDKERIVAAILKYT  175

Query  257  GSSPQD  240
              +PQ+
Sbjct  176  SLTPQN  181



>ref|XP_004501566.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004501567.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=217

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEEF RI+EK+K TG+LVVVDF+RTSCGSCKYIEQGF KLCK SG  +
Sbjct  89   LCPVECVREFKTDEEFFRILEKSKGTGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSGSHD  148

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
             PV+FLKHNV+DEYDE+SEVAERLRIR+VPLFHFYK+G LLEAFPTRDKERIL+AILKYS
Sbjct  149  VPVIFLKHNVIDEYDEESEVAERLRIRAVPLFHFYKDGKLLEAFPTRDKERILAAILKYS  208

Query  257  GSSPQD  240
                +D
Sbjct  209  SLEAED  214



>ref|XP_008375989.1| PREDICTED: thioredoxin-like 4, chloroplastic [Malus domestica]
 ref|XP_008356944.1| PREDICTED: thioredoxin-like 4, chloroplastic [Malus domestica]
Length=211

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECVREF TD EFS+I+E A+++GALVVVDFYRTSCGSCKYIEQGF KLCKG+GD E
Sbjct  85   VCPVECVREFRTDXEFSKILEXARESGALVVVDFYRTSCGSCKYIEQGFSKLCKGAGDGE  144

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVA+RLRI++VPLFHFYK+GVLLEAFPTRDKERI +AI KY+
Sbjct  145  AAVIFLKHNVIDEYDEQSEVADRLRIKTVPLFHFYKDGVLLEAFPTRDKERITAAISKYT  204

Query  257  GSSPQD  240
              + Q+
Sbjct  205  TPASQE  210



>ref|XP_008777942.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=213

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
              VVFLKHNV+DEYDEQSEVAE+LRI++VPLFHFYK+GVLLEAFPTRDKERI+SAI KY+
Sbjct  151  GDVVFLKHNVIDEYDEQSEVAEQLRIKAVPLFHFYKDGVLLEAFPTRDKERIVSAIQKYT  210



>ref|XP_010263549.1| PREDICTED: thioredoxin-like 4, chloroplastic [Nelumbo nucifera]
Length=218

 Score =   215 bits (548),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TD+EF +I+EKA++T +LVVVDFYRTSCGSCKYIEQ F KLCKGSGD+E
Sbjct  89   LCPVECVREFKTDKEFFKILEKARETDSLVVVDFYRTSCGSCKYIEQVFSKLCKGSGDQE  148

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYK+GVLLEAFPTRDKERI + ILKY+
Sbjct  149  ASVIFLKHNVIDEYDEQSEVAERLRIKAVPLFHFYKDGVLLEAFPTRDKERITATILKYT  208

Query  257  GSSPQDA*VD  228
              + +D  +D
Sbjct  209  TPASEDIKID  218



>ref|XP_010943054.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010943055.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010943057.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010943058.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010943059.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=216

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD E
Sbjct  94   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDRE  153

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A VVFLKHNV+DEYDEQSEVAE+LRI++VPLFHFYK+GVLLEAFPTRDKERI+S I KY+
Sbjct  154  ADVVFLKHNVIDEYDEQSEVAEQLRIKAVPLFHFYKDGVLLEAFPTRDKERIVSTIRKYT  213



>ref|XP_002510215.1| Thioredoxin, putative [Ricinus communis]
 gb|EEF52402.1| Thioredoxin, putative [Ricinus communis]
Length=220

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CV+EF TDEEF +I+EKAK+T +LVVVDFYR SCGSCKYIEQGF KLC+G+GD E
Sbjct  94   LCPVDCVKEFKTDEEFFKILEKAKETDSLVVVDFYRPSCGSCKYIEQGFAKLCRGAGDNE  153

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYK GVLLEAFPTRDKERI ++ILKYS
Sbjct  154  ASVIFLKHNVIDEYDEQSEVAERLRIKTVPLFHFYKGGVLLEAFPTRDKERITASILKYS  213

Query  257  GSSPQ  243
              + Q
Sbjct  214  SPASQ  218



>ref|XP_002889657.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65916.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 124/153 (81%), Gaps = 6/153 (4%)
 Frame = -2

Query  710  CAVXSSRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKAKQTGAL  531
            C     R  S++ +NV EL +   D      LCPVECV EF TD+E  R++EK+K+T +L
Sbjct  58   CTFQHGRAKSLSQENVVELSDENDD------LCPVECVTEFKTDDELLRVLEKSKETNSL  111

Query  530  VVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRSV  351
            VVVDFYRT+CGSCKYIEQGF KLCK SGD+EAPV+FLKHNV+DEYDEQSEVAERLRI++V
Sbjct  112  VVVDFYRTACGSCKYIEQGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSEVAERLRIKAV  171

Query  350  PLFHFYKNGVLLEAFPTRDKERILSAILKYSGS  252
            PLFHFYKNGVLLE+F TRDKERI +AILKY+ S
Sbjct  172  PLFHFYKNGVLLESFATRDKERIDAAILKYTSS  204



>ref|XP_008220226.1| PREDICTED: thioredoxin-like 4, chloroplastic [Prunus mume]
Length=202

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEE  RI+E AK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKG+G+ E
Sbjct  74   LCPVECVREFKTDEELFRILETAKKTGSLVVVDFYRTSCGSCKYIEQGFSKLCKGAGNGE  133

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYK+G+LLEAFPTRDKERI +AI KY+
Sbjct  134  AGVIFLKHNVIDEYDEQSEVAERLRIKTVPLFHFYKDGILLEAFPTRDKERINAAISKYT  193

Query  257  GSSPQD  240
              + ++
Sbjct  194  SPASEE  199



>gb|AGV54863.1| thioredoxin-like 4 chloroplastic-like protein [Phaseolus vulgaris]
Length=215

 Score =   213 bits (541),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF  DEEFS+I+EKAK+ G+LVVVDF+RTSCGSCKYIEQGF KLCK  G+ E
Sbjct  87   LCPVECVREFTCDEEFSKILEKAKERGSLVVVDFFRTSCGSCKYIEQGFAKLCKKFGNHE  146

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVA+RLRIR+VP FHFYK+G LLEAFPTRDKERI++AI KYS
Sbjct  147  APVIFLKHNVMDEYDEQSEVADRLRIRAVPFFHFYKDGGLLEAFPTRDKERIIAAIFKYS  206

Query  257  GSSPQD  240
                +D
Sbjct  207  TFEAED  212



>gb|AFK47986.1| unknown [Lotus japonicus]
Length=213

 Score =   213 bits (541),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECVREF TDEEF +I++KAK+ G+LVVVDF+RTSCGSCKYIEQGF KLC+ SG+ +
Sbjct  85   VCPVECVREFKTDEEFCKILDKAKRAGSLVVVDFFRTSCGSCKYIEQGFAKLCRKSGNHD  144

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDE+SEVAERLRIR+VPLFHFYK+G+LLEAFPTRDK RI+ AILKYS
Sbjct  145  APVIFLKHNVIDEYDEESEVAERLRIRAVPLFHFYKDGILLEAFPTRDKARIVEAILKYS  204

Query  257  GSSPQD  240
                +D
Sbjct  205  SLEAED  210



>gb|AES73296.2| thioredoxin [Medicago truncatula]
Length=218

 Score =   212 bits (540),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECVREF TD+EF +I++K+K TG+LVVVDF+RTSCGSCKYIEQGF KLCK SG  +
Sbjct  90   VCPVECVREFKTDDEFLKILDKSKGTGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSGSHD  149

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
             PV+FLKHNV+DEYDE+SEVAERLRIR+VPLFHFYK+G LLEAFPTRDKERIL+AILKYS
Sbjct  150  VPVIFLKHNVIDEYDEESEVAERLRIRAVPLFHFYKDGKLLEAFPTRDKERILAAILKYS  209

Query  257  GSSPQD  240
                +D
Sbjct  210  SLEAED  215



>ref|XP_003603045.1| Thioredoxin H-type 3 [Medicago truncatula]
Length=162

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECVREF TD+EF +I++K+K TG+LVVVDF+RTSCGSCKYIEQGF KLCK SG  +
Sbjct  34   VCPVECVREFKTDDEFLKILDKSKGTGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSGSHD  93

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
             PV+FLKHNV+DEYDE+SEVAERLRIR+VPLFHFYK+G LLEAFPTRDKERIL+AILKYS
Sbjct  94   VPVIFLKHNVIDEYDEESEVAERLRIRAVPLFHFYKDGKLLEAFPTRDKERILAAILKYS  153

Query  257  GSSPQD  240
                +D
Sbjct  154  SLEAED  159



>ref|XP_010487849.1| PREDICTED: thioredoxin-like 4, chloroplastic [Camelina sativa]
 ref|XP_010487858.1| PREDICTED: thioredoxin-like 4, chloroplastic [Camelina sativa]
Length=208

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECV EF TD+E  R++EK+K+T +LVVVDFYRT+CGSCKYIEQGF KLCK SGD+E
Sbjct  85   LCPVECVTEFKTDDELLRVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE  144

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNGVLLE+F TRDKERI +AILKY+
Sbjct  145  APVIFLKHNVVDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFATRDKERIDAAILKYT  204

Query  257  GS  252
             S
Sbjct  205  SS  206



>ref|XP_006304213.1| hypothetical protein CARUB_v10010324mg [Capsella rubella]
 ref|XP_006304214.1| hypothetical protein CARUB_v10010324mg [Capsella rubella]
 gb|EOA37111.1| hypothetical protein CARUB_v10010324mg [Capsella rubella]
 gb|EOA37112.1| hypothetical protein CARUB_v10010324mg [Capsella rubella]
Length=203

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECV EF TD+E  R++EK+K+T  LVVVDFYRT+CGSCKYIEQGF KLCK SGD+E
Sbjct  80   LCPVECVTEFKTDDELLRVLEKSKETNTLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE  139

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNGVLLE+F TRDKERI +AILKY+
Sbjct  140  APVIFLKHNVVDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFATRDKERIDAAILKYT  199

Query  257  GS  252
             S
Sbjct  200  SS  201



>ref|XP_010667621.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=209

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECVREF TDEEF +I+EK+K+  +LVVVDFYRTSCGSCKYIEQGF KLCK SGD++
Sbjct  90   VCPVECVREFKTDEEFLKILEKSKKKNSLVVVDFYRTSCGSCKYIEQGFSKLCKASGDDD  149

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
             PV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNG LLEAFPTRDKERI  AI KY
Sbjct  150  VPVIFLKHNVMDEYDEQSEVAERLRIKTVPLFHFYKNGTLLEAFPTRDKERITEAIYKY  208



>ref|XP_010667619.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=219

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECVREF TDEEF +I+EK+K+  +LVVVDFYRTSCGSCKYIEQGF KLCK SGD++
Sbjct  100  VCPVECVREFKTDEEFLKILEKSKKKNSLVVVDFYRTSCGSCKYIEQGFSKLCKASGDDD  159

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
             PV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNG LLEAFPTRDKERI  AI KY
Sbjct  160  VPVIFLKHNVMDEYDEQSEVAERLRIKTVPLFHFYKNGTLLEAFPTRDKERITEAIYKY  218



>gb|EPS71637.1| hypothetical protein M569_03123, partial [Genlisea aurea]
Length=133

 Score =   208 bits (530),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CV+EF T+EEFSRI+ KA+ + ALVVVDFYRTSCGSCKYIEQGF K+C+G+GD +
Sbjct  10   LCPVDCVKEFKTEEEFSRILSKAEASNALVVVDFYRTSCGSCKYIEQGFAKICRGAGDPQ  69

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
             P++FLKHNVLDEYDEQSEVAERL+IRSVPLFHFYKNGV+LEAF TRDK+RIL  I KY+
Sbjct  70   TPIIFLKHNVLDEYDEQSEVAERLKIRSVPLFHFYKNGVILEAFATRDKDRILQTIRKYT  129

Query  257  GS  252
             S
Sbjct  130  HS  131



>ref|XP_007223464.1| hypothetical protein PRUPE_ppa011634mg [Prunus persica]
 gb|EMJ24663.1| hypothetical protein PRUPE_ppa011634mg [Prunus persica]
Length=202

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEE  RI+E AK+TG+LVVVDF+RTSCGSCKYIEQGF KLCKG+G+ E
Sbjct  74   LCPVECVREFKTDEELFRILETAKKTGSLVVVDFFRTSCGSCKYIEQGFSKLCKGAGNGE  133

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYK+G+LLEAFPTRDKERI +AI KY+
Sbjct  134  AGVIFLKHNVIDEYDEQSEVAERLRIKTVPLFHFYKDGILLEAFPTRDKERINAAISKYT  193

Query  257  GSSPQD  240
              + ++
Sbjct  194  SPASEE  199



>ref|XP_010475538.1| PREDICTED: thioredoxin-like 4, chloroplastic [Camelina sativa]
 ref|XP_010475539.1| PREDICTED: thioredoxin-like 4, chloroplastic [Camelina sativa]
Length=209

 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECV EF TD+E  +++EK+K+T +LVVVDFYRT+CGSCKYIEQGF KLCK SGD+E
Sbjct  86   LCPVECVTEFKTDDELLKVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE  145

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNGVLLE+F TRDKERI +AILKY+
Sbjct  146  APVIFLKHNVVDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFATRDKERIDAAILKYT  205

Query  257  GS  252
             S
Sbjct  206  SS  207



>ref|XP_009137448.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Brassica 
rapa]
Length=159

 Score =   207 bits (528),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECV EF TD+E  R++EKAK+T  LVVVDFYR SCGSCKYIEQGF KLCK SGD+E
Sbjct  31   LCPVECVTEFKTDDELLRVLEKAKETNTLVVVDFYRPSCGSCKYIEQGFSKLCKQSGDQE  90

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
            APV+FLKHNV+DEYDEQSEVAERLRI+SVPLFHFYKNGVLLEAF TRDKERI ++I KY
Sbjct  91   APVIFLKHNVIDEYDEQSEVAERLRIKSVPLFHFYKNGVLLEAFATRDKERIDASIAKY  149



>emb|CDX92634.1| BnaC07g38920D [Brassica napus]
Length=159

 Score =   207 bits (528),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECV EF TD+E  R++EKAK+T  LVVVDFYR SCGSCKYIEQGF KLCK SGD+E
Sbjct  31   LCPVECVTEFRTDDELLRVLEKAKETNTLVVVDFYRPSCGSCKYIEQGFSKLCKQSGDQE  90

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
            APV+FLKHNV+DEYDEQSEVAERLRI+SVPLFHFYKNGVLLEAF TRDKERI ++I KY
Sbjct  91   APVIFLKHNVIDEYDEQSEVAERLRIKSVPLFHFYKNGVLLEAFATRDKERIDASIAKY  149



>ref|NP_563794.1| thioredoxin family protein [Arabidopsis thaliana]
 sp|Q9C5C5.1|TRL4_ARATH RecName: Full=Thioredoxin-like 4, chloroplastic; AltName: Full=Lilium-type 
thioredoxin 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK28642.1|AF360345_1 unknown protein [Arabidopsis thaliana]
 gb|AAK93759.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01521.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28164.1| thioredoxin family protein [Arabidopsis thaliana]
Length=204

 Score =   209 bits (532),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECV EF TD+E   ++EK+K+T +LVVVDFYRT+CGSCKYIEQGF KLCK SGD+E
Sbjct  81   LCPVECVTEFKTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE  140

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNGVLLE+F TRDKERI +AILKY+
Sbjct  141  APVIFLKHNVVDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFATRDKERIDAAILKYT  200

Query  257  GS  252
             S
Sbjct  201  SS  202



>ref|XP_006413425.1| hypothetical protein EUTSA_v10026224mg [Eutrema salsugineum]
 gb|ESQ54878.1| hypothetical protein EUTSA_v10026224mg [Eutrema salsugineum]
Length=213

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECV EF TD+E  R++EKAK+T +LVVVDFYR SCGSCKYIEQGF KLCK SGD+E
Sbjct  86   VCPVECVTEFKTDDELLRVLEKAKETNSLVVVDFYRPSCGSCKYIEQGFSKLCKQSGDQE  145

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVAERLR++SVPLFHFYKNG+LLEAF TRDKERI ++ILKY+
Sbjct  146  APVIFLKHNVIDEYDEQSEVAERLRVKSVPLFHFYKNGLLLEAFATRDKERIDASILKYT  205

Query  257  GS-SP  246
             S SP
Sbjct  206  SSESP  210



>emb|CDY11014.1| BnaA03g46730D [Brassica napus]
Length=209

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECV EF TD+E  R++EKAK+T  LVVVDFYR SCGSCKYIEQGF KLCK SGD+E
Sbjct  81   LCPVECVTEFKTDDELLRVLEKAKETNTLVVVDFYRPSCGSCKYIEQGFSKLCKQSGDQE  140

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
            APV+FLKHNV+DEYDEQSEVAERLRI+SVPLFHFYKNGVLLEAF TRDKERI ++I KY
Sbjct  141  APVIFLKHNVIDEYDEQSEVAERLRIKSVPLFHFYKNGVLLEAFATRDKERIDASIAKY  199



>ref|NP_973781.1| thioredoxin family protein [Arabidopsis thaliana]
 gb|AEE28165.1| thioredoxin family protein [Arabidopsis thaliana]
Length=217

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECV EF TD+E   ++EK+K+T +LVVVDFYRT+CGSCKYIEQGF KLCK SGD+E
Sbjct  94   LCPVECVTEFKTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE  153

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APV+FLKHNV+DEYDEQSEVAERLRI++VPLFHFYKNGVLLE+F TRDKERI +AILKY+
Sbjct  154  APVIFLKHNVVDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFATRDKERIDAAILKYT  213

Query  257  GS  252
             S
Sbjct  214  SS  215



>ref|XP_009137446.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Brassica 
rapa]
 ref|XP_009137447.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Brassica 
rapa]
Length=209

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECV EF TD+E  R++EKAK+T  LVVVDFYR SCGSCKYIEQGF KLCK SGD+E
Sbjct  81   LCPVECVTEFKTDDELLRVLEKAKETNTLVVVDFYRPSCGSCKYIEQGFSKLCKQSGDQE  140

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
            APV+FLKHNV+DEYDEQSEVAERLRI+SVPLFHFYKNGVLLEAF TRDKERI ++I KY
Sbjct  141  APVIFLKHNVIDEYDEQSEVAERLRIKSVPLFHFYKNGVLLEAFATRDKERIDASIAKY  199



>ref|XP_006647405.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Oryza brachyantha]
Length=221

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
             CPVECV EF TDEEF R++E++K TGALVVVDF+R SCGSCKYIEQGF+KLCKGSGD+ 
Sbjct  86   FCPVECVTEFKTDEEFLRVLERSKATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSGDDG  145

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APVVFLKHNV+DEYDEQSEVA+RLRI+ VPLFHFYK+GVLLEAF TRDK RI++AI KY+
Sbjct  146  APVVFLKHNVIDEYDEQSEVADRLRIKVVPLFHFYKDGVLLEAFATRDKGRIIAAIQKYT  205



>gb|AIN39829.1| hypothetical protein [Zoysia matrella]
Length=214

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
             CPV+CV EF TDEEF R +E+AK TGALVVVDFYR SCGSCKYIE+GF++LCKGSGD+ 
Sbjct  85   FCPVDCVTEFKTDEEFRRHLERAKATGALVVVDFYRPSCGSCKYIERGFMRLCKGSGDDG  144

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APVVFLKHNV+DEYDEQSEVA+RLRI+ VPLFHFYK+GVL+E+F TRDKERI+ AI KY+
Sbjct  145  APVVFLKHNVIDEYDEQSEVADRLRIKVVPLFHFYKDGVLVESFATRDKERIIGAIKKYT  204

Query  257  GSSPQD  240
               P++
Sbjct  205  SVDPEE  210



>ref|XP_010235574.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X3 [Brachypodium 
distachyon]
Length=209

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 111/127 (87%), Gaps = 2/127 (2%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECV EF TDEEF+R +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSGD  
Sbjct  81   VCPVECVTEFKTDEEFTRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSGDHG  140

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            +PV+FLKHNV+DEYDEQSEVAERLRI+ VPLFHFYK+ VL+E+F TRDKERI++ I KY 
Sbjct  141  SPVIFLKHNVIDEYDEQSEVAERLRIKVVPLFHFYKDAVLVESFATRDKERIIATITKY-  199

Query  257  GSSPQDA  237
             +SP  A
Sbjct  200  -TSPDSA  205



>dbj|BAJ99374.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=194

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 2/124 (2%)
 Frame = -2

Query  614  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEA  435
            CPVECV EF TDEEFSR +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSGD  +
Sbjct  62   CPVECVTEFKTDEEFSRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSGDHGS  121

Query  434  PVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSG  255
            PV+FLKHNV+DEYDEQSEVA+RLRI+ VPLFHFYK GVL+E+F TRDKERI +AI KY  
Sbjct  122  PVIFLKHNVIDEYDEQSEVADRLRIKVVPLFHFYKAGVLVESFATRDKERITAAIAKY--  179

Query  254  SSPQ  243
            +SPQ
Sbjct  180  TSPQ  183



>ref|XP_003575193.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Brachypodium 
distachyon]
Length=209

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECV EF TDEEF+R +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSGD  
Sbjct  81   VCPVECVTEFKTDEEFTRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSGDHG  140

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            +PV+FLKHNV+DEYDEQSEVAERLRI+ VPLFHFYK+ VL+E+F TRDKERI++ I KY+
Sbjct  141  SPVIFLKHNVIDEYDEQSEVAERLRIKVVPLFHFYKDAVLVESFATRDKERIIATITKYT  200



>ref|XP_002454035.1| hypothetical protein SORBIDRAFT_04g023500 [Sorghum bicolor]
 gb|EES07011.1| hypothetical protein SORBIDRAFT_04g023500 [Sorghum bicolor]
Length=216

 Score =   202 bits (515),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
             CPV+CV EF T+EEF R +E++K TGALVVVDFYR SCGSCKYIE+GF++LCKGSGD+ 
Sbjct  82   FCPVDCVTEFKTEEEFQRHLERSKATGALVVVDFYRPSCGSCKYIEKGFIRLCKGSGDDG  141

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APVVFLKHNV+DEYDEQSEVA+RLRI+ VPLFHFYK+GVL+E+F TRDKERIL+AI KY+
Sbjct  142  APVVFLKHNVIDEYDEQSEVADRLRIKIVPLFHFYKDGVLVESFATRDKERILAAIQKYT  201

Query  257  GS  252
             +
Sbjct  202  SA  203



>gb|EMT00850.1| Thioredoxin [Aegilops tauschii]
Length=213

 Score =   202 bits (514),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  614  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEA  435
            CPVECV EF TDEEFSR +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSGD  +
Sbjct  83   CPVECVTEFKTDEEFSRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSGDHGS  142

Query  434  PVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            PV+FLKHNV+DEYDEQSEVA+RLRI+ VPLFHFYK GVL+E+F TRDKERI +AI KY+
Sbjct  143  PVIFLKHNVIDEYDEQSEVADRLRIKVVPLFHFYKAGVLVESFATRDKERITAAIAKYT  201



>ref|XP_011458932.1| PREDICTED: thioredoxin-like 4, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   202 bits (514),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEEF +I++ AK++ +LVVVDFYRTSCGSCKYIEQGF KLCK +G+ E
Sbjct  82   LCPVECVREFYTDEEFFKILDAAKESHSLVVVDFYRTSCGSCKYIEQGFSKLCKRAGEGE  141

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A V+FLKHNV+DEYDEQSEVA+RLRI++VPLFHFYK+GVLLEAFPTRDKERI +AI KY+
Sbjct  142  AEVIFLKHNVIDEYDEQSEVADRLRIKTVPLFHFYKDGVLLEAFPTRDKERITAAIRKYT  201

Query  257  GSS  249
              +
Sbjct  202  SPA  204



>ref|XP_010235573.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=216

 Score =   202 bits (515),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECV EF TDEEF+R +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSGD  
Sbjct  81   VCPVECVTEFKTDEEFTRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSGDHG  140

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            +PV+FLKHNV+DEYDEQSEVAERLRI+ VPLFHFYK+ VL+E+F TRDKERI++ I KY+
Sbjct  141  SPVIFLKHNVIDEYDEQSEVAERLRIKVVPLFHFYKDAVLVESFATRDKERIIATITKYT  200



>gb|AFW71917.1| thioredoxin-like 2 [Zea mays]
Length=213

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CV EF TDEEF R + +++ TGALVVVDFYR SCGSCKYIE+ F +LCKGSGD+ 
Sbjct  85   LCPVDCVTEFKTDEEFQRHLNRSRATGALVVVDFYRPSCGSCKYIEKAFTRLCKGSGDDG  144

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APVVFLKHNV+DEYDEQSEVA+RLRI+ VPLFHFY +GVL+E+FPTRDKERI++ I KY+
Sbjct  145  APVVFLKHNVIDEYDEQSEVADRLRIKIVPLFHFYVDGVLVESFPTRDKERIIAVIRKYT  204

Query  257  GSSPQ  243
               P+
Sbjct  205  SVEPE  209



>gb|EEC73438.1| hypothetical protein OsI_07725 [Oryza sativa Indica Group]
Length=214

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V EF T+EE +R++E+AK TGALVVVDF+R SCGSCKYIEQGF+KLCKGSGD  +PVVFL
Sbjct  85   VTEFKTEEELARVLERAKATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSGDHGSPVVFL  144

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQD  240
            KHNV+DEYDEQSEVA+RLRI+ VPLFHFYKNGVLLEAF TRDKERI++AI KY+  S   
Sbjct  145  KHNVIDEYDEQSEVADRLRIKVVPLFHFYKNGVLLEAFATRDKERIIAAIQKYTAPSSPP  204

Query  239  A  237
            A
Sbjct  205  A  205



>ref|NP_001151688.1| thioredoxin-like 2 [Zea mays]
 gb|ACG43905.1| thioredoxin-like 2 [Zea mays]
Length=223

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CV EF TDEEF R + +++ TGALVVVDFYR SCGSCKYIE+ F +LCKGSGD+ 
Sbjct  85   LCPVDCVTEFKTDEEFQRHLNRSRATGALVVVDFYRPSCGSCKYIEKAFTRLCKGSGDDG  144

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            APVVFLKHNV+DEYDEQSEVA+RLRI+ VPLFHFY +GVL+E+FPTRDKERI++ I KY+
Sbjct  145  APVVFLKHNVIDEYDEQSEVADRLRIKIVPLFHFYVDGVLVESFPTRDKERIIAVIRKYT  204

Query  257  G  255
             
Sbjct  205  S  205



>ref|XP_004952710.1| PREDICTED: thioredoxin-like 4, chloroplastic-like [Setaria italica]
Length=199

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPV+CV EF TDEEF R +E++K TGALVVVDFYR SCGSCKYIE+ F++LCKGS D+ 
Sbjct  67   VCPVDCVTEFKTDEEFVRHLERSKATGALVVVDFYRPSCGSCKYIEKRFMRLCKGSADDG  126

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
            APVVFLKHNV+DEYDE+SEVAERLRI+ VPLFHFYK+GVL+E+F TRDKERI++AI KY
Sbjct  127  APVVFLKHNVIDEYDEKSEVAERLRIKVVPLFHFYKDGVLVESFATRDKERIIAAIQKY  185



>ref|NP_001047177.1| Os02g0567100 [Oryza sativa Japonica Group]
 sp|Q6YTI3.1|TRL4_ORYSJ RecName: Full=Thioredoxin-like 4, chloroplastic; AltName: Full=Lilium-type 
thioredoxin 3; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD17754.1| thioredoxin-like protein [Oryza sativa Japonica Group]
 dbj|BAF09091.1| Os02g0567100 [Oryza sativa Japonica Group]
 dbj|BAG87960.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89948.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57221.1| hypothetical protein OsJ_07192 [Oryza sativa Japonica Group]
Length=214

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V EF T+EE +R++E+AK TGALVVVDF+R SCGSCKYIEQGF+KLCKGSGD  + VVFL
Sbjct  85   VTEFKTEEELARVLERAKATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSGDHGSSVVFL  144

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQD  240
            KHNV+DEYDEQSEVA+RLRI+ VPLFHFYKNGVLLEAF TRDKERI++AI KY+  S   
Sbjct  145  KHNVIDEYDEQSEVADRLRIKVVPLFHFYKNGVLLEAFATRDKERIIAAIQKYTAPSSPP  204

Query  239  A  237
            A
Sbjct  205  A  205



>ref|XP_001764331.1| predicted protein [Physcomitrella patens]
 gb|EDQ70885.1| predicted protein, partial [Physcomitrella patens]
Length=125

 Score =   179 bits (453),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCP+ECVRE NT  E   +++ +K +G+LVVVDF+RTSCGSC+YIE+GF KLCKG+G+ E
Sbjct  7    LCPIECVREINTLNELEHVVQDSKTSGSLVVVDFFRTSCGSCRYIEKGFQKLCKGAGNGE  66

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
            A VVFLKHNV DEY+EQS++AE+ RI+ VPLFHFYKNG L+E+FPTRDK RIL  I K+
Sbjct  67   ASVVFLKHNVFDEYEEQSDIAEKFRIKVVPLFHFYKNGELVESFPTRDKARILETIYKH  125



>ref|XP_006374939.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
 gb|ERP52736.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
Length=223

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 111/164 (68%), Gaps = 24/164 (15%)
 Frame = -2

Query  728  NVEKQICAVXSSRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKA  549
            N  K   A    RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+EKA
Sbjct  84   NFPKNNVASRPGRIKAVVDENPGELSDEDDD------LCPVDCVREFKTDEEFLRILEKA  137

Query  548  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAER  369
            K+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+EA V FLKHN              
Sbjct  138  KETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQEAAVTFLKHN--------------  183

Query  368  LRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQDA  237
                +VPLFHFYK GVL+E+FPTRDKERIL AILKY+  + QD 
Sbjct  184  ----TVPLFHFYKKGVLVESFPTRDKERILGAILKYTSPAAQDT  223



>ref|XP_001780167.1| predicted protein [Physcomitrella patens]
 gb|EDQ55008.1| predicted protein, partial [Physcomitrella patens]
Length=122

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 98/119 (82%), Gaps = 0/119 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCP+ECVRE  T  E   I++++K  G LVVVDF+RTSCG+C+YIE+GF KLCKG+G+ E
Sbjct  4    LCPIECVREITTLRELEHIIQESKSAGDLVVVDFFRTSCGTCRYIEKGFQKLCKGAGNGE  63

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
            A VVF+KHNV++EYDEQS++AERLRI+ VPLFHFYKNG L+ +F TRDK RIL  I K+
Sbjct  64   ASVVFVKHNVVNEYDEQSDIAERLRIKIVPLFHFYKNGNLVASFATRDKARILQTIYKH  122



>ref|XP_010943060.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=198

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 95/120 (79%), Gaps = 18/120 (15%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD E
Sbjct  94   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDRE  153

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            A VVFLKHN                  +VPLFHFYK+GVLLEAFPTRDKERI+S I KY+
Sbjct  154  ADVVFLKHN------------------AVPLFHFYKDGVLLEAFPTRDKERIVSTIRKYT  195



>ref|XP_010525984.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X4 [Tarenaya 
hassleriana]
Length=218

 Score =   164 bits (414),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEEF RI+EKAK+  +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVECVREFKTDEEFQRILEKAKEASSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIR  357
            APV+FLKHNV+DEYDEQSEVAERLRI+
Sbjct  151  APVIFLKHNVIDEYDEQSEVAERLRIK  177



>ref|XP_010525980.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010525981.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X1 [Tarenaya 
hassleriana]
Length=244

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEEF RI+EKAK+  +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVECVREFKTDEEFQRILEKAKEASSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIR  357
            APV+FLKHNV+DEYDEQSEVAERLRI+
Sbjct  151  APVIFLKHNVIDEYDEQSEVAERLRIK  177



>ref|XP_010525985.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X5 [Tarenaya 
hassleriana]
Length=206

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEEF RI+EKAK+  +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  53   LCPVECVREFKTDEEFQRILEKAKEASSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  112

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIR  357
            APV+FLKHNV+DEYDEQSEVAERLRI+
Sbjct  113  APVIFLKHNVIDEYDEQSEVAERLRIK  139



>ref|XP_010525982.1| PREDICTED: uncharacterized protein LOC104803677 isoform X2 [Tarenaya 
hassleriana]
Length=231

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEEF RI+EKAK+  +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  78   LCPVECVREFKTDEEFQRILEKAKEASSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  137

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIR  357
            APV+FLKHNV+DEYDEQSEVAERLRI+
Sbjct  138  APVIFLKHNVIDEYDEQSEVAERLRIK  164



>ref|XP_006578025.1| PREDICTED: thioredoxin-like 4, chloroplastic-like isoform X2 
[Glycine max]
Length=202

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TDEEFS+I++KAK+TG+LVVVDF+RTSCGSCKYIEQGF KLCK SGD E
Sbjct  87   LCPVECVREFTTDEEFSKILDKAKETGSLVVVDFFRTSCGSCKYIEQGFAKLCKKSGDHE  146

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIR  357
            APV+FLKHNV+DEYDEQSEVA+RLRIR
Sbjct  147  APVIFLKHNVMDEYDEQSEVADRLRIR  173



>gb|KDO84169.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
Length=201

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 91/106 (86%), Gaps = 3/106 (3%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIR---SVPLFHFYKNGVLLEA  309
            APV+FLKHNV+DEYDEQSEVAERL+I+   S  LF  +   +L+ +
Sbjct  151  APVIFLKHNVIDEYDEQSEVAERLKIKVNFSFVLFLTFNEFILMAS  196



>ref|XP_006434771.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48011.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
Length=204

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 91/106 (86%), Gaps = 3/106 (3%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIR---SVPLFHFYKNGVLLEA  309
            APV+FLKHNV+DEYDEQSEVAERL+I+   S  LF  +   +L+ +
Sbjct  151  APVIFLKHNVIDEYDEQSEVAERLKIKVNFSFVLFLTFNEFILMAS  196



>gb|KDO84170.1| hypothetical protein CISIN_1g0278901mg, partial [Citrus sinensis]
 gb|KDO84171.1| hypothetical protein CISIN_1g0278901mg, partial [Citrus sinensis]
Length=177

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIR  357
            APV+FLKHNV+DEYDEQSEVAERL+I+
Sbjct  151  APVIFLKHNVIDEYDEQSEVAERLKIK  177



>gb|KCW66422.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
 gb|KCW66423.1| hypothetical protein EUGRSUZ_F00226 [Eucalyptus grandis]
Length=184

 Score =   158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF TDEEF RI+ KAK+T ALVVVDFYRTSCGSCKYIEQGF KLCKG+GD+E
Sbjct  94   LCPVDCVREFKTDEEFLRILGKAKETNALVVVDFYRTSCGSCKYIEQGFAKLCKGAGDQE  153

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIR  357
            A V+FLKHNV+DEYDEQSEVAERLRIR
Sbjct  154  ASVIFLKHNVIDEYDEQSEVAERLRIR  180



>ref|XP_010943061.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X3 [Elaeis 
guineensis]
Length=184

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD E
Sbjct  94   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDRE  153

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIR  357
            A VVFLKHNV+DEYDEQSEVAE+LRI+
Sbjct  154  ADVVFLKHNVIDEYDEQSEVAEQLRIK  180



>ref|XP_008777945.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X3 [Phoenix 
dactylifera]
Length=181

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRS  354
              VVFLKHNV+DEYDEQSEVAE+LRI++
Sbjct  151  GDVVFLKHNVIDEYDEQSEVAEQLRIKA  178



>ref|NP_973780.1| thioredoxin family protein [Arabidopsis thaliana]
 gb|AEE28163.1| thioredoxin family protein [Arabidopsis thaliana]
Length=171

 Score =   155 bits (392),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECV EF TD+E   ++EK+K+T +LVVVDFYRT+CGSCKYIEQGF KLCK SGD+E
Sbjct  81   LCPVECVTEFKTDDELLSVLEKSKETNSLVVVDFYRTACGSCKYIEQGFSKLCKQSGDQE  140

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPL  345
            APV+FLKHNV+DEYDEQSEVAERLRI+ +PL
Sbjct  141  APVIFLKHNVVDEYDEQSEVAERLRIKVIPL  171



>ref|XP_008777943.1| PREDICTED: thioredoxin-like 4, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=196

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPV+CVREF T+EEF RI++KAK+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVDCVREFKTEEEFRRILDKAKETGSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIR  357
              VVFLKHNV+DEYDEQSEVAE+LRI+
Sbjct  151  GDVVFLKHNVIDEYDEQSEVAEQLRIK  177



>ref|XP_002879039.1| thioredoxin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55298.1| thioredoxin family protein [Arabidopsis lyrata subsp. lyrata]
Length=169

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 6/118 (5%)
 Frame = -2

Query  710  CAVXSSRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKAKQTGAL  531
            C     R  S++ +NV EL +   D      LCPVECV EF TD+E  R++EK+K+T +L
Sbjct  58   CTFQHGRAKSLSQENVVELSDENDD------LCPVECVTEFKTDDELLRVLEKSKETNSL  111

Query  530  VVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIR  357
            VVVDFYRT+CGSC YIEQGF K+CK SGD+EAPV+FLKHNV+DEYDEQSEVAERLRI+
Sbjct  112  VVVDFYRTACGSCTYIEQGFSKVCKQSGDQEAPVIFLKHNVVDEYDEQSEVAERLRIK  169



>ref|XP_006434767.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 ref|XP_006434770.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 ref|XP_006434772.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48007.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48010.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48012.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|KDO84172.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
 gb|KDO84173.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
 gb|KDO84174.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
 gb|KDO84175.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
Length=170

 Score =   134 bits (336),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  150

Query  437  APVVFLKHNVLDEYD  393
            APV+FLKHN L E++
Sbjct  151  APVIFLKHNGLSEFN  165



>ref|XP_006434769.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|ESR48009.1| hypothetical protein CICLE_v10002686mg [Citrus clementina]
 gb|KDO84177.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
Length=163

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  150

Query  437  APVVFLKHNV  408
            APV+FLKHNV
Sbjct  151  APVIFLKHNV  160



>gb|KDO84176.1| hypothetical protein CISIN_1g0278901mg [Citrus sinensis]
Length=163

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECVREF TD EF +I+EK+K+TG+LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+E
Sbjct  91   LCPVECVREFKTDAEFFKILEKSKETGSLVVVDFYRTSCGSCKYIEQGFSKLCKGSGDQE  150

Query  437  APVVFLKHN  411
            APV+FLKHN
Sbjct  151  APVIFLKHN  159



>ref|XP_006374941.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
 gb|ERP52738.1| hypothetical protein POPTR_0014s02920g [Populus trichocarpa]
Length=201

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 78/107 (73%), Gaps = 6/107 (6%)
 Frame = -2

Query  728  NVEKQICAVXSSRIWSVNNDNVDELFNgggdeddddELCPVECVREFNTDEEFSRIMEKA  549
            N  K   A    RI +V ++N  EL +   D      LCPV+CVREF TDEEF RI+EKA
Sbjct  84   NFPKNNVASRPGRIKAVVDENPGELSDEDDD------LCPVDCVREFKTDEEFLRILEKA  137

Query  548  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            K+T +LVVVDFYRTSCGSCKYIEQGF KLCKGSGD+EA V FLKHNV
Sbjct  138  KETDSLVVVDFYRTSCGSCKYIEQGFAKLCKGSGDQEAAVTFLKHNV  184



>gb|EMS47929.1| Thioredoxin-like 4, chloroplastic [Triticum urartu]
Length=144

 Score =   122 bits (307),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -2

Query  614  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEA  435
            CPVECV EF TDEEFSR +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSGD  +
Sbjct  64   CPVECVTEFKTDEEFSRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSGDHGS  123

Query  434  PVVFLKHNV  408
            PV+FLKHNV
Sbjct  124  PVIFLKHNV  132



>dbj|BAJ87532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=170

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -2

Query  614  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEA  435
            CPVECV EF TDEEFSR +E+++ TGALVVVDF+R SCGSCKYIEQGF+KLCKGSGD  +
Sbjct  76   CPVECVTEFKTDEEFSRFLERSRATGALVVVDFFRPSCGSCKYIEQGFMKLCKGSGDHGS  135

Query  434  PVVFLKHNV  408
            PV+FLKHNV
Sbjct  136  PVIFLKHNV  144



>ref|XP_006413424.1| hypothetical protein EUTSA_v10026224mg [Eutrema salsugineum]
 gb|ESQ54877.1| hypothetical protein EUTSA_v10026224mg [Eutrema salsugineum]
Length=168

 Score =   120 bits (301),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            +CPVECV EF TD+E  R++EKAK+T +LVVVDFYR SCGSCKYIEQGF KLCK SGD+E
Sbjct  86   VCPVECVTEFKTDDELLRVLEKAKETNSLVVVDFYRPSCGSCKYIEQGFSKLCKQSGDQE  145

Query  437  APVVFLKHNV  408
            APV+FLKHNV
Sbjct  146  APVIFLKHNV  155



>ref|XP_005647696.1| hypothetical protein COCSUDRAFT_15621 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23152.1| hypothetical protein COCSUDRAFT_15621 [Coccomyxa subellipsoidea 
C-169]
Length=106

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -2

Query  530  VVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRSV  351
            VVVDF++T+CGSC+YI+ GF+KLC+ S +  +PV+FL+HN+ DEY+E SE++++ +I++V
Sbjct  8    VVVDFFKTACGSCRYIQPGFIKLCRASVERHSPVMFLRHNIFDEYEELSELSDKFKIKAV  67

Query  350  PLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQD  240
            PLF+F+K G ++E F TR++ RI  AI  ++G    D
Sbjct  68   PLFYFFKGGQVVEKFATRERRRIAKAINTHAGYEVLD  104



>gb|AAF75085.1|AC007583_21 It contains thioredoxin domain PF|00085. EST gb|AI999448 comes 
from this gene [Arabidopsis thaliana]
Length=231

 Score =   117 bits (292),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 75/122 (61%), Gaps = 38/122 (31%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            LCPVECV EF TD+E   ++EK+K+T +LVVV                            
Sbjct  146  LCPVECVTEFKTDDELLSVLEKSKETNSLVVV----------------------------  177

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
                      +DEYDEQSEVAERLRI++VPLFHFYKNGVLLE+F TRDKERI +AILKY+
Sbjct  178  ----------VDEYDEQSEVAERLRIKAVPLFHFYKNGVLLESFATRDKERIDAAILKYT  227

Query  257  GS  252
             S
Sbjct  228  SS  229



>gb|KIY93685.1| hypothetical protein MNEG_14276 [Monoraphidium neglectum]
Length=129

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 74/110 (67%), Gaps = 2/110 (2%)
 Frame = -2

Query  584  TDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVL  405
            T EE   I E A    ALVVVD+Y+T C +CKY+  GF ++C+ + +    ++F+KHNV 
Sbjct  9    TKEELDAIFESA-LPDALVVVDWYKTDCPACKYMAPGFHRMCRSASEHAQHIIFVKHNVY  67

Query  404  DEYDEQSEVAERLRIRSVPLFHFY-KNGVLLEAFPTRDKERILSAILKYS  258
            DE  E + +A   +I++VPLF F+  NG L+E+F TRDK R+++A+ K++
Sbjct  68   DEDYELTPLARHHKIKNVPLFTFHLNNGELVESFATRDKARLIAAVDKHA  117



>gb|KHN22321.1| Thioredoxin-like 4, chloroplastic [Glycine soja]
Length=59

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -2

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQD  240
            +DEYDEQSEVA+RLRIR+VPLFHFYK+GVLLEAFPTRDK+RI++AILKYS    +D
Sbjct  1    MDEYDEQSEVADRLRIRAVPLFHFYKDGVLLEAFPTRDKDRIVAAILKYSSLERED  56



>emb|CDY57282.1| BnaC06g41190D [Brassica napus]
Length=68

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  476  GFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPT  300
            GF KLCK SGD+EAPV+FLKHNV+DEYDEQSEVAERLRI+SV LFHFYK     +  P 
Sbjct  8    GFSKLCKQSGDQEAPVIFLKHNVIDEYDEQSEVAERLRIKSVSLFHFYKKWSSQQHLPN  66



>ref|XP_002888177.1| hypothetical protein ARALYDRAFT_338394 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64436.1| hypothetical protein ARALYDRAFT_338394 [Arabidopsis lyrata subsp. 
lyrata]
Length=100

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  479  QGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIR  357
            QGF KLCK SGD+EAPV+FLKHNV+DEYDEQSEVAERLRI+
Sbjct  51   QGFSKLCKQSGDQEAPVIFLKHNVVDEYDEQSEVAERLRIK  91



>gb|ACG42177.1| thioredoxin H-type [Zea mays]
 tpg|DAA42515.1| TPA: thioredoxin H-type [Zea mays]
Length=120

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 61/113 (54%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T  +F   M KAK+ G LV++DF  + CG C++I   FV+  K         VFLK +V
Sbjct  12   HTKADFDAHMAKAKEAGKLVIIDFTASWCGPCRFIAPLFVEHAKKFTQ----AVFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE  EVA    + ++P FHF KNGV +E      KE +L+ I K+  ++
Sbjct  68   ----DELKEVAAAYDVEAMPTFHFVKNGVTVETVVGARKENLLAQIEKHCAAA  116



>ref|XP_002461568.1| hypothetical protein SORBIDRAFT_02g004850 [Sorghum bicolor]
 gb|EER98089.1| hypothetical protein SORBIDRAFT_02g004850 [Sorghum bicolor]
Length=118

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 61/113 (54%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T  EF   M KAK+ G LVV+DF  + CG C+ I   FV+  K    +    VFLK +V
Sbjct  12   HTKAEFDAQMAKAKEAGKLVVIDFTASWCGPCRAIAPLFVEHAK----KYTQAVFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE  EV    +I ++P FHF KNG  +E      K+ +L+ I K++ S+
Sbjct  68   ----DELKEVTAEYKIEAMPTFHFIKNGETVETIVGARKDELLALIQKHTASA  116



>ref|NP_001147192.1| thioredoxin H-type [Zea mays]
 gb|ACG26004.1| thioredoxin H-type [Zea mays]
Length=122

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T  +F   M KAK+ G LV++DF  + CG C++I   FV+  K    +    VFLK +V
Sbjct  12   HTKADFDAHMAKAKEAGKLVIIDFTASWCGPCRFIAPLFVEHAK----KFTQAVFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                DE  EVA    + ++P FHF KNGV +E      KE +L+ I K+
Sbjct  68   ----DELKEVAAAYDVEAMPTFHFVKNGVTVETVVGARKENLLAQIEKH  112



>ref|XP_005642754.1| hypothetical protein COCSUDRAFT_45478 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18210.1| hypothetical protein COCSUDRAFT_45478 [Coccomyxa subellipsoidea 
C-169]
Length=196

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 65/120 (54%), Gaps = 2/120 (2%)
 Frame = -2

Query  614  CPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEA  435
            C VEC+ E  +     R+++ A  +  +V   FY  SCG+CK + + +  +C+ +  ++A
Sbjct  56   CSVECITELRSLRHLDRVIDSAASSVVVVA--FYSRSCGTCKEMLKHYAAMCRDANGQQA  113

Query  434  PVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSG  255
             V FLKHN+ D++D+ ++VA    +R+VP F F+  G  +      D  +   A+ +  G
Sbjct  114  GVRFLKHNIRDDFDDLTDVAALYGVRAVPCFVFFVGGAQMRRVSMMDSRQNPEAVRRLMG  173



>gb|KDO84167.1| hypothetical protein CISIN_1g0278902mg, partial [Citrus sinensis]
 gb|KDO84168.1| hypothetical protein CISIN_1g0278902mg, partial [Citrus sinensis]
Length=40

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -2

Query  356  SVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQD  240
            +VPLFHFYKNG L+EAFPTRDKERI +AILKY+ ++  D
Sbjct  1    TVPLFHFYKNGALVEAFPTRDKERIDAAILKYTSTTSND  39



>ref|NP_001091381.1| uncharacterized protein LOC100037235 [Xenopus laevis]
 gb|AAI29795.1| LOC100037235 protein [Xenopus laevis]
Length=105

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 61/110 (55%), Gaps = 10/110 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VR   T EEF  ++++AK+   LVVVDF  T CG CK I   F KL   + D    VVFL
Sbjct  2    VRHVETLEEFQNVLQEAKEK--LVVVDFTATWCGPCKMIAPVFEKLSVENPD----VVFL  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            K +V    D+  +VA    ++ +P FHFYKNG+ +  F   ++  ++  +
Sbjct  56   KVDV----DDAQDVAAHCEVKCMPTFHFYKNGLKVFEFSGANESSLVQKV  101



>ref|XP_007563716.1| PREDICTED: thioredoxin-like [Poecilia formosa]
Length=108

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 63/110 (57%), Gaps = 8/110 (7%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V+   T EEF+ I+  A     LVVVDF  T CG C+ I   F K  +   ++   V+FL
Sbjct  2    VKFVKTLEEFNDILSTA--GNKLVVVDFTATWCGPCRMIGPVFEKQAEDPANKH--VIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            K +V    DE S+V+++  IRS+P FHFYKNG  ++ F   +++ ++  I
Sbjct  58   KVDV----DEASDVSQKCEIRSMPTFHFYKNGKKVDEFTGANEKLLMEKI  103



>ref|XP_003557458.1| PREDICTED: thioredoxin H1-like [Brachypodium distachyon]
Length=118

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 61/113 (54%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T  +F   M K K+TG LV++DF  + CG C+ I   FV+  K    +    +FLK +V
Sbjct  12   HTKADFDAQMAKGKETGKLVIIDFTASWCGPCRTIAPVFVEYAK----KFPGAIFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE  EVAE  ++ ++P F FYK G  ++      K+ I + I+  +GS+
Sbjct  68   ----DELKEVAEAYKVEAMPTFLFYKGGEKVDTVVGARKDDIQTKIVALTGSA  116



>gb|AEM42995.1| thioredoxin H [Siraitia grosvenorii]
Length=121

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (54%), Gaps = 8/110 (7%)
 Frame = -2

Query  575  EFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEY  396
            E+   +EK K++G L+VVDF  + CG C+ I   F +L K + +    V+FLK +V    
Sbjct  15   EWKEQIEKGKESGKLIVVDFTASWCGPCRAIAPLFTELAKNNPN----VIFLKVDV----  66

Query  395  DEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSP  246
            DE + VA    I ++P F F K G +L      DK  + S + +Y  S+P
Sbjct  67   DELNTVASEWEINAMPTFVFLKEGKVLHKIVGADKVGLASKLEEYKNSAP  116



>ref|XP_005837151.1| hypothetical protein GUITHDRAFT_85403 [Guillardia theta CCMP2712]
 gb|EKX50171.1| hypothetical protein GUITHDRAFT_85403 [Guillardia theta CCMP2712]
Length=152

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 60/115 (52%), Gaps = 12/115 (10%)
 Frame = -2

Query  590  FNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAP-VVFLKH  414
             NT +EF   ++ A     LVV+DF+ T CG CK I   F +L      E+ P VVF K 
Sbjct  6    LNTRKEFDDCLKSAGSK--LVVIDFFATWCGPCKIISPFFHEL-----SEKYPHVVFAKV  58

Query  413  NVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
            +V    D+  E A+   I ++P F FYKNG L+       KE +L  I ++SG S
Sbjct  59   DV----DQNEETAQSCGISAMPTFQFYKNGNLVHTMRGASKEGLLQGIQEHSGDS  109



>ref|XP_003447583.1| PREDICTED: thioredoxin-like [Oreochromis niloticus]
Length=107

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 59/106 (56%), Gaps = 8/106 (8%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VR+    EEF++I+ +A  +  LVVVDF  T CG C+ I   + ++   +  E A V+FL
Sbjct  2    VRQVKNLEEFNKILSEAGNS--LVVVDFTATWCGPCRMIAPVYEQM--AAAPENANVIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERI  282
            K +V    D   +V+    IRS+P F FYKNG  +  F   D+ ++
Sbjct  58   KVDV----DAARDVSSSCGIRSMPTFQFYKNGQKVHEFSGADQAKL  99



>dbj|BAK38716.1| thioredoxin [Oplegnathus fasciatus]
Length=108

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 59/110 (54%), Gaps = 8/110 (7%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VRE    +EF  I+++A     LVVVDF  T CG CK I   F +L K    E   V+FL
Sbjct  2    VREVENLDEFKAILKEAGDR--LVVVDFTATWCGPCKMIGPEFERLSKLP--ENKNVIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            K +V    DE S+V+E  +I  +P FHFYKN   +  F   +K+ +   +
Sbjct  58   KVDV----DEASDVSEHCKISCMPTFHFYKNEAKVSEFSGANKDTLAEKV  103



>ref|XP_005537392.1| similar to thioredoxin f [Cyanidioschyzon merolae strain 10D]
 dbj|BAM81356.1| similar to thioredoxin f [Cyanidioschyzon merolae strain 10D]
Length=191

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 58/116 (50%), Gaps = 7/116 (6%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEE  438
            L P   VRE ++ EE  RI+ +A     L+VVD+  T CG CK +E           +E 
Sbjct  79   LRPRMAVREVDSQEEMERILSEAGNK--LIVVDYGTTWCGPCKLMEPKMESWS----EEY  132

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
              VVFLK  V D+  E S + +   IRSVP FHFYKNG  +        E IL  I
Sbjct  133  TDVVFLK-VVGDKSKETSMMMKAAGIRSVPSFHFYKNGDRVLTINGAKAEEILRGI  187



>pdb|2YOI|A Chain A, Crystal Structure Of Ancestral Thioredoxin Relative 
To Last Eukaryotes Common Ancestor (leca) From The Precambrian 
Period
 pdb|2YOI|B Chain B, Crystal Structure Of Ancestral Thioredoxin Relative 
To Last Eukaryotes Common Ancestor (leca) From The Precambrian 
Period
Length=106

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 64/114 (56%), Gaps = 10/114 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V +    EEF  I+ +A +   LVVVDF+ T CG CK I   F +L +   D+   VVF+
Sbjct  2    VIQVTNKEEFEAILSEADK---LVVVDFFATWCGPCKMIAPFFEELSEEYPDK---VVFI  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            K +V    DE  +VA +  I S+P F F+KNG  ++     ++E++   ILK++
Sbjct  56   KVDV----DEVPDVAAKYGITSMPTFKFFKNGKKVDELVGANQEKLKQMILKHA  105



>ref|XP_011397516.1| Thioredoxin H-type [Auxenochlorella protothecoides]
 gb|KFM24628.1| Thioredoxin H-type [Auxenochlorella protothecoides]
Length=117

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 62/110 (56%), Gaps = 8/110 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            N+  E+ +++ +AK +G  V+VDF+ T CG C+ I   F +L     D    VVF+K +V
Sbjct  10   NSKAEWDQVLNEAKNSGKAVIVDFFATWCGPCRLISPYFQELSSNYDD----VVFVKLDV  65

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
                D+  EVA+ L I ++P F  +++G  ++      K+++ S + KYS
Sbjct  66   ----DQVEEVAQALGITAMPTFQVFQSGEKVDELIGASKDKLKSLVEKYS  111



>ref|XP_001509068.1| PREDICTED: thioredoxin-like isoform X1 [Ornithorhynchus anatinus]
Length=105

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 10/110 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V++  T EEF   ++ A   G LVVVDF  T CG CK I+  F  L +   D    VVFL
Sbjct  2    VKQIQTKEEFEAELKNA--GGKLVVVDFSATWCGPCKMIKPFFHSLSEKDPD----VVFL  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            + +V    D+  +VA +  ++ +P F FYKNG  +  F   +KE++ + I
Sbjct  56   EVDV----DDCQDVASQCEVKCMPTFQFYKNGKKVSEFSGANKEKLEATI  101



>ref|XP_005944628.1| PREDICTED: thioredoxin-like [Haplochromis burtoni]
Length=107

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (53%), Gaps = 8/110 (7%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VR+     EF+ I+++A     LVVVDF  T CG C+ I   + K+   +  E A V+FL
Sbjct  2    VRQVKNLVEFNNILKEAGNK--LVVVDFTATWCGPCQRIAPVYEKM--AAAPENANVIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            K +V    D   +V+    IRS+P F FYKNG  L  F   D+  +L  +
Sbjct  58   KVDV----DAAHDVSSSCGIRSMPTFQFYKNGQKLHEFSGADQATLLKKV  103



>pdb|2J23|A Chain A, Cross-Reactivity And Crystal Structure Of Malassezia 
Sympodialis Thioredoxin (Mala S 13), A Member Of A New Pan- 
Allergen Family
 pdb|2J23|B Chain B, Cross-Reactivity And Crystal Structure Of Malassezia 
Sympodialis Thioredoxin (Mala S 13), A Member Of A New Pan- 
Allergen Family
Length=121

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 68/121 (56%), Gaps = 12/121 (10%)
 Frame = -2

Query  617  LCPVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLC-KGSGDE  441
            L P   V+  ++ ++F ++    K    +VV+DF+ T CG CK I   F K+    +GD+
Sbjct  11   LVPRGSVQVISSYDQFKQVTGGDK----VVVIDFWATWCGPCKMIGPVFEKISDTPAGDK  66

Query  440  EAPVVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
               V F K +V    DEQS++A+ + IR++P F F+KNG  ++     D  ++ +AI ++
Sbjct  67   ---VGFYKVDV----DEQSQIAQEVGIRAMPTFVFFKNGQKIDTVVGADPSKLQAAITQH  119

Query  260  S  258
            S
Sbjct  120  S  120



>ref|XP_006657515.1| PREDICTED: thioredoxin H1-like [Oryza brachyantha]
Length=121

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 61/113 (54%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T EEF   M+KAK  G +V++DF  + CG C++I   F +  K    +     FLK +V
Sbjct  12   HTKEEFDAQMDKAKAAGKVVIIDFTASWCGPCRFIAPVFAEYAK----KYPGAFFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE  EVAE+  + ++P F F K+G   +      K+ + + I+K+ G++
Sbjct  68   ----DELKEVAEKYNVEAMPTFLFIKDGAEADKVIGARKDDLQNTIVKHVGAT  116



>ref|XP_005844786.1| hypothetical protein CHLNCDRAFT_138664 [Chlorella variabilis]
 gb|EFN52684.1| hypothetical protein CHLNCDRAFT_138664 [Chlorella variabilis]
Length=165

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -2

Query  542  TGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLR  363
             G LVV+  Y  SCG CK + +    +C+ S  + A +VFL+H++ D +D  S+VA   +
Sbjct  44   AGQLVVLTVYSRSCGICKDVLRELEAVCRESRQQRARIVFLRHDMQDAWDWPSDVARYYK  103

Query  362  IRSVPLFHFYKNGVLL  315
            +RS P F F+ +G LL
Sbjct  104  LRSAPRFLFFVDGALL  119



>ref|XP_003447577.1| PREDICTED: thioredoxin-like [Oreochromis niloticus]
Length=107

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 58/106 (55%), Gaps = 8/106 (8%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VR+    EEF++I+ +A     LVVVDF  T CG C+ I   + K+   S  E A V+FL
Sbjct  2    VRQVKDLEEFNKILREAGDK--LVVVDFTATWCGPCRMIAPVYEKMAAES--ENANVIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERI  282
            K +V    D   +V+    IRS+P F FYKNG  +  F   D+ ++
Sbjct  58   KVDV----DAARDVSSSCGIRSMPTFQFYKNGQKVHEFSGADQAKL  99



>ref|NP_001085522.1| MGC80314 protein [Xenopus laevis]
 gb|AAH72884.1| MGC80314 protein [Xenopus laevis]
Length=105

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 58/110 (53%), Gaps = 10/110 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VR     EEF  ++++A   G LVVVDF  T CG CK I   F KL   + D     VFL
Sbjct  2    VRHIENLEEFQLVLKEA--GGKLVVVDFTATWCGPCKMIAPVFEKLSVDNPD----AVFL  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            K +V    D+  +VA    ++ +P F FYKNG+ ++ F   ++  ++  +
Sbjct  56   KVDV----DDAQDVAAHCDVKCMPTFQFYKNGIKVDEFSGANQSSLIQKV  101



>gb|KFP55656.1| Thioredoxin, partial [Cathartes aura]
Length=96

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (57%), Gaps = 8/90 (9%)
 Frame = -2

Query  539  GALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRI  360
            G LVVVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    +
Sbjct  11   GKLVVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDV  62

Query  359  RSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            + +P F FYKNG  ++ F   +KE++   I
Sbjct  63   KCMPTFQFYKNGKKVQEFSGANKEKLEETI  92



>gb|KFO84041.1| Thioredoxin, partial [Buceros rhinoceros silvestris]
Length=96

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (57%), Gaps = 8/90 (9%)
 Frame = -2

Query  539  GALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRI  360
            G LVVVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    +
Sbjct  11   GKLVVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDV  62

Query  359  RSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            + +P F FYKNG  ++ F   +KE++   I
Sbjct  63   KCMPTFQFYKNGKKVQEFSGANKEKLEETI  92



>ref|XP_008426203.1| PREDICTED: thioredoxin-like [Poecilia reticulata]
Length=108

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V+   T EEF++I+ +A     LVVVDF  T C  C+ I   F KL + S +++  V+FL
Sbjct  2    VKFVKTLEEFNKILGEA--GNKLVVVDFTATWCPPCQMIGPVFEKLAEDSANKD--VIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            K +V    D+ S+V++   I+++P F FYKNG  ++ F   DK ++   I
Sbjct  58   KVDV----DDASDVSQSCGIKAMPTFQFYKNGKKVDEFCGADKNKLGKKI  103



>ref|XP_010304587.1| PREDICTED: thioredoxin, partial [Balearica regulorum gibbericeps]
Length=97

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (57%), Gaps = 8/90 (9%)
 Frame = -2

Query  539  GALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRI  360
            G LVVVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    +
Sbjct  12   GKLVVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVAAHCDV  63

Query  359  RSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            + +P F FYKNG  ++ F   +KE++   I
Sbjct  64   KCMPTFQFYKNGKKVQEFSGANKEKLEETI  93



>gb|KFO12770.1| Thioredoxin, partial [Balearica regulorum gibbericeps]
Length=96

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (57%), Gaps = 8/90 (9%)
 Frame = -2

Query  539  GALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRI  360
            G LVVVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    +
Sbjct  11   GKLVVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVAAHCDV  62

Query  359  RSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            + +P F FYKNG  ++ F   +KE++   I
Sbjct  63   KCMPTFQFYKNGKKVQEFSGANKEKLEETI  92



>ref|XP_010141764.1| PREDICTED: thioredoxin, partial [Buceros rhinoceros silvestris]
Length=105

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 51/90 (57%), Gaps = 8/90 (9%)
 Frame = -2

Query  539  GALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRI  360
            G LVVVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    +
Sbjct  20   GKLVVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDV  71

Query  359  RSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            + +P F FYKNG  ++ F   +KE++   I
Sbjct  72   KCMPTFQFYKNGKKVQEFSGANKEKLEETI  101



>ref|XP_009038965.1| hypothetical protein AURANDRAFT_29236, partial [Aureococcus anophagefferens]
 gb|EGB06389.1| hypothetical protein AURANDRAFT_29236, partial [Aureococcus anophagefferens]
Length=125

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 49/93 (53%), Gaps = 8/93 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIM-EKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVF  423
            VRE     EF +++   A+ TG  VVVDFY  SCG C+ I   F KL     D     VF
Sbjct  19   VRELKNLAEFDKLLAHHAENTGLPVVVDFYSDSCGPCRMIAPVFKKLAAEYKDR---AVF  75

Query  422  LKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNG  324
             K NV    D    V+ + +IRS+P FHFY +G
Sbjct  76   AKVNVAHARD----VSAKAQIRSMPTFHFYADG  104



>ref|XP_008627424.1| PREDICTED: thioredoxin [Corvus brachyrhynchos]
Length=128

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 61/110 (55%), Gaps = 10/110 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            +RE  + +EF   ++ A +   L+VVDF  T CG CK I+  F  LC+  GD    VVF+
Sbjct  25   LREVESIDEFEAELKSAGEK--LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFI  78

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            + +V    D+  +VA    ++ +P F FYKNG  ++ F   +KE++   I
Sbjct  79   EIDV----DDAQDVASHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETI  124



>ref|XP_006809689.1| PREDICTED: thioredoxin-like [Neolamprologus brichardi]
Length=107

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 58/112 (52%), Gaps = 8/112 (7%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VRE    EEF  I+++A     LVVVDF  T CG CK I   F ++   + D+   V+FL
Sbjct  2    VREVKNLEEFQSILKEAGDK--LVVVDFTATWCGPCKQIAPVFAQM--AADDDNKNVIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILK  264
            K +V    DE  +V+    I  +P FHFYK    ++ F   + E +   ++K
Sbjct  58   KVDV----DEAEDVSSSCGINCMPTFHFYKKNQKIDEFSGANVETLKDKVMK  105



>ref|NP_001059069.1| Os07g0186000 [Oryza sativa Japonica Group]
 sp|Q0D840.1|TRXH1_ORYSJ RecName: Full=Thioredoxin H1; Short=OsTrxh1; AltName: Full=Phloem 
sap 13 kDa protein 1 [Oryza sativa Japonica Group]
 sp|A2YIW7.1|TRXH_ORYSI RecName: Full=Thioredoxin H-type; Short=Trx-H; AltName: Full=Phloem 
sap 13 kDa protein 1 [Oryza sativa Indica Group]
 dbj|BAA04864.1| thioredoxin h [Oryza sativa Japonica Group]
 dbj|BAA05546.1| thioredoxin h [Oryza sativa Japonica Group]
 gb|AAB51522.1| thioredoxin h [Oryza sativa Indica Group]
 dbj|BAC79928.1| Thioredoxin H-type (TRX-H) [Oryza sativa Japonica Group]
 dbj|BAD30186.1| Thioredoxin H-type (TRX-H) [Oryza sativa Japonica Group]
 dbj|BAF20983.1| Os07g0186000 [Oryza sativa Japonica Group]
 gb|EAZ03028.1| hypothetical protein OsI_25169 [Oryza sativa Indica Group]
 gb|EAZ38949.1| hypothetical protein OsJ_23370 [Oryza sativa Japonica Group]
 dbj|BAG86917.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00481.1| unnamed protein product [Oryza sativa Japonica Group]
Length=122

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 61/114 (54%), Gaps = 8/114 (7%)
 Frame = -2

Query  578  EEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDE  399
            +EF   M KAK+ G +V++DF  + CG C++I   F +  K    +    VFLK +V   
Sbjct  15   DEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAK----KFPGAVFLKVDV---  67

Query  398  YDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQDA  237
             DE  EVAE+  + ++P F F K+G   +      K+ + + I+K+ G++   A
Sbjct  68   -DELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAASA  120



>ref|XP_007563715.1| PREDICTED: thioredoxin-like [Poecilia formosa]
Length=107

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VRE     +F  I+++A     LVVVDF  T CG CK I   FVKL +   ++E  VVFL
Sbjct  2    VREVKDLADFESILKEA--GNKLVVVDFTATWCGPCKQIGPEFVKLSELPENKE--VVFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGV  321
            K +V    DE  +V+   +I  +P FHFYKNG 
Sbjct  58   KVDV----DEAEDVSSHCKISCMPTFHFYKNGT  86



>ref|XP_004574216.1| PREDICTED: thioredoxin-like isoform X2 [Maylandia zebra]
Length=107

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (53%), Gaps = 8/110 (7%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VR+     EF+ I+++A     LVVVDF  T CG C+ I   + K+   +  E A V+FL
Sbjct  2    VRQVKNLVEFNNILKEAGNK--LVVVDFTATWCGPCQRIAPVYEKM--AAAPENANVIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            K +V    D   +V+    IRS+P F FYKNG  L  F   D+  +L  +
Sbjct  58   KVDV----DAARDVSSSCGIRSMPTFQFYKNGQKLHEFSGADEALLLKKV  103



>pdb|1WMJ|A Chain A, Solution Structure Of Thioredoxin Type H From Oryza 
Sativa
Length=130

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 61/114 (54%), Gaps = 8/114 (7%)
 Frame = -2

Query  578  EEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDE  399
            +EF   M KAK+ G +V++DF  + CG C++I   F +  K    +    VFLK +V   
Sbjct  23   DEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAK----KFPGAVFLKVDV---  75

Query  398  YDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSSPQDA  237
             DE  EVAE+  + ++P F F K+G   +      K+ + + I+K+ G++   A
Sbjct  76   -DELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAASA  128



>ref|XP_005020456.1| PREDICTED: thioredoxin [Anas platyrhynchos]
Length=150

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            LVVVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  67   LVVVDFSATWCGPCKMIKPFFHSLCEKFGD----VVFIEIDV----DDAQDVATHCEVKC  118

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG +++ F   +KE++   I
Sbjct  119  MPTFQFYKNGKMVQEFSGANKEKLEETI  146



>ref|NP_001105811.1| thioredoxin h homolog2 [Zea mays]
 emb|CAI64401.1| thioredoxin h2 protein [Zea mays]
 gb|ACG30821.1| thioredoxin H-type [Zea mays]
Length=122

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 56/109 (51%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            ++  EF   M KA++ G LVV+DF    CG C+ I   FV+  K    +   VVFLK +V
Sbjct  12   HSKAEFDAHMTKAQEAGKLVVIDFTAAWCGPCRAIAPLFVEHAK----KFTQVVFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                DE  EV     + ++P FHF KNG  +       K+ +L+ I K+
Sbjct  68   ----DEVKEVTAAYEVEAMPTFHFVKNGKTVATIVGAKKDELLALIEKH  112



>gb|ACQ58191.1| Thioredoxin [Anoplopoma fimbria]
 gb|ACQ58532.1| Thioredoxin [Anoplopoma fimbria]
Length=108

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 59/111 (53%), Gaps = 8/111 (7%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            + +  T  EF +I+  A     LVVVDF  T CG CK I   F +  +    E   V+F+
Sbjct  2    IDDVKTLAEFKKILADAGD--KLVVVDFTATWCGPCKMISPVFQQ--EDGKPENKNVIFV  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAIL  267
            K +V    DE  EV++   I  +P FHFYKNG+ ++ F   +K+ +L  ++
Sbjct  58   KVDV----DEADEVSKDCGISCMPTFHFYKNGIKVDEFSGANKDTLLEKLV  104



>ref|XP_002595942.1| hypothetical protein BRAFLDRAFT_268611 [Branchiostoma floridae]
 gb|EEN51954.1| hypothetical protein BRAFLDRAFT_268611 [Branchiostoma floridae]
Length=106

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 48/92 (52%), Gaps = 10/92 (11%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VRE NT  EF  ++  A+    LVVVDF+   C  C+ +   F +L   + D    V+F 
Sbjct  2    VREINTKAEFDALL--AESNDKLVVVDFWAQWCAPCRAMAPVFEELANENPD----VIFA  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNG  324
            K NV        E A+   IRS+P FHFYKNG
Sbjct  56   KVNV----SVNMETAQAADIRSIPAFHFYKNG  83



>gb|ACF81437.1| unknown [Zea mays]
 gb|ACG24455.1| thioredoxin H-type [Zea mays]
 gb|ACG24458.1| thioredoxin H-type [Zea mays]
 gb|ACG25599.1| thioredoxin H-type [Zea mays]
 gb|ACG27374.1| thioredoxin H-type [Zea mays]
 gb|ACG30519.1| thioredoxin H-type [Zea mays]
 gb|ACG30879.1| thioredoxin H-type [Zea mays]
 gb|ACG31237.1| thioredoxin H-type [Zea mays]
 gb|ACG45885.1| thioredoxin H-type [Zea mays]
 tpg|DAA59856.1| TPA: thioredoxin H-type [Zea mays]
Length=122

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 56/109 (51%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            ++  EF   M KA++ G LVV+DF    CG C+ I   FV+  K    +   VVFLK +V
Sbjct  12   HSKAEFDAHMTKAQEAGKLVVIDFTAAWCGPCRAIAPLFVEHAK----KFTQVVFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                DE  EV     + ++P FHF KNG  +       K+ +L+ I K+
Sbjct  68   ----DEVKEVTAAYEVEAMPTFHFVKNGKTVATIVGARKDELLAQIEKH  112



>ref|XP_008281601.1| PREDICTED: thioredoxin [Stegastes partitus]
Length=107

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 61/110 (55%), Gaps = 12/110 (11%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V E  +  +F++ +++A     LVVVDF  T CG CK I   FVKL      E A VVFL
Sbjct  2    VHEVESMADFNKCLQEAGDK--LVVVDFTATWCGPCKQIGPEFVKL--AGLPENANVVFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAF----PTRDKERI  282
            K +V    DE  +V+ +  I+ +P F+FYKNG  ++ F    P   KE++
Sbjct  58   KVDV----DEAEDVSAQCGIKCMPTFYFYKNGKKVDEFSGANPQTLKEKV  103



>gb|ACG30866.1| thioredoxin H-type [Zea mays]
Length=122

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 56/109 (51%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            ++  EF   M KA++ G LVV+DF    CG C+ I   FV+  K    +   VVFLK +V
Sbjct  12   HSKAEFDAHMTKAQEAGKLVVIDFTAAWCGPCRAIAPLFVEHAK----KFTQVVFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                DE  EV     + ++P FHF KNG  +       K+ +L+ I K+
Sbjct  68   ----DEVKEVTAXYEVEAMPTFHFVKNGKTVATIVGARKDELLAQIEKH  112



>ref|XP_009488383.1| PREDICTED: thioredoxin [Pelecanus crispus]
Length=120

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 10/107 (9%)
 Frame = -2

Query  590  FNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHN  411
            FN   EF   ++ A +   L+VVDF  T CG CK I+  F  LC+  G+    VVF++ +
Sbjct  20   FNNSSEFEAELKSAGEK--LIVVDFSATWCGPCKMIKPFFHSLCEKYGN----VVFIEID  73

Query  410  VLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            V    D+  +VA    ++ +P F FYKNG  ++ F   +KE++   I
Sbjct  74   V----DDAQDVAAHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETI  116



>ref|XP_003447575.1| PREDICTED: thioredoxin-like [Oreochromis niloticus]
Length=107

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 52/98 (53%), Gaps = 8/98 (8%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VRE    EEF  I+++A     LVVVDF  T CG CK I   F ++   + DE   V+FL
Sbjct  2    VREVKNLEEFQSILKEAGDK--LVVVDFTATWCGPCKQIAPLFAQM--AADDENKNVIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAF  306
            K +V    DE  +V+    I  +P FHFYKN   +  F
Sbjct  58   KVDV----DEAEDVSSSCGINCMPTFHFYKNNQKVHEF  91



>ref|XP_002180660.1| thioredoxin h [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48068.1| thioredoxin h [Phaeodactylum tricornutum CCAP 1055/1]
Length=105

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 62/112 (55%), Gaps = 10/112 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V+   + ++F+ ++E +K    LVVVDF  T CG CKYI   F KL + + D E    F+
Sbjct  2    VKHLESMDDFNTMLETSKTK--LVVVDFTATWCGPCKYIGPIFEKLAEENPDIE----FV  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILK  264
            K +V    DE  +VA    +R++P F F++NG  +E     D+ ++ + + K
Sbjct  56   KVDV----DEADDVAAHCGVRAMPTFQFFRNGEKIEEMMGADQNKLAALVAK  103



>ref|XP_009505960.1| PREDICTED: thioredoxin [Phalacrocorax carbo]
Length=110

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 10/108 (9%)
 Frame = -2

Query  593  EFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKH  414
            E  T  EF   ++ A +   LVVVDF  T CG CK I+  F  LC+  GD    VVF++ 
Sbjct  9    EKGTKSEFEAELKSAGEK--LVVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEI  62

Query  413  NVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +V    D+  +VA    ++ +P F FYKNG  ++ F   +KE++   I
Sbjct  63   DV----DDAQDVATHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETI  106



>gb|ACG29437.1| thioredoxin H-type [Zea mays]
 gb|ACG30675.1| thioredoxin H-type [Zea mays]
 gb|ACG30910.1| thioredoxin H-type [Zea mays]
 gb|ACG31003.1| thioredoxin H-type [Zea mays]
 gb|ACG31596.1| thioredoxin H-type [Zea mays]
 gb|ACG45880.1| thioredoxin H-type [Zea mays]
Length=122

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 56/109 (51%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            ++  EF   M KA++ G LVV+DF    CG C+ I   FV+  K    +   VVFLK +V
Sbjct  12   HSKAEFDAHMTKAQEAGKLVVIDFTAAWCGPCRAIAPLFVEHAK----KFTQVVFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                DE  EV     + ++P FHF KNG  +       K+ +L+ I K+
Sbjct  68   ----DEVKEVTAAYEVEAMPTFHFVKNGKTVATIVGARKDELLALIEKH  112



>ref|XP_002863443.1| hypothetical protein ARALYDRAFT_916860 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39702.1| hypothetical protein ARALYDRAFT_916860 [Arabidopsis lyrata subsp. 
lyrata]
Length=54

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -2

Query  437  APVVFLKHNVLDEYDEQSEVAERLRIRSVPL  345
            APV+FLKHNV+DEYDEQSEVAERLRI+ +PL
Sbjct  24   APVIFLKHNVVDEYDEQSEVAERLRIKVIPL  54



>ref|XP_010179037.1| PREDICTED: thioredoxin, partial [Mesitornis unicolor]
Length=97

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            LVVVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  14   LVVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVAAHCDVKC  65

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  66   MPTFQFYKNGKKVQEFSGANKEKLEETI  93



>ref|NP_001123670.1| uncharacterized protein LOC100170420 [Xenopus (Silurana) tropicalis]
 gb|AAI66957.1| LOC100170420 protein [Xenopus (Silurana) tropicalis]
Length=105

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 58/110 (53%), Gaps = 10/110 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VR   + +EF  I+++A     LVVVDF  T CG CK I   F KL   + D    VVF+
Sbjct  2    VRHVESLDEFQNILKEAGDK--LVVVDFTATWCGPCKMISPVFEKLSVENPD----VVFI  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            K +V    D+  +VA    ++ +P FHFYKNG  +  F   ++  ++  +
Sbjct  56   KVDV----DDAQDVAAHCDVKCMPTFHFYKNGQKVHEFSGANQASLIQKV  101



>emb|CCU98198.1| allergen [Malassezia sympodialis ATCC 42132]
Length=107

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 8/93 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLC-KGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIR  357
            +VV+DF+ T CG CK I   F K+    +GD+   V F K +V    DEQS++A+ + IR
Sbjct  21   VVVIDFWATWCGPCKMIGPVFEKISDTPAGDK---VGFYKVDV----DEQSQIAQEVGIR  73

Query  356  SVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            ++P F F+KNG  ++     D  ++ +AI ++S
Sbjct  74   AMPTFVFFKNGQKIDTVVGADPSKLQAAITQHS  106



>emb|CAI78451.1| thioredoxin, partial [Malassezia sympodialis]
Length=105

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 8/93 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLC-KGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIR  357
            +VV+DF+ T CG CK I   F K+    +GD+   V F K +V    DEQS++A+ + IR
Sbjct  19   VVVIDFWATWCGPCKMIGPVFEKISDTPAGDK---VGFYKVDV----DEQSQIAQEVGIR  71

Query  356  SVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            ++P F F+KNG  ++     D  ++ +AI ++S
Sbjct  72   AMPTFVFFKNGQKIDTVVGADPSKLQAAITQHS  104



>gb|KFQ32124.1| Thioredoxin, partial [Mesitornis unicolor]
Length=96

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            LVVVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  13   LVVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVAAHCDVKC  64

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  65   MPTFQFYKNGKKVQEFSGANKEKLEETI  92



>gb|AAU93947.1| thioredoxin H [Helicosporidium sp. ex Simulium jonesi]
Length=112

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 60/117 (51%), Gaps = 8/117 (7%)
 Frame = -2

Query  602  CVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVF  423
             V +     EF   +  A   G LVVVDF  T CG CK I   F KL   SG E   VVF
Sbjct  4    AVIQVTNKTEFDSHLSTAASKGKLVVVDFTATWCGPCKMIAPFFAKL---SG-EYPDVVF  59

Query  422  LKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGS  252
            LK +V    DE   VA    I ++P F F+K+G  +++    ++ER+ + + +++ S
Sbjct  60   LKVDV----DEVEAVAAEHGITAMPTFLFFKDGKQVDSLTGANQERLRAMLTQHAQS  112



>ref|XP_009409351.1| PREDICTED: thioredoxin-like 2, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=212

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 11/97 (11%)
 Frame = -2

Query  593  EFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKH  414
            + ++ EEF   + +A     LVVV+FY T CGSC+ +   F KLCK + +E   ++FLK 
Sbjct  85   DIHSTEEFLDALSQAGDR--LVVVEFYGTWCGSCRAL---FPKLCK-TAEEHPDILFLKV  138

Query  413  NVLDEYDEQSEVAERLRIRSVPLFHFYKNG-VLLEAF  306
            N    +DE   + +RL +R +P FHFY+    LL++F
Sbjct  139  N----FDENKPMCKRLNVRVLPYFHFYRGADGLLQSF  171



>ref|NP_001268482.1| thioredoxin [Melopsittacus undulatus]
 gb|AAO72714.1| thioredoxin 1 [Melopsittacus undulatus]
Length=105

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 58/110 (53%), Gaps = 10/110 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V+      EF   ++ A +   LVVVDF  T CG CK I+  F  LC+  GD    VVF+
Sbjct  2    VKSVGCLSEFKAELQSAGEN--LVVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFI  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            + +V    D+  +VA    ++ +P F FYKNG  ++ F   +KE++   I
Sbjct  56   EIDV----DDAQDVAAHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETI  101



>ref|XP_005807281.1| PREDICTED: thioredoxin-like [Xiphophorus maculatus]
Length=108

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (56%), Gaps = 8/99 (8%)
 Frame = -2

Query  578  EEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDE  399
            EEF+ I+ +A     LVVVDF  + CG CK I   F  L     +E   V+F K +V   
Sbjct  9    EEFNNILSQAGNK--LVVVDFTASWCGPCKMIGPVFENLAADPANEN--VIFFKVDV---  61

Query  398  YDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERI  282
             DE S+VA    IR++P F FYK+  +++ F   DK+++
Sbjct  62   -DEASDVAGNCGIRAMPTFQFYKDRKMVDEFSGADKKKL  99



>ref|XP_005807280.1| PREDICTED: thioredoxin-like [Xiphophorus maculatus]
Length=107

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 51/92 (55%), Gaps = 8/92 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VRE     +F  I++ A     LVVVDF  T CG CK I   FV L + +  E   VVFL
Sbjct  2    VREVKDLADFESILKGAGNK--LVVVDFTATWCGPCKQIGPQFVALSEQA--ENKDVVFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNG  324
            K +V    DE  +V+ + +I  +P FHFYKNG
Sbjct  58   KVDV----DEAEDVSSQCKISCMPTFHFYKNG  85



>gb|KFW92622.1| Thioredoxin, partial [Phalacrocorax carbo]
Length=96

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            LVVVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  13   LVVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDVKC  64

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  65   MPTFQFYKNGKKVQEFSGANKEKLEETI  92



>ref|XP_006118910.1| PREDICTED: thioredoxin-like [Pelodiscus sinensis]
Length=105

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 56/106 (53%), Gaps = 10/106 (9%)
 Frame = -2

Query  578  EEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDE  399
            EEF  +++ A     LVVVDF  T CG CK I+  F  LC+   D    VVFL+ +V   
Sbjct  9    EEFQTLLKCAGDK--LVVVDFSATWCGPCKMIKPFFHSLCEKYPD----VVFLEVDV---  59

Query  398  YDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
             D+  +VA    ++ +P FHFYK G  +  F   +KE++   I  +
Sbjct  60   -DDAQDVASHCGVQCMPTFHFYKQGAKVHEFSGANKEKLEENITTF  104



>ref|XP_005530816.1| PREDICTED: thioredoxin [Pseudopodoces humilis]
Length=105

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 9/97 (9%)
 Frame = -2

Query  557  EKAKQTG-ALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSE  381
            E+ K  G  L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +
Sbjct  13   EELKSAGEKLIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQD  64

Query  380  VAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            VA    ++ +P F FYKNG  ++ F   +KE++   I
Sbjct  65   VASHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETI  101



>ref|XP_001695633.1| thioredoxin-like protein [Chlamydomonas reinhardtii]
 gb|EDP01420.1| thioredoxin-like protein [Chlamydomonas reinhardtii]
Length=215

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 56/104 (54%), Gaps = 2/104 (2%)
 Frame = -2

Query  593  EFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKH  414
            E    +EF  + E A  +  LVV+  YR SCGSCK     F +L + +   +A V F++H
Sbjct  79   EVRDADEFDALCEHANNS--LVVMFMYRPSCGSCKDAALRFEQLREEANRTQARVAFVRH  136

Query  413  NVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERI  282
            NV  +Y + S+++    +R+VP F F+  G ++     RD  R+
Sbjct  137  NVETDYGDTSDLSRIHSVRAVPAFLFFDGGAMVRRLSLRDIRRL  180



>gb|KFQ52792.1| Thioredoxin, partial [Nestor notabilis]
Length=96

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  13   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVAAHCDVKC  64

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  65   MPTFQFYKNGKKVQEFSGANKEKLEETI  92



>ref|XP_010399629.1| PREDICTED: thioredoxin [Corvus cornix cornix]
Length=98

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  15   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVASHCDVKC  66

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  67   MPTFQFYKNGKKVQEFSGANKEKLEETI  94



>ref|XP_009817975.1| PREDICTED: thioredoxin, partial [Gavia stellata]
Length=97

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  14   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEVDV----DDAQDVATHCDVKC  65

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  66   MPTFQFYKNGKKVQEFSGANKEKLEETI  93



>gb|KFO55691.1| Thioredoxin, partial [Corvus brachyrhynchos]
Length=97

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  14   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVASHCDVKC  65

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  66   MPTFQFYKNGKKVQEFSGANKEKLEETI  93



>ref|XP_004574213.1| PREDICTED: thioredoxin-like isoform X1 [Maylandia zebra]
Length=109

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 8/92 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VRE    EEF  I+++A     LVVVDF  T CG CK I   F ++   + D+   V+FL
Sbjct  2    VREVKNLEEFQSILKEAGDK--LVVVDFTATWCGPCKQIAPLFAQM--AADDDNKNVIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNG  324
            K +V    DE  +V+    I  +P FHFYKN 
Sbjct  58   KVDV----DEAEDVSSSCGISCMPTFHFYKNN  85



>ref|XP_004574214.1| PREDICTED: thioredoxin-like isoform X2 [Maylandia zebra]
 ref|XP_005750520.1| PREDICTED: thioredoxin-like [Pundamilia nyererei]
 ref|XP_005944630.1| PREDICTED: thioredoxin-like [Haplochromis burtoni]
Length=107

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 52/98 (53%), Gaps = 8/98 (8%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VRE    EEF  I+++A     LVVVDF  T CG CK I   F ++   + D+   V+FL
Sbjct  2    VREVKNLEEFQSILKEAGDK--LVVVDFTATWCGPCKQIAPLFAQM--AADDDNKNVIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAF  306
            K +V    DE  +V+    I  +P FHFYKN   +  F
Sbjct  58   KVDV----DEAEDVSSSCGISCMPTFHFYKNNQKVHEF  91



>ref|XP_009571594.1| PREDICTED: thioredoxin, partial [Fulmarus glacialis]
Length=97

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  14   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDVKC  65

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  66   MPTFQFYKNGKKVQEFSGANKEKLEETI  93



>gb|KFM12228.1| Thioredoxin, partial [Aptenodytes forsteri]
 gb|KFQ86502.1| Thioredoxin, partial [Phoenicopterus ruber ruber]
 gb|KFW00817.1| Thioredoxin, partial [Fulmarus glacialis]
 gb|KFW70566.1| Thioredoxin, partial [Pygoscelis adeliae]
Length=96

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  13   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDVKC  64

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  65   MPTFQFYKNGKKVQEFSGANKEKLEETI  92



>gb|KFV60183.1| Thioredoxin, partial [Gavia stellata]
Length=96

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  13   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEVDV----DDAQDVATHCDVKC  64

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  65   MPTFQFYKNGKKVQEFSGANKEKLEETI  92



>ref|XP_008426201.1| PREDICTED: thioredoxin-like [Poecilia reticulata]
Length=107

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 8/92 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VRE     +F  I+++A     LVVVDF  T CG CK I   F+KL +   ++E  VVFL
Sbjct  2    VREVKDLADFESILKEA--GNKLVVVDFTATWCGPCKQIAPEFIKLSEVPENKE--VVFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNG  324
            K +V    DE  +V+ + +I  +P F FYKNG
Sbjct  58   KVDV----DEAEDVSSQCKISCMPTFQFYKNG  85



>ref|XP_003557457.1| PREDICTED: thioredoxin H1-like [Brachypodium distachyon]
Length=118

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 58/113 (51%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +  +EF   M KAK+ G LV++DF    CG C+ I   F +  K    +    +FLK +V
Sbjct  12   HNKQEFDTHMAKAKEIGKLVIIDFTAVWCGPCRIIAPVFAEYAK----KFPGAIFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE  EVAE  +I ++P F F K+G  +       K+ I + I+ Y+ ++
Sbjct  68   ----DELKEVAEEYKIEAMPTFLFIKDGEKVHTVVGGKKDEIEAKIVAYTATA  116



>ref|XP_010016344.1| PREDICTED: thioredoxin [Nestor notabilis]
Length=115

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  32   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVAAHCDVKC  83

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  84   MPTFQFYKNGKKVQEFSGANKEKLEETI  111



>gb|KFP66023.1| Thioredoxin, partial [Cariama cristata]
Length=96

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+V+DF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  13   LIVIDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDVKC  64

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  65   MPTFQFYKNGKKVQEFSGANKEKLEETI  92



>ref|XP_009095010.1| PREDICTED: thioredoxin [Serinus canaria]
Length=105

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  22   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVASHCDVKC  73

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  74   MPTFQFYKNGKKVQEFSGANKEKLEETI  101



>ref|NP_990784.1| thioredoxin [Gallus gallus]
 sp|P08629.2|THIO_CHICK RecName: Full=Thioredoxin; Short=Trx [Gallus gallus]
 gb|AAA49092.1| thioredoxin [Gallus gallus]
Length=105

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 49/88 (56%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            LVVVDF  T CG CK I+  F  LC   GD    VVF++ +V    D+  +VA    ++ 
Sbjct  22   LVVVDFSATWCGPCKMIKPFFHSLCDKFGD----VVFIEIDV----DDAQDVATHCDVKC  73

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  74   MPTFQFYKNGKKVQEFSGANKEKLEETI  101



>ref|XP_009700412.1| PREDICTED: thioredoxin, partial [Cariama cristata]
Length=97

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+V+DF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  14   LIVIDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDVKC  65

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  66   MPTFQFYKNGKKVQEFSGANKEKLEETI  93



>ref|XP_002461569.1| hypothetical protein SORBIDRAFT_02g004860 [Sorghum bicolor]
 gb|EER98090.1| hypothetical protein SORBIDRAFT_02g004860 [Sorghum bicolor]
Length=113

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T+EEF   M++A + G LV++DF  T C  C    Q    + K   ++    VFL+ + 
Sbjct  12   HTNEEFDAQMDEAYEAGKLVIIDFMTTWCPFC----QEIAPVYKEYANKYPAAVFLEVDA  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                +E  +VA++  I S P F F +NG  LE+F   D E++   I KY
Sbjct  68   ----EELEDVAKKYNIHSFPTFFFIRNGETLESFVGADPEKLEETINKY  112



>ref|XP_009327272.1| PREDICTED: thioredoxin [Pygoscelis adeliae]
Length=104

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  21   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDVKC  72

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  73   MPTFQFYKNGKKVQEFSGANKEKLEETI  100



>ref|XP_003213740.2| PREDICTED: LOW QUALITY PROTEIN: thioredoxin [Meleagris gallopavo]
Length=112

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 10/107 (9%)
 Frame = -2

Query  590  FNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHN  411
            F+   EF   ++ A +   LVVVDF  T CG CK I+  F  LC   GD    VVF++ +
Sbjct  12   FSLXSEFEAELKSAGEK--LVVVDFSATWCGPCKMIKPFFHSLCDKFGD----VVFIEID  65

Query  410  VLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            V    D+  +VA    ++ +P F FYKNG  ++ F   +KE++   I
Sbjct  66   V----DDAQDVATHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETI  108



>gb|KGL75115.1| Thioredoxin, partial [Tinamus guttatus]
Length=96

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = -2

Query  539  GALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRI  360
            G LVVVDF  T CG CK I+  F  LC+   D    V+F++ +V    D+  +VA    +
Sbjct  11   GKLVVVDFSATWCGPCKMIKPFFHSLCEKFAD----VIFIEIDV----DDAQDVAAHCDV  62

Query  359  RSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            + +P F FYKNG  ++ F   +KE++   I
Sbjct  63   KCMPTFQFYKNGKKVQEFSGANKEKLEETI  92



>gb|AEC03316.1| thioredoxin H-type 2 [Hevea brasiliensis]
Length=118

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 62/113 (55%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T E ++  ++KA Q+  LVVVDF  + CG C++I    V+L K   +    V+FLK +V
Sbjct  12   HTVELWNENLQKANQSKKLVVVDFTASWCGPCRFISPFLVELAKKLPN----VIFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE   VA+   + ++P F F + G +L+     +K+++   I K+  ++
Sbjct  68   ----DELKTVAQDWAVEAMPTFIFLREGTILDKVVGANKDKLHETIAKHMATA  116



>emb|CCQ38253.1| thioredoxin H-type protein, partial [Schiedea jacobii]
Length=130

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 66/113 (58%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T ++++  ++ AK++  LVVVDF  + CG C+ I   FV  C     +   V+FLK +V
Sbjct  4    HTVQQWTHNLDIAKESKKLVVVDFTASWCGPCRTIAP-FVDEC---AKKYPNVLFLKVDV  59

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE+ E+AE+  I+++P F F  +G  ++     DK  I +AILK+S ++
Sbjct  60   ----DEREEIAEQWGIQAMPSFIFLIDGQEVQRIIGTDKTTITTAILKHSTTT  108



>pdb|2YPM|A Chain A, Crystal Structure Of Ancestral Thioredoxin Relative 
To Last Animal And Fungi Common Ancestor (lafca) From The Precambrian 
Period
Length=106

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 62/117 (53%), Gaps = 14/117 (12%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAP--VV  426
            V +    +EF  I+ +A +   LVVVDF  T CG CK I   F +L      EE P  VV
Sbjct  2    VIQVTNKDEFESILSEADK---LVVVDFTATWCGPCKMIAPKFEELS-----EEYPDNVV  53

Query  425  FLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSG  255
            FLK +V    DE  +VA    I ++P F F+KNG  ++     ++E++ + I K++ 
Sbjct  54   FLKVDV----DEVEDVAAEYGISAMPTFQFFKNGKKVDELTGANQEKLKAMIKKHAA  106



>emb|CCQ38247.1| thioredoxin H-type protein, partial [Schiedea haleakalensis]
 emb|CCQ38248.1| thioredoxin H-type protein, partial [Schiedea salicaria]
 emb|CCQ38249.1| thioredoxin H-type protein, partial [Schiedea adamantis]
 emb|CCQ38250.1| thioredoxin H-type protein, partial [Schiedea lydgatei]
Length=130

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 66/113 (58%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T ++++  ++ AK++  LVVVDF  + CG C+ I   FV  C     +   V+FLK +V
Sbjct  4    HTVQQWTHHLDIAKESKKLVVVDFTASWCGPCRTIAP-FVDEC---AKKYPNVLFLKVDV  59

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE+ E+AE+  I+++P F F  +G  ++     DK  I +AILK+S ++
Sbjct  60   ----DEREEIAEQWGIQAMPSFIFLIDGQEVQRIIGTDKTTITTAILKHSTTT  108



>ref|XP_005494692.1| PREDICTED: thioredoxin [Zonotrichia albicollis]
Length=105

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    V+F++ +V    D+  +VA    ++ 
Sbjct  22   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VIFIEIDV----DDAQDVASHCDVKC  73

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  74   MPTFQFYKNGEKVQEFSGANKEKLEETI  101



>ref|XP_002117789.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV19765.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=107

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 57/110 (52%), Gaps = 8/110 (7%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V+   T E F + +  AK    LVV DF+ T C  CK I   F K+ +   DE   VVF 
Sbjct  2    VQVIETKEAFDKFLSDAKDK--LVVFDFFATWCQPCKLIGPIFEKMSES--DEYKDVVFA  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            K +V    DE  E AE + IR++P F FYKNG  ++      ++R+ S I
Sbjct  58   KIDV----DENEETAEFVGIRAMPTFAFYKNGSKIDEVSGAAEDRLRSKI  103



>gb|AAR83852.1| thioredoxin [Capsicum annuum]
 gb|ABN42904.1| thioredoxin H-type [Capsicum annuum]
Length=124

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 59/109 (54%), Gaps = 8/109 (7%)
 Frame = -2

Query  578  EEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDE  399
            EE+ +  +K  +T  LVVVDF  + CG C++I      + K    +   V+FLK +V   
Sbjct  18   EEWDQHFKKGVETKKLVVVDFTASWCGPCRFIAPILADIAK----KMPHVIFLKVDV---  70

Query  398  YDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGS  252
             DE   VAE   + ++P F F+K+G  ++      KE + +AILK+ G+
Sbjct  71   -DELKTVAEEWNVDAMPTFVFFKDGEEVDRVVGAQKEELQAAILKHVGA  118



>gb|AAL67139.1| thioredoxin H [Triticum aestivum]
 gb|ACE82288.1| thioredoxin H [Triticum aestivum]
 gb|AEO78951.1| thioredoxin h [Triticum aestivum]
 gb|AEO78952.1| thioredoxin h [Triticum aestivum]
Length=118

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 58/113 (51%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T +EF   M   K+TG LV++DF  + CG C+ I   F +  K    +    +FLK +V
Sbjct  12   HTKQEFDTHMANGKETGKLVIIDFTASWCGPCRVIAPVFAEYAK----KFPGAIFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE  +VAE   + ++P F F K+G  ++      K+ I + I+   GS+
Sbjct  68   ----DELKDVAEAYNVEAMPTFLFIKDGAKVDTVVGGRKDDIHTKIVALMGSA  116



>ref|XP_006281332.1| hypothetical protein CARUB_v10027387mg [Capsella rubella]
 gb|EOA14230.1| hypothetical protein CARUB_v10027387mg [Capsella rubella]
Length=119

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = -2

Query  578  EEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDE  399
            EE++  ++ A  +  L+V+DF  T C  C++I   F +L K   D    VVF K +V   
Sbjct  14   EEWNEKLKTASDSKKLIVIDFTATWCPPCRFIAPIFAELAKKHLD----VVFFKVDV---  66

Query  398  YDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGS  252
             DE + VA+   ++++P F F K GV+++      KE I+S + K++ +
Sbjct  67   -DELNSVAKDFDVQAMPTFIFMKEGVVVDTVVGAAKEEIVSKLEKHTAT  114



>emb|CCQ38251.1| thioredoxin H-type protein, partial [Schiedea mannii]
 emb|CCQ38252.1| thioredoxin H-type protein, partial [Schiedea ligustrina]
Length=135

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T ++++  ++ AK++  LVVVDF  + CG C+ I   FV  C     +   V+FLK +V
Sbjct  4    HTVQQWTHHLDIAKESKKLVVVDFTASWCGPCRTIAP-FVDEC---AKKYPNVLFLKVDV  59

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
                DE+ E+AE+  I+++P F F  +G  ++     DK  I +AILK+S
Sbjct  60   ----DERKEIAEKWDIQAMPSFIFLIDGQEVQRIIGTDKTAITTAILKHS  105



>ref|XP_009872080.1| PREDICTED: thioredoxin, partial [Apaloderma vittatum]
 gb|KFP91000.1| Thioredoxin, partial [Apaloderma vittatum]
Length=97

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 49/88 (56%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            LVVVDF  T CG CK I+  F  LC+  GD    V F++ +V    D+  +VA    ++ 
Sbjct  14   LVVVDFSATWCGPCKMIKPFFHSLCEKYGD----VTFIEIDV----DDAQDVATHCDVKC  65

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  66   MPTFQFYKNGKKVQEFSGANKEKLEETI  93



>ref|XP_002510456.1| Thioredoxin H-type, putative [Ricinus communis]
 gb|EEF52643.1| Thioredoxin H-type, putative [Ricinus communis]
Length=118

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 57/110 (52%), Gaps = 8/110 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T E ++  +EK ++T  L+VVDF  + CG C++I     ++ K   +    V FLK +V
Sbjct  11   HTVEAWTEQLEKGQETKKLIVVDFTASWCGPCRFIAPILAEMAKKMPN----VTFLKVDV  66

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
                DE   VAE   + ++P F F K G ++      +KE +   I KY+
Sbjct  67   ----DELKSVAEDWAVEAMPTFMFLKEGKIVHKVVGANKEELQMTIAKYA  112



>emb|CBJ28369.1| similar to thioredoxin-like protein, partial [Ectocarpus siliculosus]
Length=106

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 53/102 (52%), Gaps = 10/102 (10%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T E  S  +  A     LVVVDF+ T CG CK I    VKL +   D    VVFLK +V
Sbjct  7    DTPEALSTALTGAGS--KLVVVDFHATWCGPCKRIAPFLVKLSETLTD----VVFLKVDV  60

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERI  282
                DE S+ +E+  I ++P F F KNG ++E     D+  I
Sbjct  61   ----DENSDASEKYGIEAMPTFKFIKNGEVVETVTGADEASI  98



>ref|NP_035790.1| thioredoxin [Mus musculus]
 sp|P10639.3|THIO_MOUSE RecName: Full=Thioredoxin; Short=Trx; AltName: Full=ATL-derived 
factor; Short=ADF [Mus musculus]
 emb|CAA54688.1| thioredoxin [Mus musculus]
 dbj|BAA04881.1| thioredoxin [Mus musculus]
 dbj|BAB25096.1| unnamed protein product [Mus musculus]
 gb|AAH10756.1| Thioredoxin 1 [Mus musculus]
 gb|AAH94415.1| Thioredoxin 1 [Mus musculus]
 gb|EDL02237.1| mCG2706 [Mus musculus]
Length=105

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 60/114 (53%), Gaps = 10/114 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V+   + E F   +  A     LVVVDF  T CG CK I+  F  LC    D+ + VVFL
Sbjct  2    VKLIESKEAFQEALAAAGDK--LVVVDFSATWCGPCKMIKPFFHSLC----DKYSNVVFL  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            + +V    D+  +VA    ++ +P F FYK G  +  F   +KE++ ++I +Y+
Sbjct  56   EVDV----DDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA  105



>emb|CCQ38271.1| thioredoxin H-type protein, partial [Schiedea apokremnos]
Length=134

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T ++++  ++ AK++  LVVVDF  + CG C+ I   FV  C     +   V+FLK +V
Sbjct  4    HTVQQWTHHLDIAKESKKLVVVDFTASWCGPCRTIAP-FVDEC---AKKYPNVLFLKVDV  59

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
                DE+ E+AE+  I+++P F F  +G  ++     DK  I +AILK+S
Sbjct  60   ----DEREEIAEQWNIQAMPSFIFLIDGQEVQRVIGTDKTAITTAILKHS  105



>emb|CCQ38258.1| thioredoxin H-type protein, partial [Schiedea sarmentosa]
Length=135

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T ++++  ++ AK++  LVVVDF  + CG C+ I   FV  C     +   V+FLK +V
Sbjct  4    HTVQQWTHHLDIAKESKKLVVVDFTASWCGPCRTIAP-FVDEC---AKKYPNVLFLKVDV  59

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
                DE+ E+AE+  I+++P F F  +G  ++     DK  I +AILK+S
Sbjct  60   ----DERKEIAEQWDIQAMPSFIFLIDGQEVQRIIGTDKTAITTAILKHS  105



>ref|XP_005425401.1| PREDICTED: thioredoxin [Geospiza fortis]
Length=141

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    V+F++ +V    D+  +VA    ++ 
Sbjct  58   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VIFIEIDV----DDAQDVASHCDVKC  109

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  110  MPTFQFYKNGKKVQEFSGANKEKLEETI  137



>ref|XP_007233862.1| PREDICTED: thioredoxin-like [Astyanax mexicanus]
Length=108

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 6/91 (7%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            LVVVDF  T CG CK I   + +L      + + VVFLK +V    D+  +VA    I+ 
Sbjct  23   LVVVDFTATWCGPCKMIAPYYKEL--SDNPQNSNVVFLKVDV----DDAQDVAAHCEIKC  76

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
            +P FHFYKNG  ++ F   ++++++  + K+
Sbjct  77   MPTFHFYKNGKKIDEFSGGNRDKLVEILNKH  107



>ref|XP_006292776.1| hypothetical protein CARUB_v10019026mg [Capsella rubella]
 gb|EOA25674.1| hypothetical protein CARUB_v10019026mg [Capsella rubella]
Length=114

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 56/109 (51%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T E ++  ++KA  +  LVVVDF  T CG C++I   F  L K   +    V+FLK ++
Sbjct  12   HTVESWNEQLQKANDSKTLVVVDFTATWCGPCRFIAPFFADLAKKLPN----VLFLKVDI  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                DE   VA    I ++P F F K G +L+      K+ + S I K+
Sbjct  68   ----DELKSVASDWAIEAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH  112



>pdb|1XWA|A Chain A, Drospohila Thioredoxin, Oxidized, P41212
 pdb|1XWA|B Chain B, Drospohila Thioredoxin, Oxidized, P41212
 pdb|1XWA|C Chain C, Drospohila Thioredoxin, Oxidized, P41212
 pdb|1XWA|D Chain D, Drospohila Thioredoxin, Oxidized, P41212
Length=111

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 48/89 (54%), Gaps = 7/89 (8%)
 Frame = -2

Query  548  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAER  369
            K +G LVV+DF+ T CG CK I    V+L     D    VV LK +V    DE  ++A  
Sbjct  22   KASGKLVVLDFFATWCGPCKMISPKLVELSTQFADN---VVVLKVDV----DECEDIAME  74

Query  368  LRIRSVPLFHFYKNGVLLEAFPTRDKERI  282
              I S+P F F KNGV +E F   + +R+
Sbjct  75   YNISSMPTFVFLKNGVKVEEFAGANAKRL  103



>ref|XP_010442091.1| PREDICTED: thioredoxin H3-like [Camelina sativa]
Length=117

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = -2

Query  578  EEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDE  399
            EE++  ++ A ++  L+V+DF  T C  C++I   F +L K   +    VVF K +V   
Sbjct  14   EEWNEKLKTASESKKLIVIDFTATWCPPCRFIAPIFAELAKKHLN----VVFFKVDV---  66

Query  398  YDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
             DE + VA+   ++++P F F K GV+L+      KE IL+ + K++  +
Sbjct  67   -DELNTVAKDFDVQAMPTFIFMKEGVVLDTVVGAAKEEILAKLEKHTAVA  115



>gb|ABK26043.1| unknown [Picea sitchensis]
Length=145

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 60/117 (51%), Gaps = 8/117 (7%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V   NT +E+   + +A  TG +VVVDF  T CG C  I   + +L +    +   +VFL
Sbjct  31   VHIINTSQEWEAKISEANTTGKIVVVDFSATWCGPCNMIAPFYTELSQ----KHPQLVFL  86

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
            K +V    DE  E++E   ++++P F F KNG  ++     DK  +   +  Y+ ++
Sbjct  87   KVDV----DELRELSETWNVQAMPTFVFIKNGKQIDTLVGADKSELEKKVKSYATAA  139



>dbj|BAB25256.1| unnamed protein product [Mus musculus]
Length=105

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 59/114 (52%), Gaps = 10/114 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V+   + E F   +  A     LVVVDF  T CG CK I+  F  LC    D+ + VVFL
Sbjct  2    VKLIESKEAFQEALAAAGDK--LVVVDFSATWCGPCKMIKPFFHSLC----DKYSNVVFL  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            + +V    D+  +VA    ++ +P F FYK G  +  F   +KE++ + I +Y+
Sbjct  56   EVDV----DDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEACITEYA  105



>ref|XP_008444759.1| PREDICTED: thioredoxin H1-like [Cucumis melo]
Length=122

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 54/106 (51%), Gaps = 8/106 (8%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +   E+  ++ KAK++G LVVVDF  + CG C+ I   F +L K        V+FLK +V
Sbjct  11   HKQSEWDALLAKAKESGKLVVVDFTASWCGPCRTIAPYFSELAK----NHPGVMFLKVDV  66

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
                DE + +A   +I ++P F F K G  L      D+  +L  I
Sbjct  67   ----DELNAIASEWKINAMPTFVFVKGGETLHKIVGADRAALLKKI  108



>ref|XP_010209801.1| PREDICTED: thioredoxin [Tinamus guttatus]
Length=140

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = -2

Query  539  GALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRI  360
            G LVVVDF  T CG CK I+  F  LC+   D    V+F++ +V    D+  +VA    +
Sbjct  55   GKLVVVDFSATWCGPCKMIKPFFHSLCEKFAD----VIFIEIDV----DDAQDVAAHCDV  106

Query  359  RSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            + +P F FYKNG  ++ F   +KE++   I
Sbjct  107  KCMPTFQFYKNGKKVQEFSGANKEKLEETI  136



>gb|KFP93174.1| Thioredoxin, partial [Haliaeetus albicilla]
Length=96

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF    CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  13   LIVVDFSAAWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDVKC  64

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  65   MPTFQFYKNGKKVQEFSGANKEKLEETI  92



>ref|NP_001132192.1| hypothetical protein [Zea mays]
 gb|ACF80943.1| unknown [Zea mays]
 tpg|DAA59858.1| TPA: hypothetical protein ZEAMMB73_591752 [Zea mays]
Length=126

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 56/109 (51%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T +EF   M KAK+ G LVV+DF    C  C+ +   +         +    VFL+ +V
Sbjct  12   HTKDEFDARMAKAKEQGKLVVIDFMAPWCSGCQMMAPVYAD----CASKYPSAVFLEVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                DE  EVA+   +  +P F F +NG  LE+F T D++ +  A+ KY
Sbjct  68   ----DELLEVAKIYGVHVMPTFCFIRNGETLESFATVDEDELRDAVRKY  112



>gb|KFQ65367.1| Thioredoxin, partial [Pelecanus crispus]
Length=96

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  G+    VVF++ +V    D+  +VA    ++ 
Sbjct  13   LIVVDFSATWCGPCKMIKPFFHSLCEKYGN----VVFIEIDV----DDAQDVAAHCDVKC  64

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  65   MPTFQFYKNGKKVQEFSGANKEKLEETI  92



>ref|XP_009284533.1| PREDICTED: thioredoxin H2-1-like [Aptenodytes forsteri]
Length=204

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  121  LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDVKC  172

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  173  MPTFQFYKNGKKVQEFSGANKEKLEETI  200



>ref|NP_523526.1| thioredoxin-2, isoform A [Drosophila melanogaster]
 ref|NP_723475.1| thioredoxin-2, isoform B [Drosophila melanogaster]
 pdb|1XW9|A Chain A, Drosophila Thioredoxin, Oxidized, P21
 pdb|1XW9|B Chain B, Drosophila Thioredoxin, Oxidized, P21
 pdb|1XW9|C Chain C, Drosophila Thioredoxin, Oxidized, P21
 pdb|1XW9|D Chain D, Drosophila Thioredoxin, Oxidized, P21
 pdb|1XWB|A Chain A, Drospohila Thioredoxin, Oxidized, P42212
 pdb|1XWB|B Chain B, Drospohila Thioredoxin, Oxidized, P42212
 pdb|1XWB|C Chain C, Drospohila Thioredoxin, Oxidized, P42212
 pdb|1XWB|D Chain D, Drospohila Thioredoxin, Oxidized, P42212
 pdb|1XWC|A Chain A, Drosophila Thioredoxin, Reduced, P6522
 gb|AAF37263.1|AF220362_1 thioredoxin [Drosophila melanogaster]
 gb|AAN10700.1| thioredoxin-2, isoform A [Drosophila melanogaster]
 gb|AAN10701.1| thioredoxin-2, isoform B [Drosophila melanogaster]
 gb|ADC54215.1| RE24425p [Drosophila melanogaster]
Length=106

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = -2

Query  551  AKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAE  372
             K +G LVV+DF+ T CG CK I    V+L     D    VV LK +V    DE  ++A 
Sbjct  16   TKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADN---VVVLKVDV----DECEDIAM  68

Query  371  RLRIRSVPLFHFYKNGVLLEAFPTRDKERI  282
               I S+P F F KNGV +E F   + +R+
Sbjct  69   EYNISSMPTFVFLKNGVKVEEFAGANAKRL  98



>ref|XP_010292094.1| PREDICTED: thioredoxin, partial [Phaethon lepturus]
Length=97

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  14   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDVKC  65

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYK+G  ++ F   +KE++   I
Sbjct  66   MPTFQFYKSGKKVQEFSGANKEKLEETI  93



>gb|KGL90929.1| Thioredoxin, partial [Charadrius vociferus]
Length=96

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    +  
Sbjct  13   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCEVTC  64

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +K+++   I
Sbjct  65   MPTFQFYKNGKKVQEFSGANKDKLEETI  92



>ref|XP_004574215.1| PREDICTED: thioredoxin-like isoform X1 [Maylandia zebra]
Length=111

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 8/92 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VR+     EF+ I+++A     LVVVDF  T CG C+ I   + K+   +  E A V+FL
Sbjct  2    VRQVKNLVEFNNILKEAGNK--LVVVDFTATWCGPCQRIAPVYEKM--AAAPENANVIFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNG  324
            K +V    D   +V+    IRS+P F FYKNG
Sbjct  58   KVDV----DAARDVSSSCGIRSMPTFQFYKNG  85



>emb|CCQ71730.1| thioredoxin [Channa striata]
Length=108

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 59/112 (53%), Gaps = 8/112 (7%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VR+     +F  ++++A     LVVVDF  T CG C++I   F K+ +    E   VVFL
Sbjct  2    VRQVKDKADFDNLLKEAGD--KLVVVDFTATWCGPCRFIGPIFQKMSEDP--ENKNVVFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILK  264
            K +V    DE  +V+   +I  +P F FYK+G  ++ F   D E++   + K
Sbjct  58   KVDV----DEADDVSSACKITCMPTFQFYKSGEKVDEFSGADAEKLKETLEK  105



>ref|NP_001266774.1| thioredoxin [Zea mays]
 gb|AFJ97110.1| thioredoxin [Zea mays]
Length=126

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 56/109 (51%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T +EF   M KAK+ G LVV+DF    C  C+ +   +         +    VFL+ +V
Sbjct  12   HTKDEFDARMAKAKEEGKLVVIDFMAPWCSGCQMMAPVYAD----CASKYPSAVFLEVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                DE  EVA+   +  +P F F +NG  LE+F T D++ +  A+ KY
Sbjct  68   ----DELLEVAKIYGVHVMPTFCFIRNGETLESFATVDEDELRDAVRKY  112



>gb|KFQ81561.1| Thioredoxin, partial [Phaethon lepturus]
Length=96

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  13   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDVKC  64

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYK+G  ++ F   +KE++   I
Sbjct  65   MPTFQFYKSGKKVQEFSGANKEKLEETI  92



>ref|XP_008444760.1| PREDICTED: thioredoxin H-type 1 [Cucumis melo]
Length=123

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 50/89 (56%), Gaps = 8/89 (9%)
 Frame = -2

Query  590  FNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHN  411
             ++ EEF  ++ K K+TG L+VVDF  + C  C++I   F +L K        V+FLK +
Sbjct  10   IHSVEEFDALVLKGKETGKLIVVDFTASWCPPCRFIAPVFAELAKTYPH----VIFLKVD  65

Query  410  VLDEYDEQSEVAERLRIRSVPLFHFYKNG  324
            V    DE   +A R ++ ++P F F K+G
Sbjct  66   V----DEVQPIAARFKVEAMPTFAFVKDG  90



>dbj|BAK82164.1| thioredoxin 2 [Sebastes schlegelii]
Length=109

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 57/110 (52%), Gaps = 7/110 (6%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VRE  +  EF  I+ K +    LVVVDF  T CG CK I   F +  + +  E   V+FL
Sbjct  2    VREVTSLAEFQSIL-KEEAGDRLVVVDFTATWCGPCKIIGPIFEQ--QAAKPENKNVLFL  58

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            K +V    DE  +V+    I  +P FHFYKNG  +  F   +K+ +L  +
Sbjct  59   KVDV----DEADDVSSHCGINCMPTFHFYKNGEKVFEFSGANKDTLLEKL  104



>sp|Q9V429.2|THIO2_DROME RecName: Full=Thioredoxin-2; Short=DmTrx-2 [Drosophila melanogaster]
 gb|AAL25497.1| SD03042p [Drosophila melanogaster]
Length=114

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 48/90 (53%), Gaps = 7/90 (8%)
 Frame = -2

Query  551  AKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAE  372
             K +G LVV+DF+ T CG CK I    V+L     D    VV LK +V    DE  ++A 
Sbjct  24   TKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADN---VVVLKVDV----DECEDIAM  76

Query  371  RLRIRSVPLFHFYKNGVLLEAFPTRDKERI  282
               I S+P F F KNGV +E F   + +R+
Sbjct  77   EYNISSMPTFVFLKNGVKVEEFAGANAKRL  106



>gb|AGG17889.1| thioredoxin [Cristaria plicata]
Length=105

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 10/107 (9%)
 Frame = -2

Query  581  DEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLD  402
            + EF+ I++ +     LVVVDF  T CG C+ I   F ++     +E   V+F+K +V  
Sbjct  8    ESEFNSIVKGSGDK--LVVVDFTATWCGPCQRIAPLFAEM----AEEMKDVIFIKVDV--  59

Query  401  EYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
              D+  E A   +I ++P F FYKNG  LE F   D  ++   + K+
Sbjct  60   --DQNEETASACKINAMPTFQFYKNGQKLEEFSGADINKLRQVVAKH  104



>pdb|2VM1|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 1 
Crystallized Using Ammonium Sulfate As Precipitant
 pdb|2VM1|B Chain B, Crystal Structure Of Barley Thioredoxin H Isoform 1 
Crystallized Using Ammonium Sulfate As Precipitant
 pdb|2VM1|C Chain C, Crystal Structure Of Barley Thioredoxin H Isoform 1 
Crystallized Using Ammonium Sulfate As Precipitant
 pdb|2VM1|D Chain D, Crystal Structure Of Barley Thioredoxin H Isoform 1 
Crystallized Using Ammonium Sulfate As Precipitant
 pdb|2VM2|A Chain A, Crystal Structure Of Barley Thioredoxin H Isoform 1 
Crystallized Using Peg As Precipitant
 pdb|2VM2|B Chain B, Crystal Structure Of Barley Thioredoxin H Isoform 1 
Crystallized Using Peg As Precipitant
 pdb|2VM2|C Chain C, Crystal Structure Of Barley Thioredoxin H Isoform 1 
Crystallized Using Peg As Precipitant
 pdb|2VM2|D Chain D, Crystal Structure Of Barley Thioredoxin H Isoform 1 
Crystallized Using Peg As Precipitant
 gb|AAP72290.1| thioredoxin h isoform 1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87029.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04260.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=118

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 58/113 (51%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T +EF   M   K TG LV++DF  + CG C+ I   F +  K    +    +FLK +V
Sbjct  12   HTKQEFDTHMANGKDTGKLVIIDFTASWCGPCRVIAPVFAEYAK----KFPGAIFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE  +VAE   + ++P F F K+G  +++     K+ I + I+   GS+
Sbjct  68   ----DELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVALMGSA  116



>ref|XP_002180517.1| thioredoxin f [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47925.1| thioredoxin f [Phaeodactylum tricornutum CCAP 1055/1]
Length=174

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 53/95 (56%), Gaps = 7/95 (7%)
 Frame = -2

Query  608  VECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPV  429
            +  V +  ++  F + +  A   G+LVVVD+  T CG CK I   F +L +  GD     
Sbjct  62   LSAVVDIGSESAFDQTIASAG--GSLVVVDYSTTWCGPCKVIAPKFEELSEKYGD----A  115

Query  428  VFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNG  324
            VFLK  + D   + S++ +R  +RSVP FH++KNG
Sbjct  116  VFLK-VIGDASPDASKLMKREGVRSVPSFHYFKNG  149



>emb|CCQ38255.1| thioredoxin H-type protein, partial [Schiedea obovata]
Length=137

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T ++++  ++ AK++  LVVVDF  + CG C+ +   FV  C     +   V+FLK +V
Sbjct  4    HTVQQWTHHLDIAKESKKLVVVDFTASWCGPCRTMAP-FVDEC---AKKYPNVLFLKVDV  59

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
                DE+ E+AE+  I+++P F F  +G  ++     DK  I +AILK+S
Sbjct  60   ----DERKEIAEQWDIQAMPSFIFLIDGQEVQRIIGTDKTAITTAILKHS  105



>ref|XP_004335509.1| thioredoxin-1, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR13496.1| thioredoxin-1, putative [Acanthamoeba castellanii str. Neff]
Length=105

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 57/113 (50%), Gaps = 10/113 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V++  + +EF+   E A     LVVVDF+ T CG CK I     K+ +    E   VVFL
Sbjct  2    VKQVTSKDEFNT--ELANAGSKLVVVDFFATWCGPCKRIAPAIEKMSQ----ENTNVVFL  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
            K +V    DE  ++A  L + ++P F F+KNG  +       + +I   I K+
Sbjct  56   KVDV----DEVGDLAAELSVSAMPTFLFFKNGSKVHEVVGASEAKIAEGITKH  104



>gb|KDO17028.1| hypothetical protein SPRG_17331 [Saprolegnia parasitica CBS 223.65]
 gb|KDO23404.1| hypothetical protein SPRG_11496 [Saprolegnia parasitica CBS 223.65]
Length=110

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 8/109 (7%)
 Frame = -2

Query  596  REFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLK  417
            + F ++  F   + + K    L+V+DF  + C  C+YI+  F +      DE     F +
Sbjct  6    KHFASEAAFQAEIAQDKYKDRLIVIDFTASWCPPCQYIKPIFHRY----ADETPDATFFQ  61

Query  416  HNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
             +V    DE  E++E L + ++P F F++NGV +EA    DK+++ + I
Sbjct  62   IDV----DESDELSEALGVSAMPTFQFWRNGVKVEALTGADKDKLKALI  106



>ref|XP_004703244.1| PREDICTED: thioredoxin-like [Echinops telfairi]
Length=105

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (54%), Gaps = 10/114 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V++ ++ E+F   ++ A +   LVVVDF  T CG CK I+  +  LC+  G+    VVFL
Sbjct  2    VKQIDSKEDFQAALKSAGEK--LVVVDFPATWCGPCKMIKPFYHSLCEQYGN----VVFL  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            + +V    DE  +V     ++ +P F FYK    +  F   +KE++ + I K S
Sbjct  56   EVDV----DECQDVVSECEVKCIPTFQFYKKRQKVGEFSGANKEKLEATINKLS  105



>ref|NP_199112.1| thioredoxin H3 [Arabidopsis thaliana]
 sp|Q42403.1|TRXH3_ARATH RecName: Full=Thioredoxin H3; Short=AtTrxh3; AltName: Full=Thioredoxin 
3; Short=AtTRX3 [Arabidopsis thaliana]
 emb|CAA84611.1| thioredoxin [Arabidopsis thaliana]
 gb|AAC49351.1| thioredoxin h [Arabidopsis thaliana]
 dbj|BAB09200.1| thioredoxin (clone GIF1) [Arabidopsis thaliana]
 gb|AAL24352.1| thioredoxin (clone GIF1) [Arabidopsis thaliana]
 gb|AAL38274.1| thioredoxin (clone GIF1) [Arabidopsis thaliana]
 gb|AAM13317.1| thioredoxin [Arabidopsis thaliana]
 gb|AAM47885.1| thioredoxin clone GIF1 [Arabidopsis thaliana]
 gb|AAM61671.1| thioredoxin [Arabidopsis thaliana]
 gb|AED94897.1| thioredoxin H3 [Arabidopsis thaliana]
Length=118

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T E+++  ++ A ++  L+V+DF  T C  C++I   F  L K   D    VVF K +V
Sbjct  11   HTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLD----VVFFKVDV  66

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                DE + VAE  +++++P F F K G + E      KE I++ + K+
Sbjct  67   ----DELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKH  111



>sp|Q6XHI1.1|THIO2_DROYA RecName: Full=Thioredoxin-2; Short=Trx-2 [Drosophila yakuba]
 gb|AAR10225.1| similar to Drosophila melanogaster thioredoxin, partial [Drosophila 
yakuba]
Length=106

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 7/89 (8%)
 Frame = -2

Query  548  KQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAER  369
            K +G LVV+DF+ T CG CK I     +L     D    VV LK +V    DE  ++A  
Sbjct  17   KASGKLVVLDFFATWCGPCKMISPKLAELSTQYADT---VVVLKVDV----DECEDIAME  69

Query  368  LRIRSVPLFHFYKNGVLLEAFPTRDKERI  282
              I S+P F F KNGV +E F   + +R+
Sbjct  70   YNISSMPTFVFLKNGVKVEEFAGANAQRL  98



>ref|XP_008619027.1| hypothetical protein SDRG_14659 [Saprolegnia diclina VS20]
 gb|EQC27607.1| hypothetical protein SDRG_14659 [Saprolegnia diclina VS20]
Length=110

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 8/109 (7%)
 Frame = -2

Query  596  REFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLK  417
            + F ++  F   + + K    L+V+DF  + C  C+YI+  F +      DE     F +
Sbjct  6    KHFASEAAFQAEIAQDKYKDRLIVIDFTASWCPPCQYIKPIFHRY----ADETPDATFFQ  61

Query  416  HNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
             +V    DE  E++E L + ++P F F++NGV +EA    DK+++ + I
Sbjct  62   VDV----DESDELSEALGVSAMPTFQFWRNGVKVEALTGADKDKLKALI  106



>gb|KDN52836.1| thioredoxin [Tilletiaria anomala UBC 951]
Length=107

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/118 (31%), Positives = 60/118 (51%), Gaps = 16/118 (14%)
 Frame = -2

Query  611  PVECVREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAP  432
            P+E ++EF          + A Q   +VV+DF+ T CG CK +   F KL +G+  ++  
Sbjct  5    PLESLKEF----------QDAIQGDKVVVIDFWATWCGPCKMVSPIFEKLSEGAAADK--  52

Query  431  VVFLKHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
            V F K +V    DEQ ++A+ ++++ +P F F+K G  +          +  AI  YS
Sbjct  53   VGFYKVDV----DEQEQIAQEVKVKVMPTFMFFKGGQKIHEIQGARIPELTKAISDYS  106



>gb|KFO81555.1| Thioredoxin, partial [Cuculus canorus]
Length=96

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            LVVVDF  T CG CK I+  F  LC+  G+    VVF++ +V    D+  +VA    ++ 
Sbjct  13   LVVVDFSATWCGPCKMIKPFFYSLCEKYGE----VVFIEIDV----DDAQDVATHCDVKC  64

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYK+G  ++ F   +KE++   I
Sbjct  65   MPTFQFYKSGKKVQEFSGANKEKLEETI  92



>gb|AAV73827.1| thioredoxin [Azumapecten farreri]
Length=108

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 8/94 (9%)
 Frame = -2

Query  545  QTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERL  366
            QT  LVV+DF+   CG CK I     +L K + D    V+F K NV    DE  E A+  
Sbjct  21   QTDKLVVIDFFADWCGPCKQIAPAIEELAKANTD----VIFRKVNV----DENDETAQAC  72

Query  365  RIRSVPLFHFYKNGVLLEAFPTRDKERILSAILK  264
             I ++P F FYK+G  ++     +K +I   I+K
Sbjct  73   EISAMPTFRFYKSGQTVDEVVGANKGKIEEYIVK  106



>ref|XP_010576482.1| PREDICTED: thioredoxin [Haliaeetus leucocephalus]
Length=112

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF    CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    ++ 
Sbjct  29   LIVVDFSAAWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCDVKC  80

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +KE++   I
Sbjct  81   MPTFQFYKNGKKVQEFSGANKEKLEETI  108



>ref|XP_009880427.1| PREDICTED: LOW QUALITY PROTEIN: thioredoxin, partial [Charadrius 
vociferus]
Length=112

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            L+VVDF  T CG CK I+  F  LC+  GD    VVF++ +V    D+  +VA    +  
Sbjct  29   LIVVDFSATWCGPCKMIKPFFHSLCEKYGD----VVFIEIDV----DDAQDVATHCEVTC  80

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYKNG  ++ F   +K+++   I
Sbjct  81   MPTFQFYKNGKKVQEFSGANKDKLEETI  108



>dbj|BAC21264.1| thioredoxin h [Cucurbita maxima]
Length=120

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 8/109 (7%)
 Frame = -2

Query  578  EEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDE  399
            EEF  I++K K++G L+V+DF  + C  C++I   F +L K        V FLK +V   
Sbjct  14   EEFDAIIDKEKESGRLIVIDFTASWCPPCRFIAPVFAELAKA----HVHVTFLKVDV---  66

Query  398  YDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGS  252
             D   E+A+R  + ++P F F K G  +      DK  +   +L+ S +
Sbjct  67   -DNVKEIAKRFEVTAMPTFVFLKGGNEVHRIVGADKVELGVKVLELSAA  114



>ref|NP_190672.1| thioredoxin H1 [Arabidopsis thaliana]
 ref|XP_002877785.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. 
lyrata]
 sp|P29448.1|TRXH1_ARATH RecName: Full=Thioredoxin H1; Short=AtTrxh1; AltName: Full=Thioredoxin 
1; Short=AtTRX1 [Arabidopsis thaliana]
 emb|CAA78462.1| Thioredoxin H [Arabidopsis thaliana]
 gb|AAC49354.1| thioredoxin h [Arabidopsis thaliana]
 emb|CAB62625.1| thioredoxin h [Arabidopsis thaliana]
 gb|AAM67008.1| thioredoxin h [Arabidopsis thaliana]
 gb|EFH54044.1| hypothetical protein ARALYDRAFT_485455 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE78739.1| thioredoxin H1 [Arabidopsis thaliana]
Length=114

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T E ++  ++KA ++  LVVVDF  + CG C++I   F  L K   +    V+FLK + 
Sbjct  12   HTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPN----VLFLKVDT  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                DE   VA    I+++P F F K G +L+      K+ + S I K+
Sbjct  68   ----DELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKH  112



>ref|XP_010494264.1| PREDICTED: thioredoxin H3 [Camelina sativa]
Length=117

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 60/107 (56%), Gaps = 8/107 (7%)
 Frame = -2

Query  578  EEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDE  399
            EE++  ++ A ++  L+V+DF  T C  C++I   F +L K   +    VVF K +V   
Sbjct  14   EEWTEKLKTASESKKLIVIDFTATWCPPCRFIAPIFAELAKKHLN----VVFFKVDV---  66

Query  398  YDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYS  258
             DE + VA+   ++++P F F K GV+++      KE IL+ + K++
Sbjct  67   -DELNTVAKDFDVQAMPTFIFMKEGVVVDTVVGAAKEEILAKLEKHT  112



>ref|XP_010481919.1| PREDICTED: thioredoxin H3 [Camelina sativa]
Length=117

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = -2

Query  578  EEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDE  399
            EE++  ++ A ++  L+V+DF  T C  C++I   F +L K   +    VVF K +V   
Sbjct  14   EEWNEKLKTASESKKLIVIDFTATWCPPCRFIAPIFAELAKKHLN----VVFFKVDV---  66

Query  398  YDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
             DE + VA+   ++++P F F K GV+++      KE IL+ + K++  +
Sbjct  67   -DELNTVAKDFDVQAMPTFIFMKEGVVVDTVVGAAKEEILAKLEKHTAVA  115



>ref|XP_004079889.1| PREDICTED: thioredoxin [Oryzias latipes]
Length=107

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 52/98 (53%), Gaps = 8/98 (8%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            VRE     EF +I+E A     LVVVDF  + CG CK I   + ++     D+   VVFL
Sbjct  2    VREVADLAEFKKILEDAGDK--LVVVDFTASWCGPCKQIAPLYKQM--SESDDNKNVVFL  57

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAF  306
            K +V    DE  +++    I+ +P FHFYK G  ++ F
Sbjct  58   KVDV----DEADDISSFCEIKCMPTFHFYKGGKKVDEF  91



>ref|XP_004702285.1| PREDICTED: thioredoxin-like [Echinops telfairi]
Length=105

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 58/110 (53%), Gaps = 10/110 (9%)
 Frame = -2

Query  599  VREFNTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFL  420
            V++ ++ E+F   ++ A +   +VVVDF  T CG CK I+  +  LC+  G+    VVFL
Sbjct  2    VKQIHSKEDFQAALKSAGEK--IVVVDFSATWCGPCKMIKPFYHSLCEKYGN----VVFL  55

Query  419  KHNVLDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAI  270
            K +     D+  +VA    +   P F FYK G  +  F   +KE++ + I
Sbjct  56   KVDA----DDCQDVASECEVNCTPTFQFYKKGQKVGEFSGDNKEQLEATI  101



>ref|XP_009566503.1| PREDICTED: thioredoxin [Cuculus canorus]
Length=105

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = -2

Query  533  LVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNVLDEYDEQSEVAERLRIRS  354
            LVVVDF  T CG CK I+  F  LC+  G+    VVF++ +V    D+  +VA    ++ 
Sbjct  22   LVVVDFSATWCGPCKMIKPFFYSLCEKYGE----VVFIEIDV----DDAQDVATHCDVKC  73

Query  353  VPLFHFYKNGVLLEAFPTRDKERILSAI  270
            +P F FYK+G  ++ F   +KE++   I
Sbjct  74   MPTFQFYKSGKKVQEFSGANKEKLEETI  101



>ref|XP_010113482.1| Thioredoxin H-type [Morus notabilis]
 gb|EXC35509.1| Thioredoxin H-type [Morus notabilis]
Length=119

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 58/113 (51%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T E ++  ++K  ++  LVVVDF  + C  C++I    V+L K   D    V FLK +V
Sbjct  12   HTLEAWNEQLQKGNESKKLVVVDFTASWCAPCRFITPFLVELAKRLPD----VTFLKVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE   VA+   + ++P F F K G +++      +E +   I K++ SS
Sbjct  68   ----DELKPVAQDWAVEAMPTFMFLKEGTIVDKVVGARREELQQTIAKHTASS  116



>ref|NP_001266925.1| thioredoxin [Zea mays]
 gb|AFJ97109.1| thioredoxin [Zea mays]
Length=128

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 55/109 (50%), Gaps = 8/109 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T +EF   M KAK+ G LVV+DF    C  C+ +   +         +    VFL+ +V
Sbjct  12   HTKDEFDARMAKAKEQGKLVVIDFMAPWCSGCQMMAPVYAD----CASKYPSAVFLEVDV  67

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKY  261
                DE  EVA+   +  +P F F +NG  LE+F T D+  +  A+ KY
Sbjct  68   ----DELLEVAKIYGVHVMPTFCFIRNGETLESFATVDEGELRDAVRKY  112



>ref|NP_001237535.1| thioredoxin h1 [Glycine max]
 gb|ABV71991.1| thioredoxin h1 [Glycine max]
Length=120

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 59/113 (52%), Gaps = 8/113 (7%)
 Frame = -2

Query  587  NTDEEFSRIMEKAKQTGALVVVDFYRTSCGSCKYIEQGFVKLCKGSGDEEAPVVFLKHNV  408
            +T EE++  ++K  ++  L+VVDF  + CG C++I     +L K    +   V+FLK +V
Sbjct  14   HTVEEWNDQLQKGNESKKLIVVDFTASWCGPCRFIAPFLAELAK----KFTSVIFLKVDV  69

Query  407  LDEYDEQSEVAERLRIRSVPLFHFYKNGVLLEAFPTRDKERILSAILKYSGSS  249
                DE   V++   I ++P F F K G LL+      K+ +   I K+  SS
Sbjct  70   ----DELKSVSQDWAIEAMPTFVFVKEGTLLDKVVGAKKDELQQKIQKHVASS  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500