BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF037B19

Length=701
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592648.1|  PREDICTED: uncharacterized protein DDB_G0274915    262   2e-78   Nicotiana tomentosiformis
ref|XP_009799920.1|  PREDICTED: uncharacterized protein DDB_G0274915    260   7e-78   Nicotiana sylvestris
ref|XP_010089271.1|  Nuclear pore glycoprotein p62                      239   4e-75   
ref|XP_007220636.1|  hypothetical protein PRUPE_ppa002546mg             246   3e-73   
ref|XP_006445364.1|  hypothetical protein CICLE_v10019079mg             245   2e-72   Citrus clementina [clementine]
gb|EYU31925.1|  hypothetical protein MIMGU_mgv1a001392mg                246   3e-72   Erythranthe guttata [common monkey flower]
ref|XP_011094488.1|  PREDICTED: nuclear pore complex protein NUP62      246   6e-72   
ref|XP_006347924.1|  PREDICTED: uncharacterized protein DDB_G0274...    244   8e-72   Solanum tuberosum [potatoes]
gb|AES78767.2|  structural constituent of nuclear pore protein, p...    231   2e-71   Medicago truncatula
ref|XP_003622549.1|  Nuclear pore glycoprotein                          231   3e-71   
ref|XP_006375247.1|  hypothetical protein POPTR_0014s05610g             239   5e-71   
ref|XP_008375784.1|  PREDICTED: uncharacterized protein DDB_G0274915    241   5e-71   Malus domestica [apple tree]
gb|KFK37295.1|  hypothetical protein AALP_AA4G238800                    241   7e-71   Arabis alpina [alpine rockcress]
dbj|BAO49732.1|  nuclear pore complex protein Nup62a                    241   7e-71   Nicotiana benthamiana
ref|XP_010325475.1|  PREDICTED: uncharacterized protein DDB_G0274915    241   9e-71   
ref|XP_007052220.1|  Structural constituent of nuclear pore isofo...    237   2e-70   
ref|XP_008232542.1|  PREDICTED: uncharacterized protein DDB_G0274915    240   2e-70   Prunus mume [ume]
dbj|BAO49733.1|  nuclear pore complex protein Nup62b                    239   4e-70   Nicotiana benthamiana
ref|XP_011033063.1|  PREDICTED: nuclear pore complex protein NUP62      244   5e-70   Populus euphratica
emb|CDX74703.1|  BnaA05g04490D                                          238   9e-70   
ref|XP_007144284.1|  hypothetical protein PHAVU_007G143400g             226   9e-70   Phaseolus vulgaris [French bean]
ref|XP_009143093.1|  PREDICTED: uncharacterized protein DDB_G0274915    238   2e-69   Brassica rapa
emb|CDP09469.1|  unnamed protein product                                238   2e-69   Coffea canephora [robusta coffee]
ref|XP_010508222.1|  PREDICTED: uncharacterized protein DDB_G0274...    238   2e-69   Camelina sativa [gold-of-pleasure]
gb|KHN20170.1|  Nuclear pore glycoprotein p62                           225   2e-69   Glycine soja [wild soybean]
ref|XP_002880150.1|  hypothetical protein ARALYDRAFT_483630             237   2e-69   
ref|NP_850429.1|  protein EMBRYO DEFECTIVE 2766                         237   4e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002511630.1|  structural constituent of nuclear pore, puta...    237   6e-69   
ref|XP_010518110.1|  PREDICTED: uncharacterized protein DDB_G0274...    236   7e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010506438.1|  PREDICTED: uncharacterized protein DDB_G0274...    236   7e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006397681.1|  hypothetical protein EUTSA_v10001339mg             235   7e-69   Eutrema salsugineum [saltwater cress]
ref|XP_010053963.1|  PREDICTED: uncharacterized protein DDB_G0274...    235   2e-68   Eucalyptus grandis [rose gum]
ref|XP_010661352.1|  PREDICTED: nuclear pore complex protein NUP62      235   2e-68   Vitis vinifera
ref|XP_006573216.1|  PREDICTED: uncharacterized protein DDB_G0274...    233   9e-68   Glycine max [soybeans]
ref|XP_010692120.1|  PREDICTED: nuclear pore complex protein NUP62      230   2e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007052219.1|  Structural constituent of nuclear pore isofo...    231   7e-67   
gb|KDP41346.1|  hypothetical protein JCGZ_15753                         231   9e-67   Jatropha curcas
ref|XP_003539122.1|  PREDICTED: uncharacterized protein DDB_G0274...    229   3e-66   Glycine max [soybeans]
ref|XP_010524415.1|  PREDICTED: nuclear pore complex protein DDB_...    229   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_010923084.1|  PREDICTED: nuclear pore complex protein NUP6...    228   5e-66   
emb|CDY18959.1|  BnaC04g03910D                                          228   5e-66   Brassica napus [oilseed rape]
emb|CAN81311.1|  hypothetical protein VITISV_016403                     217   8e-66   Vitis vinifera
ref|XP_009373200.1|  PREDICTED: uncharacterized protein DDB_G0274915    227   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_011469208.1|  PREDICTED: nuclear pore complex protein NUP62      228   1e-65   Fragaria vesca subsp. vesca
ref|XP_010258846.1|  PREDICTED: uncharacterized serine-rich prote...    224   2e-64   Nelumbo nucifera [Indian lotus]
ref|XP_009412577.1|  PREDICTED: uncharacterized serine-rich prote...    223   8e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008785384.1|  PREDICTED: uncharacterized serine-rich prote...    221   1e-63   Phoenix dactylifera
ref|XP_004140612.1|  PREDICTED: LOW QUALITY PROTEIN: nucleoporin ...    221   3e-63   
ref|XP_010923083.1|  PREDICTED: nuclear pore complex protein NUP6...    220   4e-63   Elaeis guineensis
ref|XP_010923082.1|  PREDICTED: nuclear pore complex protein NUP6...    220   5e-63   Elaeis guineensis
gb|KHG05627.1|  Nuclear pore glycoprotein p62                           219   8e-63   Gossypium arboreum [tree cotton]
ref|XP_008459731.1|  PREDICTED: uncharacterized serine-rich prote...    219   9e-63   Cucumis melo [Oriental melon]
gb|KJB42510.1|  hypothetical protein B456_007G156100                    219   1e-62   Gossypium raimondii
ref|XP_004513928.1|  PREDICTED: uncharacterized protein DDB_G0274...    219   2e-62   Cicer arietinum [garbanzo]
gb|KJB42509.1|  hypothetical protein B456_007G156100                    219   3e-62   Gossypium raimondii
ref|XP_004164977.1|  PREDICTED: nucleoporin nsp1-like                   217   1e-61   
gb|KGN46555.1|  hypothetical protein Csa_6G108530                       216   2e-61   Cucumis sativus [cucumbers]
gb|KJB42513.1|  hypothetical protein B456_007G156100                    213   4e-60   Gossypium raimondii
ref|XP_006293763.1|  hypothetical protein CARUB_v10022723mg             207   3e-58   
ref|XP_001768661.1|  predicted protein                                  204   2e-57   
ref|XP_003564647.1|  PREDICTED: uncharacterized protein DDB_G0274915    204   3e-57   Brachypodium distachyon [annual false brome]
dbj|BAJ94031.1|  predicted protein                                      203   5e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006645043.1|  PREDICTED: nuclear pore glycoprotein p62-like      193   1e-56   
gb|EMT32138.1|  Nuclear pore glycoprotein p62                           196   2e-56   
emb|CDM85074.1|  unnamed protein product                                201   3e-56   Triticum aestivum [Canadian hard winter wheat]
gb|EEC71829.1|  hypothetical protein OsI_04485                          191   4e-56   Oryza sativa Indica Group [Indian rice]
gb|EMS50822.1|  Nuclear pore glycoprotein p62                           191   1e-55   Triticum urartu
ref|NP_001168960.1|  uncharacterized protein LOC100382780               190   2e-55   
ref|XP_004970627.1|  PREDICTED: uncharacterized protein DDB_G0274...    197   1e-54   Setaria italica
ref|XP_008655236.1|  PREDICTED: uncharacterized protein LOC100382...    197   1e-54   
ref|XP_004970628.1|  PREDICTED: uncharacterized protein DDB_G0274...    197   1e-54   Setaria italica
ref|XP_004970629.1|  PREDICTED: uncharacterized protein DDB_G0274...    196   1e-54   Setaria italica
ref|XP_006846196.1|  hypothetical protein AMTR_s00012p00215820          196   2e-54   Amborella trichopoda
gb|EEE55694.1|  hypothetical protein OsJ_04120                          188   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002458789.1|  hypothetical protein SORBIDRAFT_03g040330          193   2e-54   
ref|XP_009419737.1|  PREDICTED: uncharacterized serine-rich prote...    190   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN43851.1|  Nuclear pore glycoprotein p62                           176   9e-51   Glycine soja [wild soybean]
gb|EPS64659.1|  hypothetical protein M569_10119                         173   1e-49   Genlisea aurea
gb|AFW84513.1|  hypothetical protein ZEAMMB73_475004                    134   1e-35   
ref|NP_001044847.1|  Os01g0856600                                       125   4e-31   
gb|KJB42512.1|  hypothetical protein B456_007G156100                    114   3e-25   Gossypium raimondii
ref|XP_005847401.1|  hypothetical protein CHLNCDRAFT_134254           95.1    7e-19   Chlorella variabilis
ref|XP_011396612.1|  Nuclear pore glycoprotein p62                    87.8    1e-17   Auxenochlorella protothecoides
ref|XP_005651822.1|  hypothetical protein COCSUDRAFT_38998            90.1    5e-17   Coccomyxa subellipsoidea C-169
ref|XP_002952778.1|  hypothetical protein VOLCADRAFT_105669           77.8    6e-13   Volvox carteri f. nagariensis
ref|XP_007507065.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  68.6    6e-10   Monodelphis domestica
ref|XP_007507064.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  68.6    6e-10   Monodelphis domestica
ref|XP_007507063.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  68.6    6e-10   Monodelphis domestica
ref|XP_007507062.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  68.6    6e-10   Monodelphis domestica
ref|XP_004923460.1|  PREDICTED: uncharacterized protein DDB_G0274...  67.8    1e-09   Bombyx mori [silk moth]
ref|XP_004342073.1|  nuclear pore glycoprotein p62, putative          63.5    2e-08   Acanthamoeba castellanii str. Neff
gb|ENN77508.1|  hypothetical protein YQE_06034                        63.5    3e-08   Dendroctonus ponderosae
gb|KHJ35508.1|  putative nuclear pore glycoprotein p62                63.2    3e-08   Erysiphe necator
gb|AAA60741.1|  nuclear core glycoprotein                             60.1    3e-08   Rattus norvegicus [brown rat]
gb|KHN96286.1|  Nucleoporin, NSP1-lik                                 62.8    4e-08   Metarhizium album ARSEF 1941
ref|XP_002063012.1|  GK21694                                          62.4    5e-08   
gb|KEY67630.1|  hypothetical protein S7711_07827                      62.0    9e-08   Stachybotrys chartarum IBT 7711
gb|KFA51495.1|  hypothetical protein S40293_06766                     62.0    9e-08   Stachybotrys chartarum IBT 40293
gb|KFA73162.1|  hypothetical protein S40288_08256                     62.0    9e-08   Stachybotrys chartarum IBT 40288
ref|XP_011326498.1|  hypothetical protein FGSG_06845                  62.0    1e-07   Fusarium graminearum PH-1
emb|CCT66034.1|  related to nuclear pore protein NSP1                 62.0    1e-07   Fusarium fujikuroi IMI 58289
gb|EWG43849.1|  hypothetical protein FVEG_05141                       62.0    1e-07   Fusarium verticillioides 7600
gb|EMT63823.1|  Nucleoporin nsp1                                      62.0    1e-07   Fusarium oxysporum f. sp. cubense race 4
gb|EXM36771.1|  hypothetical protein FOTG_00768                       62.0    1e-07   Fusarium oxysporum f. sp. vasinfectum 25433
gb|EXL95302.1|  hypothetical protein FOIG_12240                       62.0    1e-07   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EXK41870.1|  hypothetical protein FOMG_05089                       62.0    1e-07   Fusarium oxysporum f. sp. melonis 26406
gb|EXA49790.1|  hypothetical protein FOVG_02791                       62.0    1e-07   Fusarium oxysporum f. sp. pisi HDV247
gb|EWZ44506.1|  hypothetical protein FOZG_05261                       62.0    1e-07   Fusarium oxysporum Fo47
gb|EWY98431.1|  hypothetical protein FOYG_02923                       62.0    1e-07   Fusarium oxysporum FOSC 3-a
gb|ENH64508.1|  Nucleoporin nsp1                                      62.0    1e-07   Fusarium oxysporum f. sp. cubense race 1
gb|EGU89054.1|  hypothetical protein FOXB_00466                       62.0    1e-07   Fusarium oxysporum Fo5176
gb|EYB22785.1|  hypothetical protein FG05_06845                       62.0    1e-07   Fusarium graminearum
ref|XP_009263213.1|  hypothetical protein FPSE_11821                  62.0    1e-07   Fusarium pseudograminearum CS3096
emb|CCG82414.1|  Predicted protein                                    61.6    1e-07   Taphrina deformans PYCC 5710
ref|XP_003051722.1|  hypothetical protein NECHADRAFT_79074            61.6    1e-07   [Nectria] haematococca mpVI 77-13-4
gb|ESA10487.1|  hypothetical protein GLOINDRAFT_196715                61.6    1e-07   
gb|EXX55109.1|  Nsp1p                                                 61.6    1e-07   Rhizophagus irregularis DAOM 197198w
ref|XP_003406825.1|  PREDICTED: nuclear pore glycoprotein p62         60.8    2e-07   Loxodonta africana [African bush elephant]
gb|KIL84288.1|  nucleoporin nsp1                                      60.8    2e-07   Fusarium avenaceum
ref|XP_011110598.1|  hypothetical protein H072_4703                   60.8    2e-07   
gb|KFA61478.1|  hypothetical protein S40285_03419                     60.5    3e-07   Stachybotrys chlorohalonata IBT 40285
gb|EPQ65212.1|  hypothetical protein BGT96224_370                     60.5    3e-07   Blumeria graminis f. sp. tritici 96224
gb|KFO26195.1|  Nuclear pore glycoprotein p62                         60.1    3e-07   Fukomys damarensis [Damara mole rat]
dbj|BAK62955.1|  nuclear pore glycoprotein p62                        58.2    4e-07   Pan troglodytes
gb|KFG81878.1|  hypothetical protein MANI_118343                      60.1    4e-07   Metarhizium anisopliae
ref|XP_006822534.1|  PREDICTED: nuclear pore glycoprotein p62-like    57.8    5e-07   Saccoglossus kowalevskii
ref|XP_005419943.1|  PREDICTED: nuclear pore glycoprotein p62-like    57.8    6e-07   Geospiza fortis
gb|KFU89209.1|  Nuclear pore glycoprotein p62                         57.4    6e-07   Chaetura pelagica
ref|XP_009097752.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  59.3    6e-07   
ref|XP_007821901.1|  Nucleoporin, NSP1-lik                            59.7    6e-07   Metarhizium robertsii ARSEF 23
gb|KID80141.1|  Nucleoporin, NSP1-like protein                        59.3    6e-07   Metarhizium brunneum ARSEF 3297
gb|KIE00004.1|  Nucleoporin, NSP1-like protein                        59.3    6e-07   Metarhizium majus ARSEF 297
gb|EQB55649.1|  hypothetical protein CGLO_04395                       59.3    6e-07   Colletotrichum gloeosporioides Cg-14
gb|KFO61081.1|  Nuclear pore glycoprotein p62                         57.4    6e-07   Corvus brachyrhynchos
emb|CCU76818.1|  hypothetical protein BGHDH14_bgh06235                59.3    6e-07   Blumeria graminis f. sp. hordei DH14
ref|XP_008634424.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  57.4    6e-07   
gb|ETE69696.1|  Nuclear pore glycoprotein p62                         58.9    6e-07   Ophiophagus hannah
ref|XP_009995388.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  57.4    7e-07   Chaetura pelagica
ref|XP_006898707.1|  PREDICTED: nuclear pore glycoprotein p62         58.9    7e-07   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KDN61835.1|  hypothetical protein CSUB01_00380                     59.3    8e-07   Colletotrichum sublineola
gb|EMP31982.1|  Nuclear pore glycoprotein p62                         58.2    8e-07   Chelonia mydas [green seaturtle]
gb|KID91174.1|  Nucleoporin, NSP1-like protein                        58.9    8e-07   Metarhizium guizhouense ARSEF 977
gb|EPQ16007.1|  Nuclear pore glycoprotein p62                         57.0    9e-07   Myotis brandtii
emb|CCF35519.1|  nuclear pore glycoprotein p62                        58.9    9e-07   Colletotrichum higginsianum
gb|ETE61133.1|  hypothetical protein L345_13118                       57.0    1e-06   Ophiophagus hannah
ref|XP_010012487.1|  PREDICTED: nuclear pore glycoprotein p62         58.2    1e-06   Nestor notabilis
ref|XP_007807360.1|  hypothetical protein MAC_01020                   58.9    1e-06   Metarhizium acridum CQMa 102
gb|KFQ49215.1|  Nuclear pore glycoprotein p62                         58.2    1e-06   Nestor notabilis
gb|EDL22755.1|  mCG23139                                              58.5    1e-06   Mus musculus [mouse]
gb|EDM07457.1|  rCG53751                                              58.2    1e-06   Rattus norvegicus [brown rat]
ref|XP_007497465.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  58.2    1e-06   
ref|XP_007497464.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  58.2    1e-06   Monodelphis domestica
ref|XP_007497466.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  58.2    1e-06   Monodelphis domestica
ref|XP_002092219.1|  GE11786                                          58.2    1e-06   Drosophila yakuba
gb|EPY89156.1|  hypothetical protein CB1_000132008                    58.2    2e-06   Camelus ferus
ref|XP_005001812.1|  PREDICTED: nuclear pore glycoprotein p62         58.2    2e-06   Cavia porcellus [guinea pig]
ref|XP_003005306.1|  nuclear pore glycoprotein p62                    58.2    2e-06   Verticillium alfalfae VaMs.102
ref|XP_005046201.1|  PREDICTED: nuclear pore glycoprotein p62-like    57.8    2e-06   
gb|AAI30142.1|  LOC100037082 protein                                  57.8    2e-06   Xenopus laevis [clawed frog]
ref|XP_003764354.1|  PREDICTED: nuclear pore glycoprotein p62-like    56.2    2e-06   
ref|XP_003658805.1|  hypothetical protein MYCTH_2295069               57.8    2e-06   Thermothelomyces thermophila ATCC 42464
ref|NP_075586.1|  nuclear pore glycoprotein p62                       57.8    2e-06   Rattus norvegicus [brown rat]
gb|EMC88654.1|  Nuclear pore glycoprotein p62                         57.4    2e-06   
ref|XP_006036900.1|  PREDICTED: nuclear pore glycoprotein p62-like    57.4    2e-06   
gb|ENH87501.1|  nucleoporin nsp1                                      57.8    2e-06   
ref|XP_002034121.1|  GM21692                                          57.4    2e-06   Drosophila sechellia
ref|XP_006275550.1|  PREDICTED: nuclear pore glycoprotein p62-like    57.4    2e-06   
ref|NP_611120.1|  nucleoporin 62kD, isoform A                         57.4    3e-06   Drosophila melanogaster
gb|KGL78705.1|  Nuclear pore glycoprotein p62                         57.4    3e-06   Tinamus guttatus
ref|XP_008634480.1|  PREDICTED: LOW QUALITY PROTEIN: nuclear pore...  57.4    3e-06   
ref|XP_006677073.1|  hypothetical protein BATDEDRAFT_86302            57.4    3e-06   Batrachochytrium dendrobatidis JAM81
ref|XP_003935930.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  56.6    3e-06   Saimiri boliviensis boliviensis
dbj|BAE40127.1|  unnamed protein product                              57.4    3e-06   Mus musculus [mouse]
ref|XP_003269736.1|  PREDICTED: nuclear pore glycoprotein p62         57.4    3e-06   
gb|AAB19953.1|  nuclear pore complex glycoprotein p62                 57.4    3e-06   Mus sp. [mice]
dbj|BAK62486.1|  nuclear pore glycoprotein p62                        57.4    3e-06   Pan troglodytes
dbj|BAE29296.1|  unnamed protein product                              57.4    3e-06   Mus musculus [mouse]
ref|XP_006868284.1|  PREDICTED: nuclear pore glycoprotein p62         57.4    3e-06   Chrysochloris asiatica
dbj|BAE40956.1|  unnamed protein product                              57.4    3e-06   Mus musculus [mouse]
dbj|BAE33019.1|  unnamed protein product                              57.4    3e-06   Mus musculus [mouse]
ref|NP_444304.1|  nuclear pore glycoprotein p62                       57.4    3e-06   Mus musculus [mouse]
ref|XP_007941054.1|  PREDICTED: nuclear pore glycoprotein p62         57.4    3e-06   Orycteropus afer afer
gb|EOB08562.1|  Nuclear pore glycoprotein p62                         57.4    3e-06   Anas platyrhynchos [duck]
ref|NP_001270199.1|  uncharacterized protein LOC101866268             57.4    3e-06   Macaca fascicularis [crab eating macaque]
ref|XP_005440073.1|  PREDICTED: nuclear pore glycoprotein p62-like    57.0    3e-06   
gb|EFQ26235.1|  hypothetical protein GLRG_01379                       57.4    3e-06   Colletotrichum graminicola M1.001
gb|KFB34747.1|  AGAP010978-PA-like protein                            57.0    3e-06   Anopheles sinensis
ref|XP_007995812.1|  PREDICTED: nuclear pore glycoprotein p62         57.0    3e-06   Chlorocebus sabaeus
ref|XP_010215102.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  57.0    3e-06   Tinamus guttatus
gb|EMC88655.1|  Nuclear pore glycoprotein p62                         57.0    3e-06   
ref|XP_009570320.1|  PREDICTED: nuclear pore glycoprotein p62-like    57.0    3e-06   Cuculus canorus
ref|XP_005009725.1|  PREDICTED: nuclear pore glycoprotein p62-like    57.0    3e-06   
ref|XP_010713440.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  57.0    3e-06   Meleagris gallopavo [common turkey]
ref|XP_007599043.1|  nuclear pore glycoprotein p62                    57.4    3e-06   
gb|KFH47953.1|  Nucleoporin-like protein                              57.4    3e-06   Acremonium chrysogenum ATCC 11550
ref|NP_001247546.1|  nuclear pore glycoprotein p62                    57.0    3e-06   Macaca mulatta [rhesus macaque]
ref|XP_004381680.1|  PREDICTED: nuclear pore glycoprotein p62         57.0    4e-06   Trichechus manatus latirostris
ref|XP_010638993.1|  PREDICTED: nuclear pore glycoprotein p62         57.0    4e-06   
gb|AFP33412.1|  nucleoporin 62                                        54.7    4e-06   Sepiella maindroni
ref|XP_008053992.1|  PREDICTED: nuclear pore glycoprotein p62         57.0    4e-06   Carlito syrichta
gb|AAH64245.2|  hypothetical protein LOC394934                        57.0    4e-06   Xenopus tropicalis [western clawed frog]
ref|XP_002673465.1|  nuclear pore complex p62                         57.0    4e-06   Naegleria gruberi strain NEG-M
ref|XP_003915981.1|  PREDICTED: nuclear pore glycoprotein p62         56.6    4e-06   Papio anubis [baboon]
ref|XP_005237964.1|  PREDICTED: nuclear pore glycoprotein p62-like    56.6    4e-06   
ref|XP_010367825.1|  PREDICTED: nuclear pore glycoprotein p62         56.6    4e-06   Rhinopithecus roxellana
gb|KFV78789.1|  Nuclear pore glycoprotein p62                         56.6    4e-06   Struthio camelus australis
ref|XP_009668275.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  56.6    5e-06   Struthio camelus australis
ref|XP_010991466.1|  PREDICTED: LOW QUALITY PROTEIN: nuclear pore...  56.6    5e-06   Camelus dromedarius [camel]
ref|XP_005515441.1|  PREDICTED: nuclear pore glycoprotein p62-like    56.6    5e-06   
ref|XP_002609193.1|  hypothetical protein BRAFLDRAFT_125958           56.6    5e-06   Branchiostoma floridae
gb|KFO71976.1|  Nuclear pore glycoprotein p62                         56.6    5e-06   Cuculus canorus
ref|NP_001001989.1|  uncharacterized protein LOC394934                56.6    5e-06   Xenopus tropicalis [western clawed frog]
ref|XP_005420008.1|  PREDICTED: nuclear pore glycoprotein p62-like    56.2    5e-06   
ref|XP_006173846.1|  PREDICTED: nuclear pore glycoprotein p62         56.6    5e-06   Camelus ferus
ref|XP_003226470.2|  PREDICTED: nucleoporin-62 C-terminal-like pr...  56.6    5e-06   Anolis carolinensis [Carolina anole]
ref|XP_008529432.1|  PREDICTED: nuclear pore glycoprotein p62         56.2    6e-06   Equus przewalskii [Przewalski horse]
ref|XP_007506780.1|  PREDICTED: nuclear pore glycoprotein p62-like    55.1    6e-06   
ref|XP_006208499.1|  PREDICTED: nuclear pore glycoprotein p62         56.6    6e-06   Vicugna pacos
ref|XP_007530689.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  55.5    6e-06   
ref|XP_005641697.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  56.2    6e-06   
ref|NP_001084339.1|  nuclear pore complex glycoprotein p62            56.2    6e-06   Xenopus laevis [clawed frog]
gb|KFO86807.1|  Nuclear pore glycoprotein p62                         56.2    6e-06   Buceros rhinoceros silvestris
ref|XP_010740237.1|  PREDICTED: nuclear pore glycoprotein p62         56.2    6e-06   
ref|XP_001975363.1|  GG20600                                          56.2    6e-06   Drosophila erecta
ref|XP_010129702.1|  PREDICTED: nuclear pore glycoprotein p62         56.2    6e-06   Buceros rhinoceros silvestris
ref|XP_008020640.1|  hypothetical protein SETTUDRAFT_162123           56.2    6e-06   Exserohilum turcica Et28A
gb|EPQ14626.1|  Nuclear pore glycoprotein p62                         56.2    6e-06   Myotis brandtii
ref|XP_005692911.1|  PREDICTED: nuclear pore glycoprotein p62         55.8    7e-06   
ref|XP_004672270.1|  PREDICTED: nuclear pore glycoprotein p62         56.2    7e-06   Jaculus jaculus
emb|CAA41411.1|  nucleoporin p62                                      56.2    7e-06   Homo sapiens [man]
ref|XP_009649198.1|  nuclear pore glycoprotein p62                    56.2    7e-06   Verticillium dahliae VdLs.17
ref|XP_004061257.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  56.2    8e-06   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_007546536.1|  PREDICTED: nuclear pore glycoprotein p62         56.2    8e-06   Poecilia formosa
ref|XP_852888.3|  PREDICTED: nuclear pore glycoprotein p62 isofor...  55.5    8e-06   
ref|XP_004440362.1|  PREDICTED: nuclear pore glycoprotein p62         55.8    8e-06   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005641696.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  55.8    8e-06   
ref|XP_003316568.1|  PREDICTED: nuclear pore glycoprotein p62         55.8    8e-06   Pan troglodytes
ref|XP_003814399.1|  PREDICTED: nuclear pore glycoprotein p62         55.8    8e-06   Pan paniscus [bonobo]
ref|XP_001846021.1|  nuclear pore glycoprotein p62                    55.5    8e-06   Culex quinquefasciatus
ref|XP_006890006.1|  PREDICTED: nuclear pore glycoprotein p62-like    54.7    9e-06   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KFV73131.1|  Nuclear pore glycoprotein p62                         55.8    9e-06   Picoides pubescens
ref|XP_006986271.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  55.8    9e-06   Peromyscus maniculatus bairdii
ref|XP_004409969.1|  PREDICTED: nuclear pore glycoprotein p62         55.8    9e-06   Odobenus rosmarus divergens
ref|XP_010114860.1|  PREDICTED: nuclear pore glycoprotein p62         55.8    9e-06   Chlamydotis macqueenii
ref|XP_004769067.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  55.5    9e-06   Mustela putorius furo [black ferret]
gb|KFP40131.1|  Nuclear pore glycoprotein p62                         55.8    1e-05   Chlamydotis macqueenii
ref|XP_009905646.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  55.8    1e-05   Picoides pubescens
ref|XP_005654342.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  55.5    1e-05   Sus scrofa [pigs]
ref|NP_036478.2|  nuclear pore glycoprotein p62                       55.8    1e-05   Homo sapiens [man]
emb|CAB82399.1|  hypothetical protein                                 55.8    1e-05   Homo sapiens [man]
gb|KFP06952.1|  Nuclear pore glycoprotein p62                         55.8    1e-05   Calypte anna
ref|XP_005654341.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  55.5    1e-05   
ref|XP_004457801.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  55.8    1e-05   Dasypus novemcinctus
ref|NP_001125843.1|  nuclear pore glycoprotein p62                    55.8    1e-05   Pongo abelii [orang utan]
ref|XP_005877471.1|  PREDICTED: nuclear pore glycoprotein p62-like    55.5    1e-05   Myotis brandtii
gb|KGL96677.1|  Nuclear pore glycoprotein p62                         55.5    1e-05   Charadrius vociferus
ref|XP_011126974.1|  hypothetical protein AOL_s00193g61               55.8    1e-05   Arthrobotrys oligospora ATCC 24927
ref|XP_005955531.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   Pantholops hodgsonii [Tibetan antelope]
ref|XP_008499978.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  55.5    1e-05   Calypte anna
ref|XP_004767299.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  55.5    1e-05   Mustela putorius furo [black ferret]
ref|XP_420179.4|  PREDICTED: nuclear pore glycoprotein p62 isofor...  55.5    1e-05   Gallus gallus [bantam]
ref|XP_005616338.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   
ref|XP_009932998.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  55.5    1e-05   Opisthocomus hoazin [hoatzin]
ref|XP_006744389.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   Leptonychotes weddellii
gb|KJB42511.1|  hypothetical protein B456_007G156100                  55.5    1e-05   Gossypium raimondii
ref|XP_009231185.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  55.5    1e-05   
ref|XP_008843343.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   Nannospalax galili
ref|XP_005596474.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   Equus caballus [domestic horse]
ref|XP_007063996.1|  PREDICTED: nuclear pore glycoprotein p62-like    55.5    1e-05   Chelonia mydas [green seaturtle]
dbj|BAK63085.1|  nuclear pore glycoprotein p62                        55.5    1e-05   Pan troglodytes
ref|XP_008933190.1|  PREDICTED: LOW QUALITY PROTEIN: nucleoporin-...  55.5    1e-05   
ref|XP_004769064.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  55.1    1e-05   Mustela putorius furo [black ferret]
gb|KFR10751.1|  Nuclear pore glycoprotein p62                         55.5    1e-05   Opisthocomus hoazin [hoatzin]
ref|XP_009873633.1|  PREDICTED: LOW QUALITY PROTEIN: nuclear pore...  55.5    1e-05   Apaloderma vittatum
ref|XP_008276938.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   Stegastes partitus
ref|XP_005084819.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   Mesocricetus auratus [Syrian golden hamster]
ref|XP_002917872.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   Ailuropoda melanoleuca
ref|XP_007536309.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   Erinaceus europaeus [common hedgehog]
ref|XP_003940425.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   Saimiri boliviensis boliviensis
ref|XP_003510931.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   
emb|CAG09958.1|  unnamed protein product                              55.5    1e-05   
ref|XP_005366910.1|  PREDICTED: nuclear pore glycoprotein p62         55.5    1e-05   
ref|XP_009570319.1|  PREDICTED: nuclear pore glycoprotein p62-like    55.1    1e-05   
ref|XP_005515440.1|  PREDICTED: nuclear pore glycoprotein p62-like    55.1    1e-05   
ref|XP_007445266.1|  PREDICTED: nuclear pore glycoprotein p62-like    55.1    1e-05   
gb|KJB42514.1|  hypothetical protein B456_007G156100                  55.5    2e-05   
ref|XP_007074356.1|  PREDICTED: nuclear pore glycoprotein p62         55.1    2e-05   
gb|ADR82634.1|  Nup62                                                 55.1    2e-05   
ref|XP_002762436.1|  PREDICTED: nuclear pore glycoprotein p62         55.1    2e-05   
ref|XP_309717.4|  AGAP010978-PA                                       55.1    2e-05   
ref|XP_005237963.1|  PREDICTED: nuclear pore glycoprotein p62-like    55.1    2e-05   
ref|XP_002186991.2|  PREDICTED: nuclear pore glycoprotein p62-like    55.1    2e-05   
ref|XP_005412867.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  55.1    2e-05   
ref|XP_003961888.1|  PREDICTED: nuclear pore glycoprotein p62-like    55.1    2e-05   
ref|XP_007463456.1|  PREDICTED: nuclear pore glycoprotein p62         55.1    2e-05   
ref|XP_004081805.1|  PREDICTED: nuclear pore glycoprotein p62         55.1    2e-05   
ref|XP_009887615.1|  PREDICTED: nuclear pore glycoprotein p62         55.1    2e-05   
ref|XP_005799460.1|  PREDICTED: nuclear pore glycoprotein p62-like    55.1    2e-05   
ref|XP_007990684.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  53.5    2e-05   
ref|XP_011190092.1|  PREDICTED: nuclear pore glycoprotein p62         54.7    2e-05   
ref|XP_006941033.1|  PREDICTED: nuclear pore glycoprotein p62         55.1    2e-05   
ref|XP_006137519.1|  PREDICTED: nuclear pore glycoprotein p62-like    55.1    2e-05   
ref|XP_001360457.2|  GA19470                                          54.7    2e-05   
ref|XP_002015979.1|  GL10733                                          54.7    2e-05   
ref|XP_004286201.1|  PREDICTED: nuclear pore glycoprotein p62         54.7    2e-05   
gb|KFM04900.1|  Nuclear pore glycoprotein p62                         54.7    2e-05   
ref|XP_003356052.1|  PREDICTED: nuclear pore glycoprotein p62         54.7    2e-05   
ref|XP_004064714.1|  PREDICTED: nuclear pore glycoprotein p62-like    53.5    2e-05   
ref|XP_008397509.1|  PREDICTED: nuclear pore glycoprotein p62         54.7    2e-05   
ref|XP_008152553.1|  PREDICTED: nuclear pore glycoprotein p62         54.7    2e-05   
ref|XP_011197613.1|  PREDICTED: nuclear pore glycoprotein p62         54.7    2e-05   
ref|XP_007112517.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  54.7    2e-05   
ref|XP_004533785.1|  PREDICTED: nuclear pore glycoprotein p62-like    54.7    2e-05   
ref|XP_004866907.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  54.7    2e-05   
ref|XP_005151387.1|  PREDICTED: nuclear pore glycoprotein p62-like    54.7    2e-05   
ref|XP_006633020.1|  PREDICTED: nuclear pore glycoprotein p62-like    54.7    2e-05   
ref|XP_003801513.1|  PREDICTED: nuclear pore glycoprotein p62         54.7    2e-05   
ref|XP_004889010.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  54.7    2e-05   
ref|XP_008682784.1|  PREDICTED: nuclear pore glycoprotein p62         54.7    2e-05   
ref|XP_011235955.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  54.3    2e-05   
ref|XP_007507068.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  54.7    2e-05   
ref|XP_007184993.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  54.7    2e-05   
ref|XP_005285745.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  54.7    2e-05   
ref|XP_011235954.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  54.3    2e-05   
ref|XP_001960904.1|  GF13594                                          54.3    2e-05   
ref|XP_006107351.1|  PREDICTED: nuclear pore glycoprotein p62         54.3    3e-05   
gb|ELU14274.1|  hypothetical protein CAPTEDRAFT_165712                53.1    3e-05   
ref|XP_005336769.1|  PREDICTED: nuclear pore glycoprotein p62         54.3    3e-05   
ref|XP_003507307.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  53.9    3e-05   
ref|XP_008695452.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  53.9    3e-05   
ref|XP_007507066.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  54.7    3e-05   
ref|XP_004619914.1|  PREDICTED: nuclear pore glycoprotein p62         54.3    3e-05   
ref|XP_006905071.1|  PREDICTED: nuclear pore glycoprotein p62         54.3    3e-05   
ref|XP_007507067.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  54.3    3e-05   
ref|XP_005151267.1|  PREDICTED: nuclear pore glycoprotein p62-like    54.3    3e-05   
ref|XP_006160185.1|  PREDICTED: nuclear pore glycoprotein p62         54.3    3e-05   
ref|XP_011372908.1|  PREDICTED: nuclear pore glycoprotein p62         54.3    3e-05   
gb|ERE65767.1|  nuclear pore glycoprotein like protein                53.9    3e-05   
pir||I52523  nucleoporin p62 homolog - rat (fragment)                 53.1    3e-05
ref|XP_010581749.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  54.3    3e-05   
ref|XP_005188426.1|  PREDICTED: nuclear pore glycoprotein p62         53.9    3e-05   
ref|XP_006744287.1|  PREDICTED: nuclear pore glycoprotein p62-like    53.9    4e-05   
ref|XP_009074388.1|  PREDICTED: nuclear pore glycoprotein p62-like    51.2    4e-05   
ref|XP_008695451.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  53.9    4e-05   
ref|XP_008590576.1|  PREDICTED: nuclear pore glycoprotein p62         53.9    4e-05   
ref|XP_006214234.1|  PREDICTED: nuclear pore glycoprotein p62-like    53.5    4e-05   
ref|XP_001650988.1|  AAEL000782-PA                                    53.9    4e-05   
ref|XP_007669741.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  53.9    4e-05   
ref|XP_007990681.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  53.1    4e-05   
ref|XP_010772737.1|  PREDICTED: nuclear pore glycoprotein p62-like    53.9    5e-05   
ref|XP_003841339.1|  hypothetical protein LEMA_P092690.1              53.9    5e-05   
ref|XP_010401664.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  53.9    5e-05   
gb|KDB13394.1|  nuclear pore glycoprotein p62                         53.5    5e-05   
ref|XP_003714569.1|  hypothetical protein MGG_01590                   53.5    5e-05   
ref|XP_005879609.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  53.5    6e-05   
emb|CDQ60132.1|  unnamed protein product                              53.5    6e-05   
ref|XP_008326499.1|  PREDICTED: nuclear pore glycoprotein p62         53.1    7e-05   
ref|XP_002059882.1|  GJ15090                                          53.1    7e-05   
gb|ETN67119.1|  nuclear pore glycoprotein p62                         53.1    7e-05   
ref|XP_006052852.1|  PREDICTED: nuclear pore glycoprotein p62-like    52.8    8e-05   
ref|XP_009273670.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  53.1    8e-05   
ref|XP_010848022.1|  PREDICTED: nuclear pore glycoprotein p62         53.1    8e-05   
ref|XP_006788537.1|  PREDICTED: nuclear pore glycoprotein p62-like    53.1    8e-05   
ref|XP_004557789.1|  PREDICTED: nuclear pore glycoprotein p62-like    53.1    8e-05   
gb|KFQ55400.1|  Nuclear pore glycoprotein p62                         52.8    8e-05   
ref|XP_002004418.1|  GI19922                                          52.8    9e-05   
ref|XP_005157209.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  52.8    9e-05   
ref|XP_008593457.1|  nuclear pore glycoprotein p62                    53.1    9e-05   
ref|XP_005921561.1|  PREDICTED: nuclear pore glycoprotein p62-like    52.8    9e-05   
ref|NP_001135264.1|  Nuclear pore glycoprotein p62                    52.8    9e-05   
ref|NP_001107068.1|  nuclear pore glycoprotein p62                    52.8    9e-05   
emb|CBJ30875.1|  conserved unknown protein                            52.8    9e-05   
ref|NP_001117654.1|  nuclear pore complex glycoprotein p62            52.8    9e-05   
dbj|BAE28211.1|  unnamed protein product                              52.8    1e-04   
ref|NP_001192448.1|  nuclear pore glycoprotein p62                    52.8    1e-04   
ref|XP_010897127.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  52.8    1e-04   
ref|XP_005723536.1|  PREDICTED: nuclear pore glycoprotein p62-like    52.8    1e-04   
ref|XP_004414738.1|  PREDICTED: nuclear pore glycoprotein p62-like    52.4    1e-04   
gb|KDO15930.1|  hypothetical protein SPRG_18530                       52.4    1e-04   
ref|XP_008851201.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  52.0    1e-04   
ref|XP_010897128.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  52.4    1e-04   
gb|ACN11471.1|  Nuclear pore glycoprotein p62                         52.4    1e-04   
ref|XP_009466379.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  52.4    1e-04   
ref|XP_005905075.1|  PREDICTED: LOW QUALITY PROTEIN: nuclear pore...  52.4    1e-04   
ref|XP_003447360.1|  PREDICTED: nuclear pore glycoprotein p62-like    52.4    1e-04   
gb|EFX01687.1|  nucleoporin                                           52.4    1e-04   
gb|KIH87601.1|  nuclear pore complex protein Nup62                    52.4    2e-04   
gb|ERS98398.1|  hypothetical protein HMPREF1624_05182                 52.4    2e-04   
ref|XP_008582207.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  51.6    2e-04   
gb|KFR00179.1|  Nuclear pore glycoprotein p62                         52.0    2e-04   
ref|XP_010944431.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  52.0    2e-04   
emb|CDH58179.1|  nucleoporin nsp1                                     52.0    2e-04   
ref|XP_006080130.1|  PREDICTED: nuclear pore glycoprotein p62         52.0    2e-04   
ref|XP_008582208.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  51.6    2e-04   
ref|XP_004414471.1|  PREDICTED: nuclear pore glycoprotein p62-like    52.0    2e-04   
ref|NP_001270402.1|  uncharacterized protein LOC101867319             51.2    2e-04   
ref|XP_007228486.1|  PREDICTED: nuclear pore glycoprotein p62-like    51.6    2e-04   
ref|XP_001094695.1|  PREDICTED: nuclear pore glycoprotein p62-lik...  51.2    2e-04   
ref|XP_004646475.1|  PREDICTED: nuclear pore glycoprotein p62         51.6    2e-04   
ref|XP_011449287.1|  PREDICTED: uncharacterized protein LOC105343575  52.0    2e-04   
ref|XP_006765991.1|  PREDICTED: nuclear pore glycoprotein p62 iso...  51.6    2e-04   
gb|ELU00525.1|  hypothetical protein CAPTEDRAFT_181436                51.2    2e-04   
ref|XP_009995501.1|  PREDICTED: nuclear pore glycoprotein p62-like    49.3    2e-04   
ref|XP_007287222.1|  nucleoporin nsp1                                 50.4    3e-04   
ref|XP_006187922.1|  PREDICTED: nuclear pore glycoprotein p62-like    51.2    3e-04   
ref|XP_005367413.1|  PREDICTED: nuclear pore glycoprotein p62-like    50.8    3e-04   
ref|XP_009217618.1|  hypothetical protein GGTG_01587                  51.2    3e-04   
ref|XP_007113772.1|  PREDICTED: nuclear pore glycoprotein p62-like    50.8    3e-04   
ref|XP_005614449.1|  PREDICTED: nuclear pore glycoprotein p62-like    50.8    4e-04   
gb|EPY78602.1|  hypothetical protein CB1_001035002                    50.8    4e-04   
ref|XP_004659020.1|  PREDICTED: nuclear pore glycoprotein p62-like    50.4    4e-04   
gb|KDN43681.1|  hypothetical protein K437DRAFT_248334                 50.8    5e-04   
ref|XP_010985870.1|  PREDICTED: nucleoporin-62 C-terminal-like pr...  50.4    5e-04   
ref|XP_002115502.1|  hypothetical protein TRIADDRAFT_29876            49.3    5e-04   
ref|XP_007789196.1|  putative nuclear pore glycoprotein p62 protein   49.7    6e-04   
ref|XP_001913013.1|  hypothetical protein                             50.4    6e-04   
gb|KDO29299.1|  hypothetical protein SPRG_05836                       50.4    6e-04   
gb|EPE03948.1|  nuclear pore glycoprotein p62                         50.1    7e-04   
ref|XP_009826719.1|  hypothetical protein H257_04047                  50.1    8e-04   
ref|XP_006970478.1|  PREDICTED: nuclear pore glycoprotein p62-like    49.7    8e-04   
ref|XP_002618430.1|  hypothetical protein CLUG_01889                  50.1    8e-04   
gb|KEY79676.1|  nucleoporin Nsp1                                      50.1    8e-04   
ref|XP_004685973.1|  PREDICTED: nuclear pore glycoprotein p62-like    49.7    9e-04   
ref|XP_011304257.1|  PREDICTED: nuclear pore glycoprotein p62         50.1    9e-04   
gb|KDR14424.1|  Nuclear pore glycoprotein p62                         49.7    0.001   
ref|XP_009097755.1|  PREDICTED: nuclear pore glycoprotein p62-like    47.4    0.001   



>ref|XP_009592648.1| PREDICTED: uncharacterized protein DDB_G0274915 [Nicotiana tomentosiformis]
Length=757

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LESEVAKVVETQASLERQLELIETHQ+EVDKALQSMEEEA RIYKDER ++LDDEAA TR
Sbjct  602  LESEVAKVVETQASLERQLELIETHQEEVDKALQSMEEEADRIYKDERGVILDDEAASTR  661

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEFVEREMEKM EQIKSIIN+LNA+QGGEL   DG+ PLDVVVRILNNQLSSL+
Sbjct  662  DAMYEQAEFVEREMEKMTEQIKSIINTLNASQGGELEAPDGMTPLDVVVRILNNQLSSLM  721

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEKAE+ SSRIQKLA +GS+A+R LTGP+   T
Sbjct  722  WIDEKAEEFSSRIQKLASEGSAANRELTGPKLWLT  756



>ref|XP_009799920.1| PREDICTED: uncharacterized protein DDB_G0274915 [Nicotiana sylvestris]
Length=758

 Score =   260 bits (665),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 140/155 (90%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LESEVAKVVETQ SLERQLELIETHQ+EVDKALQSMEEEA RIYKDER ++LDDEAA TR
Sbjct  603  LESEVAKVVETQTSLERQLELIETHQEEVDKALQSMEEEADRIYKDERGVILDDEAASTR  662

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEFVEREMEKM EQIKSIIN+LNA+QGGEL   DG+ PLDVVVRILNNQLSSL+
Sbjct  663  DAMYEQAEFVEREMEKMTEQIKSIINTLNASQGGELEAPDGMTPLDVVVRILNNQLSSLM  722

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEKAE+ SSRIQKLA +GS+A+R LTGP+   T
Sbjct  723  WIDEKAEEFSSRIQKLANEGSAANRELTGPKLWLT  757



>ref|XP_010089271.1| Nuclear pore glycoprotein p62 [Morus notabilis]
 gb|EXB37596.1| Nuclear pore glycoprotein p62 [Morus notabilis]
Length=246

 Score =   239 bits (611),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA+LERQLELIETHQ+EVDKALQSME EA RIYKDER++LLDDEAA TR
Sbjct  92   LEIEVAKVVETQANLERQLELIETHQEEVDKALQSMEGEADRIYKDERDLLLDDEAASTR  151

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEF+EREME+M EQIKSII +LNA+QGGEL   D + PLD VV+ILNNQLSSL+
Sbjct  152  DAMYEQAEFIEREMEQMTEQIKSIIQTLNASQGGELDTNDTMTPLDAVVKILNNQLSSLM  211

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEKAE+ S+RIQKLA QGS+ADR L GP+F  +
Sbjct  212  WIDEKAEEFSTRIQKLASQGSAADRQLVGPKFWMS  246



>ref|XP_007220636.1| hypothetical protein PRUPE_ppa002546mg [Prunus persica]
 gb|EMJ21835.1| hypothetical protein PRUPE_ppa002546mg [Prunus persica]
Length=660

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA+LERQLELIETHQ EVDKALQSMEEEA RIYKDER ++LDDEAA TR
Sbjct  506  LEIEVAKVVETQANLERQLELIETHQQEVDKALQSMEEEAERIYKDERGLILDDEAASTR  565

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEF+ERE+E++ EQIKSII +LNANQGGEL   DG+ PLDVVVRILNNQLSSL+
Sbjct  566  DAMYEQAEFIERELEQVTEQIKSIIQTLNANQGGELDTNDGMAPLDVVVRILNNQLSSLM  625

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKLA QG +ADR L  P++
Sbjct  626  WIDEKAEEFSSRIQKLANQGPAADRELMSPKY  657



>ref|XP_006445364.1| hypothetical protein CICLE_v10019079mg [Citrus clementina]
 ref|XP_006464469.1| PREDICTED: uncharacterized protein DDB_G0274915-like [Citrus 
sinensis]
 gb|ESR58604.1| hypothetical protein CICLE_v10019079mg [Citrus clementina]
Length=707

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ++LERQLELIETHQ EVDKALQSMEEEA RIYKDER +LLDDEAA TR
Sbjct  553  LEIEVAKVVETQSNLERQLELIETHQQEVDKALQSMEEEAERIYKDERGLLLDDEAASTR  612

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEFVEREME M EQIKSII +LNA+QGG     DG+ PLDVVV+ILNNQLSSL+
Sbjct  613  DAMYEQAEFVEREMEHMTEQIKSIIQTLNASQGGGFDAFDGMTPLDVVVQILNNQLSSLM  672

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+D+KAE+ SSRIQKLA QGSSADR L GP+F
Sbjct  673  WIDDKAEEFSSRIQKLATQGSSADRVLMGPKF  704



>gb|EYU31925.1| hypothetical protein MIMGU_mgv1a001392mg [Erythranthe guttata]
Length=826

 Score =   246 bits (629),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LESEVAKVVETQ SLER+LELIETHQDEVDKALQS+EEEA RIY+ ER +LL+D+AA TR
Sbjct  672  LESEVAKVVETQGSLERELELIETHQDEVDKALQSIEEEAERIYRKERGVLLEDDAASTR  731

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E +ERE+E+M EQIKSIIN+LN+ QGGEL  TD +NPLDVVVRILNNQLSSL+
Sbjct  732  DAMYEQSELIERELEQMTEQIKSIINTLNSTQGGELEATDAMNPLDVVVRILNNQLSSLM  791

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEKAE+ SSRIQKLA QGS+ADR LTGP+   T
Sbjct  792  WIDEKAEEFSSRIQKLASQGSTADRELTGPKLWLT  826



>ref|XP_011094488.1| PREDICTED: nuclear pore complex protein NUP62 [Sesamum indicum]
Length=899

 Score =   246 bits (629),  Expect = 6e-72, Method: Composition-based stats.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LESEVAKVVETQ SLERQLELIETHQDEVDKALQSMEEEA RIY++ER +LLDD+AA TR
Sbjct  745  LESEVAKVVETQGSLERQLELIETHQDEVDKALQSMEEEAERIYREERGLLLDDDAASTR  804

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE +ERE+E+M E IKSII++LNA+ GGEL   DG+ PLDVVVRILNNQLSSL+
Sbjct  805  DAMYEQAELIERELEQMTEHIKSIISTLNASHGGELEAADGMTPLDVVVRILNNQLSSLM  864

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEKAE+ S+RIQKLA +GS+ADR LTGP+   T
Sbjct  865  WIDEKAEEFSARIQKLASEGSAADRELTGPKLWLT  899



>ref|XP_006347924.1| PREDICTED: uncharacterized protein DDB_G0274915-like [Solanum 
tuberosum]
Length=798

 Score =   244 bits (624),  Expect = 8e-72, Method: Composition-based stats.
 Identities = 122/155 (79%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LESEVAKVVETQ SLERQL+LIETHQ+EVDKALQSMEEEA RIYKDER ++LDDEAA TR
Sbjct  643  LESEVAKVVETQGSLERQLDLIETHQEEVDKALQSMEEEAERIYKDERGVILDDEAAATR  702

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEFVEREMEKM EQIKSIIN+ NA QGGEL  TDG+ PLDVVVRILNNQLSSL+
Sbjct  703  DAMYEQAEFVEREMEKMTEQIKSIINTFNACQGGELEATDGMTPLDVVVRILNNQLSSLM  762

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEK E+ SSRIQKLA +G +A+R  T P+   T
Sbjct  763  WIDEKTEEFSSRIQKLASEGPAANRESTAPKLWLT  797



>gb|AES78767.2| structural constituent of nuclear pore protein, putative [Medicago 
truncatula]
Length=270

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELIETHQ EVDKALQS+EEEA RIYKDER +LLDDEAA TR
Sbjct  116  LEIEVAKVVETQSSLERQLELIETHQQEVDKALQSVEEEAERIYKDERGLLLDDEAASTR  175

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E +ERE+E+M EQIKSII+SLN+NQGGE+   DG+ PLD VVRILNNQL+SL+
Sbjct  176  DAMYEQSELIERELEQMTEQIKSIIHSLNSNQGGEVEAPDGMTPLDAVVRILNNQLTSLM  235

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGP  257
            W+DEKAE+ SSRIQKL+ QGS++DR L GP
Sbjct  236  WIDEKAEEFSSRIQKLSNQGSASDRQLMGP  265



>ref|XP_003622549.1| Nuclear pore glycoprotein [Medicago truncatula]
Length=299

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELIETHQ EVDKALQS+EEEA RIYKDER +LLDDEAA TR
Sbjct  145  LEIEVAKVVETQSSLERQLELIETHQQEVDKALQSVEEEAERIYKDERGLLLDDEAASTR  204

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E +ERE+E+M EQIKSII+SLN+NQGGE+   DG+ PLD VVRILNNQL+SL+
Sbjct  205  DAMYEQSELIERELEQMTEQIKSIIHSLNSNQGGEVEAPDGMTPLDAVVRILNNQLTSLM  264

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGP  257
            W+DEKAE+ SSRIQKL+ QGS++DR L GP
Sbjct  265  WIDEKAEEFSSRIQKLSNQGSASDRQLMGP  294



>ref|XP_006375247.1| hypothetical protein POPTR_0014s05610g, partial [Populus trichocarpa]
 gb|ERP53044.1| hypothetical protein POPTR_0014s05610g, partial [Populus trichocarpa]
Length=582

 Score =   239 bits (609),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA+LER+LELIETHQ EVDKALQS+EEEA RIYKDER  LLDDEAA TR
Sbjct  431  LEIEVAKVVETQANLERKLELIETHQQEVDKALQSIEEEAERIYKDERGSLLDDEAASTR  490

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEF+EREME+M EQIKS+I ++NANQGGEL   DG+ PLD+VVRILNNQLSSL+
Sbjct  491  DAMYEQAEFIEREMEQMTEQIKSVIQTVNANQGGELDAIDGMTPLDMVVRILNNQLSSLM  550

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKLA QGS+ADR   G +F
Sbjct  551  WIDEKAEEFSSRIQKLANQGSAADRQFLGLKF  582



>ref|XP_008375784.1| PREDICTED: uncharacterized protein DDB_G0274915 [Malus domestica]
Length=723

 Score =   241 bits (616),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA+LERQLELIETHQ EVDKALQSMEEEA RIYKDER +L DDEAA TR
Sbjct  569  LEIEVAKVVETQANLERQLELIETHQQEVDKALQSMEEEAERIYKDERGLLRDDEAASTR  628

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEFVERE+E++ EQIKSII +LNANQGGEL   DG+ PLDVVVRILNNQLSSL+
Sbjct  629  DAMYEQAEFVERELEQVTEQIKSIIQTLNANQGGELDTNDGMAPLDVVVRILNNQLSSLM  688

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKLA +G +ADR L  P++
Sbjct  689  WIDEKAEEFSSRIQKLANEGPAADRELMAPKY  720



>gb|KFK37295.1| hypothetical protein AALP_AA4G238800 [Arabis alpina]
Length=741

 Score =   241 bits (616),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 132/151 (87%), Gaps = 2/151 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELIETHQ EVDKALQSMEEEA RIY DER+ LLDDEAA TR
Sbjct  587  LEIEVAKVVETQSSLERQLELIETHQQEVDKALQSMEEEAERIYNDERKSLLDDEAASTR  646

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E VERE+E M EQIKSII S+NANQGGEL   DG++PLDVVVRILNNQLSSL+
Sbjct  647  DAMYEQSELVERELEHMTEQIKSIIQSVNANQGGELEAIDGMSPLDVVVRILNNQLSSLM  706

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPR  254
            W+DEKAE+ SSRIQK+A QGS +DR L  P+
Sbjct  707  WIDEKAEEFSSRIQKIATQGSGSDRELMAPK  737



>dbj|BAO49732.1| nuclear pore complex protein Nup62a [Nicotiana benthamiana]
Length=742

 Score =   241 bits (616),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 126/155 (81%), Positives = 139/155 (90%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LESEV KVVETQ SLERQLELIETHQ+EVDKALQSMEEEA RIYKDER ++LDDEAA TR
Sbjct  588  LESEVGKVVETQTSLERQLELIETHQEEVDKALQSMEEEADRIYKDERGVILDDEAASTR  647

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELT--DGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEFVEREMEKM EQIKSIIN+LNA+QGGEL   DG+ PLDVVVRILNNQLSSL+
Sbjct  648  DAMYEQAEFVEREMEKMTEQIKSIINALNASQGGELEAPDGMTPLDVVVRILNNQLSSLM  707

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEKAE+ SSRIQKLA +GS+A+R LTGP+   T
Sbjct  708  WIDEKAEEFSSRIQKLASEGSAANRELTGPKLWLT  742



>ref|XP_010325475.1| PREDICTED: uncharacterized protein DDB_G0274915 [Solanum lycopersicum]
Length=758

 Score =   241 bits (616),  Expect = 9e-71, Method: Composition-based stats.
 Identities = 123/155 (79%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LESEVAKVVETQ SLERQLELIETHQ+EVDKALQSMEEEA RIYKDER ++LDDEAA TR
Sbjct  603  LESEVAKVVETQGSLERQLELIETHQEEVDKALQSMEEEAERIYKDERGVILDDEAAATR  662

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEFVEREMEKM EQIKSIIN+ NA QGGEL  TDG+ PLDVVVRILNNQLSSL+
Sbjct  663  DAMYEQAEFVEREMEKMTEQIKSIINTFNACQGGELEATDGMTPLDVVVRILNNQLSSLM  722

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEK E+ SSRIQKLA +G +A+R  T P+   T
Sbjct  723  WIDEKTEEFSSRIQKLASEGPAANRESTAPKLWLT  757



>ref|XP_007052220.1| Structural constituent of nuclear pore isoform 2, partial [Theobroma 
cacao]
 gb|EOX96377.1| Structural constituent of nuclear pore isoform 2, partial [Theobroma 
cacao]
Length=576

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVE QASLERQLELIETHQ EVDKAL SMEEEA RIYKDER +LLDDEAA TR
Sbjct  422  LEIEVAKVVEAQASLERQLELIETHQQEVDKALLSMEEEAERIYKDERGLLLDDEAASTR  481

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE VERE+E+M EQIKSII ++N++QGGEL   DG+ PLDVVVRILNNQL+SL+
Sbjct  482  DAMYEQAEIVERELEQMAEQIKSIIETVNSSQGGELEALDGMTPLDVVVRILNNQLTSLM  541

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKLA QGS+ADR L  P+F
Sbjct  542  WIDEKAEEFSSRIQKLAMQGSAADRELMAPKF  573



>ref|XP_008232542.1| PREDICTED: uncharacterized protein DDB_G0274915 [Prunus mume]
Length=735

 Score =   240 bits (612),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA+LERQLELIETHQ EVDKALQSMEEEA RIYKDER ++LDDEAA TR
Sbjct  581  LEIEVAKVVETQANLERQLELIETHQQEVDKALQSMEEEAERIYKDERGLVLDDEAASTR  640

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEF+ERE+E++ EQIKSII +LNANQGGEL   DG+ PLDVVVRILNNQLSSL+
Sbjct  641  DAMYEQAEFIERELEQVTEQIKSIIQTLNANQGGELDTNDGMAPLDVVVRILNNQLSSLM  700

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKLA QG +ADR L  P++
Sbjct  701  WIDEKAEEFSSRIQKLANQGPAADRELMSPKY  732



>dbj|BAO49733.1| nuclear pore complex protein Nup62b [Nicotiana benthamiana]
Length=756

 Score =   239 bits (611),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LESEVAKVVETQ SLERQLELIETHQ+EVDKALQSMEEEA RIYKDER ++LDDEAA TR
Sbjct  602  LESEVAKVVETQTSLERQLELIETHQEEVDKALQSMEEEADRIYKDERGVILDDEAASTR  661

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELT--DGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEFVEREMEKM E+IKSIIN+LNA+QGGEL   DG+ PLD+VVRILNNQLSSL+
Sbjct  662  DAMYEQAEFVEREMEKMTEKIKSIINTLNASQGGELEAPDGMTPLDIVVRILNNQLSSLM  721

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEKAE+ SSRIQKLA +GS+A+R LTGP+   T
Sbjct  722  WIDEKAEEFSSRIQKLASEGSAANRELTGPKLWLT  756



>ref|XP_011033063.1| PREDICTED: nuclear pore complex protein NUP62 [Populus euphratica]
Length=1436

 Score =   244 bits (622),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 2/152 (1%)
 Frame = -2

Query  700   LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
             LE EVAKVVETQA+LER+LELIETHQ EVDKALQS+EEEA RIYKDER  LLDDEAA TR
Sbjct  1285  LEIEVAKVVETQANLERKLELIETHQQEVDKALQSIEEEAERIYKDERGSLLDDEAASTR  1344

Query  520   DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
             DAMYEQAEF+EREME+M EQIKS+I ++NANQGGEL   DG+ PLD+VVRILNNQLSSL+
Sbjct  1345  DAMYEQAEFIEREMEQMTEQIKSVIQTVNANQGGELDAIDGMTPLDMVVRILNNQLSSLM  1404

Query  346   WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
             W+DEKAE+ SSRIQKLA QGS+ADR   G RF
Sbjct  1405  WIDEKAEEFSSRIQKLANQGSAADRQFLGLRF  1436



>emb|CDX74703.1| BnaA05g04490D [Brassica napus]
Length=736

 Score =   238 bits (608),  Expect = 9e-70, Method: Composition-based stats.
 Identities = 118/147 (80%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELI+THQ EVDKALQSMEEEA RIY DER+ LLDDEAA TR
Sbjct  581  LEIEVAKVVETQSSLERQLELIDTHQQEVDKALQSMEEEAERIYNDERKSLLDDEAASTR  640

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E VERE+E M EQI+SII S+NANQGGEL   DG+NPLDVVVRILNNQLSSL+
Sbjct  641  DAMYEQSELVERELEHMTEQIRSIIQSVNANQGGELEAVDGMNPLDVVVRILNNQLSSLM  700

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGL  266
            W+DEKAE+ SSRIQK+A QGS ADR L
Sbjct  701  WIDEKAEEFSSRIQKIASQGSGADREL  727



>ref|XP_007144284.1| hypothetical protein PHAVU_007G143400g, partial [Phaseolus vulgaris]
 gb|ESW16278.1| hypothetical protein PHAVU_007G143400g, partial [Phaseolus vulgaris]
Length=252

 Score =   226 bits (576),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ++LERQLELIETHQ EVDKALQSMEEEA RIYKDER +LLDDEAA TR
Sbjct  98   LEIEVAKVVETQSNLERQLELIETHQHEVDKALQSMEEEAERIYKDERGLLLDDEAASTR  157

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E +ERE+E+M EQIKS+I SLN+NQGGEL   DG+ PLD VVRILNNQL+SL+
Sbjct  158  DAMYEQSELIERELEQMTEQIKSVIQSLNSNQGGELDTLDGMTPLDAVVRILNNQLTSLM  217

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGP  257
            W+DEKAE+ SSRIQKL+ QGS++D    GP
Sbjct  218  WIDEKAEEFSSRIQKLSNQGSASDHEPMGP  247



>ref|XP_009143093.1| PREDICTED: uncharacterized protein DDB_G0274915 [Brassica rapa]
Length=784

 Score =   238 bits (608),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 118/147 (80%), Positives = 130/147 (88%), Gaps = 2/147 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELI+THQ EVDKALQSMEEEA RIY DER+ LLDDEAA TR
Sbjct  629  LEIEVAKVVETQSSLERQLELIDTHQQEVDKALQSMEEEAERIYNDERKSLLDDEAASTR  688

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E VERE+E M EQI+SII S+NANQGGEL   DG+NPLDVVVRILNNQLSSL+
Sbjct  689  DAMYEQSELVERELEHMTEQIRSIIQSVNANQGGELEAVDGMNPLDVVVRILNNQLSSLM  748

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGL  266
            W+DEKAE+ SSRIQK+A QGS ADR L
Sbjct  749  WIDEKAEEFSSRIQKIASQGSGADREL  775



>emb|CDP09469.1| unnamed protein product [Coffea canephora]
Length=752

 Score =   238 bits (607),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 116/155 (75%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQA+LER LELIETHQ+EVDK+L SMEEEA RIYKDER +LLDDEAA TR
Sbjct  598  LETEVAKVVETQANLERHLELIETHQEEVDKSLLSMEEEAERIYKDERALLLDDEAASTR  657

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEF+ERE+E+M EQIK II +LN +QGGEL  TDG++PLDVVVRILNNQLSSL+
Sbjct  658  DAMYEQAEFIERELEQMTEQIKGIITTLNRSQGGELEATDGMSPLDVVVRILNNQLSSLM  717

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEKAE+ SSRIQK+A QG + DR + GP+   T
Sbjct  718  WIDEKAEEFSSRIQKIASQGPAVDRQMMGPKHWLT  752



>ref|XP_010508222.1| PREDICTED: uncharacterized protein DDB_G0274915-like [Camelina 
sativa]
Length=732

 Score =   238 bits (606),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 132/151 (87%), Gaps = 2/151 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELIETHQ EVDKALQSMEEEA RIY DER+ LLDDEAA TR
Sbjct  578  LEIEVAKVVETQSSLERQLELIETHQQEVDKALQSMEEEAERIYNDERKSLLDDEAASTR  637

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E VERE+E M EQI+SII S+NANQGGEL   DG++PLDVVVRILNNQLSSL+
Sbjct  638  DAMYEQSELVERELEHMTEQIRSIIQSVNANQGGELEAIDGMSPLDVVVRILNNQLSSLM  697

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPR  254
            W+DEKAE+ SSRIQK+A QGSS DR L  P+
Sbjct  698  WIDEKAEEFSSRIQKIASQGSSGDRELMAPK  728



>gb|KHN20170.1| Nuclear pore glycoprotein p62 [Glycine soja]
Length=250

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ++LERQLELIETHQ EVDKALQSMEEEA  IYKDER +LLDDEAA TR
Sbjct  96   LEIEVAKVVETQSNLERQLELIETHQQEVDKALQSMEEEAECIYKDERGLLLDDEAASTR  155

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGE--LTDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E +ERE+E+M EQIKSII SLN+NQGGE    DG+ PLD VVRILNNQL+SL+
Sbjct  156  DAMYEQSELIERELEQMTEQIKSIIQSLNSNQGGEHDTLDGMTPLDAVVRILNNQLTSLM  215

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTG  260
            W+DEKAE+ SSRIQKLA  GS++DR LTG
Sbjct  216  WIDEKAEEFSSRIQKLANPGSASDRELTG  244



>ref|XP_002880150.1| hypothetical protein ARALYDRAFT_483630 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56409.1| hypothetical protein ARALYDRAFT_483630 [Arabidopsis lyrata subsp. 
lyrata]
Length=737

 Score =   237 bits (605),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 132/151 (87%), Gaps = 2/151 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELIETHQ EVDKALQSMEEEA RIY DER+ LLDDEAA TR
Sbjct  583  LEIEVAKVVETQSSLERQLELIETHQQEVDKALQSMEEEAERIYNDERKSLLDDEAASTR  642

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E VERE+E M EQI+SII S+NANQGGEL   DG++PLDVVVRILNNQLSSL+
Sbjct  643  DAMYEQSELVERELEHMTEQIRSIIQSVNANQGGELEAIDGMSPLDVVVRILNNQLSSLM  702

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPR  254
            W+DEKAE+ SSRIQK+A QGSS DR L  P+
Sbjct  703  WIDEKAEEFSSRIQKIASQGSSGDRELMAPK  733



>ref|NP_850429.1| protein EMBRYO DEFECTIVE 2766 [Arabidopsis thaliana]
 sp|Q8L7F7.1|NUP62_ARATH RecName: Full=Nuclear pore complex protein NUP62; AltName: Full=Nucleoporin 
62; Short=NP62; AltName: Full=Protein EMBRYO 
DEFECTIVE 2766 [Arabidopsis thaliana]
 gb|AAM91808.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10495.1| structural constituent of nuclear pore [Arabidopsis thaliana]
Length=739

 Score =   237 bits (604),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 118/151 (78%), Positives = 131/151 (87%), Gaps = 2/151 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELIETHQ EVDKALQSMEEEA RIY DER+ LLDDEAA TR
Sbjct  585  LEIEVAKVVETQSSLERQLELIETHQQEVDKALQSMEEEAERIYNDERKSLLDDEAASTR  644

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E VERE+E M EQI+SII S+NANQGGEL   DG++PLDVVVRILNNQLSSL+
Sbjct  645  DAMYEQSELVERELEHMTEQIRSIIQSVNANQGGELEAIDGMSPLDVVVRILNNQLSSLM  704

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPR  254
            W+DEKAE+ SSRIQK+A QGS  DR L  P+
Sbjct  705  WIDEKAEEFSSRIQKIALQGSGGDRELMAPK  735



>ref|XP_002511630.1| structural constituent of nuclear pore, putative [Ricinus communis]
 gb|EEF50299.1| structural constituent of nuclear pore, putative [Ricinus communis]
Length=811

 Score =   237 bits (605),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA+LERQLELIETHQ EVDKA+QSMEEEA RIYKDER +LLDDEAA TR
Sbjct  657  LEIEVAKVVETQANLERQLELIETHQQEVDKAVQSMEEEAERIYKDERGLLLDDEAASTR  716

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE VERE+E+M +QIKS+I++LNA+QGGEL   D + PLDVVVRILNNQLSSL+
Sbjct  717  DAMYEQAELVERELEQMTQQIKSVIDTLNASQGGELDTIDRMTPLDVVVRILNNQLSSLM  776

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKLA QGS+ADR L GP+F
Sbjct  777  WIDEKAEEFSSRIQKLATQGSAADRELMGPKF  808



>ref|XP_010518110.1| PREDICTED: uncharacterized protein DDB_G0274915-like [Camelina 
sativa]
Length=761

 Score =   236 bits (603),  Expect = 7e-69, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 132/151 (87%), Gaps = 2/151 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELIETHQ EVDKALQSMEEEA RIY DER+ LLDDEAA TR
Sbjct  607  LEIEVAKVVETQSSLERQLELIETHQQEVDKALQSMEEEAERIYNDERKSLLDDEAASTR  666

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E VERE+E M EQI+SII S+NANQGGEL   DG++PLDVVVRILNNQLSSL+
Sbjct  667  DAMYEQSELVERELEHMTEQIRSIIQSVNANQGGELEAIDGMSPLDVVVRILNNQLSSLM  726

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPR  254
            W+DEKAE+ SSRIQK+A QGSS DR L  P+
Sbjct  727  WIDEKAEEFSSRIQKIASQGSSGDRELMAPK  757



>ref|XP_010506438.1| PREDICTED: uncharacterized protein DDB_G0274915-like [Camelina 
sativa]
Length=713

 Score =   236 bits (601),  Expect = 7e-69, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 132/151 (87%), Gaps = 2/151 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELIETHQ EVDKALQSMEEEA RIY DER+ LLDDEAA TR
Sbjct  559  LEIEVAKVVETQSSLERQLELIETHQQEVDKALQSMEEEAERIYNDERKSLLDDEAASTR  618

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E VERE+E M EQI+SII S+NANQGGEL   DG++PLDVVVRILNNQLSSL+
Sbjct  619  DAMYEQSELVERELEHMTEQIRSIIQSVNANQGGELEAIDGMSPLDVVVRILNNQLSSLM  678

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPR  254
            W+DEKAE+ SSRIQK+A QGSS DR L  P+
Sbjct  679  WIDEKAEEFSSRIQKIASQGSSGDRELMAPK  709



>ref|XP_006397681.1| hypothetical protein EUTSA_v10001339mg [Eutrema salsugineum]
 gb|ESQ39134.1| hypothetical protein EUTSA_v10001339mg [Eutrema salsugineum]
Length=700

 Score =   235 bits (600),  Expect = 7e-69, Method: Composition-based stats.
 Identities = 118/151 (78%), Positives = 132/151 (87%), Gaps = 2/151 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELIETHQ EVD+ALQSMEEEA RIY DER+ LLDDEAA TR
Sbjct  546  LEIEVAKVVETQSSLERQLELIETHQQEVDRALQSMEEEAERIYNDERKSLLDDEAASTR  605

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E VERE+E M EQI+SII S+NANQGGEL   DG++PLDVVVRILNNQLSSL+
Sbjct  606  DAMYEQSELVERELEHMTEQIRSIIQSVNANQGGELEAVDGMSPLDVVVRILNNQLSSLM  665

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPR  254
            W+DEKAE+ SSRIQK+A QGS ADR L  P+
Sbjct  666  WIDEKAEEFSSRIQKIASQGSGADRELIAPK  696



>ref|XP_010053963.1| PREDICTED: uncharacterized protein DDB_G0274915-like [Eucalyptus 
grandis]
 gb|KCW78342.1| hypothetical protein EUGRSUZ_D02512 [Eucalyptus grandis]
Length=779

 Score =   235 bits (600),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQASLERQLELIETHQ EVDKALQS+E EA RIYKDE  +LLDDEAA TR
Sbjct  625  LEIEVAKVVETQASLERQLELIETHQQEVDKALQSIEGEAERIYKDEHGLLLDDEAASTR  684

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE +ERE+E+M EQIK++I +LN++QGGEL   DG+ PLDVVVRILNNQLSSL+
Sbjct  685  DAMYEQAELIERELEQMTEQIKTVIQTLNSSQGGELDTIDGMTPLDVVVRILNNQLSSLM  744

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            WVDEKAE+ SSRIQKLARQGS+A+R L GP+ 
Sbjct  745  WVDEKAEEFSSRIQKLARQGSAAERELMGPKL  776



>ref|XP_010661352.1| PREDICTED: nuclear pore complex protein NUP62 [Vitis vinifera]
 emb|CBI16624.3| unnamed protein product [Vitis vinifera]
Length=808

 Score =   235 bits (600),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 117/152 (77%), Positives = 133/152 (88%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA LERQLELIETHQ EVDKAL S+EEEA RIYKDER +LLDDEAA TR
Sbjct  654  LEIEVAKVVETQAQLERQLELIETHQQEVDKALLSIEEEAERIYKDERGLLLDDEAASTR  713

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEF+EREME+M EQIKSII +LN NQGGEL   DG+ PLDV+VRILNNQLSSL+
Sbjct  714  DAMYEQAEFIEREMEQMTEQIKSIIQTLNTNQGGELDVMDGMTPLDVIVRILNNQLSSLM  773

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKA++ +SRIQKLA QGS+++ G  GP+F
Sbjct  774  WIDEKAQEFNSRIQKLASQGSTSEHGSMGPKF  805



>ref|XP_006573216.1| PREDICTED: uncharacterized protein DDB_G0274915-like [Glycine 
max]
Length=758

 Score =   233 bits (595),  Expect = 9e-68, Method: Composition-based stats.
 Identities = 115/149 (77%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ++LERQLELIETHQ EVDKALQSMEEEA  IYKDER +LLDDEAA TR
Sbjct  604  LEIEVAKVVETQSNLERQLELIETHQQEVDKALQSMEEEAECIYKDERGLLLDDEAASTR  663

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGE--LTDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E +ERE+E+M EQIKSII SLN+NQGGE    DG+ PLD VVRILNNQL+SL+
Sbjct  664  DAMYEQSELIERELEQMTEQIKSIIQSLNSNQGGEHDTLDGMTPLDAVVRILNNQLTSLM  723

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTG  260
            W+DEKAE+ SSRIQKLA  GS++DR LTG
Sbjct  724  WIDEKAEEFSSRIQKLANPGSASDRELTG  752



>ref|XP_010692120.1| PREDICTED: nuclear pore complex protein NUP62 [Beta vulgaris 
subsp. vulgaris]
Length=638

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 131/151 (87%), Gaps = 2/151 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ++LERQLELIETHQ EVDKAL+S+EEEA RIYKDER  LLDDEAA TR
Sbjct  485  LETEVAKVVETQSNLERQLELIETHQQEVDKALESIEEEAERIYKDERVSLLDDEAASTR  544

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE  E+E+E M EQIKSII SLNA+QGGEL  T+G+ PLDVVVRILNNQLSSL+
Sbjct  545  DAMYEQAESFEKELEHMTEQIKSIIQSLNASQGGELDTTEGMGPLDVVVRILNNQLSSLM  604

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPR  254
            W+DEKAE+ S RIQ LA QGS+ADR L  PR
Sbjct  605  WIDEKAEEFSVRIQNLASQGSAADRELVAPR  635



>ref|XP_007052219.1| Structural constituent of nuclear pore isoform 1 [Theobroma cacao]
 ref|XP_007052221.1| Structural constituent of nuclear pore isoform 1 [Theobroma cacao]
 gb|EOX96376.1| Structural constituent of nuclear pore isoform 1 [Theobroma cacao]
 gb|EOX96378.1| Structural constituent of nuclear pore isoform 1 [Theobroma cacao]
Length=778

 Score =   231 bits (589),  Expect = 7e-67, Method: Composition-based stats.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVE QASLERQLELIETHQ EVDKAL SMEEEA RIYKDER +LLDDEAA TR
Sbjct  624  LEIEVAKVVEAQASLERQLELIETHQQEVDKALLSMEEEAERIYKDERGLLLDDEAASTR  683

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELT--DGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE VERE+E+M EQIKSII ++N++QGGEL   DG+ PLDVVVRILNNQL+SL+
Sbjct  684  DAMYEQAEIVERELEQMAEQIKSIIETVNSSQGGELEALDGMTPLDVVVRILNNQLTSLM  743

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKLA QGS+ADR L  P+F
Sbjct  744  WIDEKAEEFSSRIQKLAMQGSAADRELMAPKF  775



>gb|KDP41346.1| hypothetical protein JCGZ_15753 [Jatropha curcas]
Length=791

 Score =   231 bits (589),  Expect = 9e-67, Method: Composition-based stats.
 Identities = 117/152 (77%), Positives = 134/152 (88%), Gaps = 3/152 (2%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQASLERQLELIETHQ EVDKALQSMEEEA RIYKDER +LLDDEAA TR
Sbjct  639  LEIEVAKVVETQASLERQLELIETHQQEVDKALQSMEEEAERIYKDERGLLLDDEAASTR  698

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE +ER++E M EQ+KS+I++LN++QGGEL   D + PLDVVVRILNNQLSSL+
Sbjct  699  DAMYEQAELIERDLEHMTEQVKSVIDTLNSSQGGELDTIDRMTPLDVVVRILNNQLSSLM  758

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKLA QGS+A+  L GP+F
Sbjct  759  WIDEKAEEFSSRIQKLATQGSAAE-DLLGPKF  789



>ref|XP_003539122.1| PREDICTED: uncharacterized protein DDB_G0274915-like [Glycine 
max]
Length=761

 Score =   229 bits (584),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 113/149 (76%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ++LERQLELIETHQ EVDKALQSMEEEA  IYKDER +L DDEAA TR
Sbjct  607  LEIEVAKVVETQSNLERQLELIETHQQEVDKALQSMEEEAECIYKDERGLLHDDEAASTR  666

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGE--LTDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E +ERE+E+M EQIKS+I SLN+NQGGE    DG+ PLD VVRILNNQL+SL+
Sbjct  667  DAMYEQSELIERELEQMTEQIKSVIQSLNSNQGGEHDTLDGMTPLDAVVRILNNQLTSLM  726

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTG  260
            W+DEKAE+ SSRIQKLA  GS+ DR LTG
Sbjct  727  WIDEKAEEFSSRIQKLANPGSATDRELTG  755



>ref|XP_010524415.1| PREDICTED: nuclear pore complex protein DDB_G0274915 homolog 
[Tarenaya hassleriana]
Length=758

 Score =   229 bits (584),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 2/144 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQASLERQLELIETHQ EVDKALQSMEEEA RIY DER +LLDDEAA TR
Sbjct  606  LEIEVAKVVETQASLERQLELIETHQQEVDKALQSMEEEAERIYNDERRLLLDDEAASTR  665

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E +ERE+E M EQI+SII  +NANQGGEL   DG+ PLDVVVRILNNQLSSL+
Sbjct  666  DAMYEQSESIERELEHMTEQIRSIIQVVNANQGGELEAIDGMTPLDVVVRILNNQLSSLM  725

Query  346  WVDEKAEDLSSRIQKLARQGSSAD  275
            W+DEKAE+ SSRIQKLA QGS++D
Sbjct  726  WIDEKAEEFSSRIQKLASQGSASD  749



>ref|XP_010923084.1| PREDICTED: nuclear pore complex protein NUP62 isoform X3 [Elaeis 
guineensis]
Length=681

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA RIYKDE  +LL+D AA+ R
Sbjct  527  LEAEVAKVVETQTSLERQLELIETHQQEVDKALQSMEEEAERIYKDEHGLLLEDNAAFAR  586

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D+MYE+AEF+EREM++M EQIKSII ++NA+QGG+    DG+ P+DV VR+LNNQLSSL+
Sbjct  587  DSMYERAEFIEREMQQMAEQIKSIIQTVNASQGGDFDVVDGMTPIDVAVRVLNNQLSSLM  646

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DE+A + SSRIQKLA +G+  +R LTGPRF
Sbjct  647  WIDERANEFSSRIQKLASRGAVVERDLTGPRF  678



>emb|CDY18959.1| BnaC04g03910D [Brassica napus]
Length=703

 Score =   228 bits (580),  Expect = 5e-66, Method: Composition-based stats.
 Identities = 116/147 (79%), Positives = 128/147 (87%), Gaps = 2/147 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELI+THQ EVDKAL SMEEEA RIY DER+ LLDDEAA TR
Sbjct  548  LEIEVAKVVETQSSLERQLELIDTHQQEVDKALLSMEEEAERIYNDERKSLLDDEAASTR  607

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E VERE+E M EQI+SII S+NANQGGEL   DG+N LDVVVRILNNQLSSL+
Sbjct  608  DAMYEQSELVERELEHMTEQIRSIIQSVNANQGGELEAVDGMNALDVVVRILNNQLSSLM  667

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGL  266
            W+DEKAE+ SSRIQK+A QGS ADR L
Sbjct  668  WIDEKAEEFSSRIQKIASQGSGADREL  694



>emb|CAN81311.1| hypothetical protein VITISV_016403 [Vitis vinifera]
Length=279

 Score =   217 bits (552),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 134/192 (70%), Gaps = 39/192 (20%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDE--------------------------------  617
            LE EVAKVVETQA LERQLELIETHQ E                                
Sbjct  88   LEIEVAKVVETQAQLERQLELIETHQQEDMLLVGHACCEVKFMEYSSCDKRNKKCDVVLQ  147

Query  616  -----VDKALQSMEEEAGRIYKDEREMLLDDEAAYTRDAMYEQAEFVEREMEKMMEQIKS  452
                 VDKAL S+EEEA RIYKDER +LLDDEAA TRDAMYEQAEF+EREME+M EQIKS
Sbjct  148  ASIRKVDKALLSIEEEAERIYKDERGLLLDDEAASTRDAMYEQAEFIEREMEQMTEQIKS  207

Query  451  IINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLVWVDEKAEDLSSRIQKLARQGSSA  278
            II +LN NQGGEL   DG+ PLDV+VRILNNQLSSL+W+DEKA++ +SRIQKLA QGS++
Sbjct  208  IIQTLNTNQGGELDVMDGMTPLDVIVRILNNQLSSLMWIDEKAQEFNSRIQKLASQGSTS  267

Query  277  DRGLTGPRFLFT  242
            + G  GP+F  +
Sbjct  268  EHGSMGPKFWMS  279



>ref|XP_009373200.1| PREDICTED: uncharacterized protein DDB_G0274915 [Pyrus x bretschneideri]
Length=728

 Score =   227 bits (579),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA+LERQLELIETHQ EVDKALQSMEEEA RIYKDE  +L DDEAA TR
Sbjct  574  LEIEVAKVVETQANLERQLELIETHQQEVDKALQSMEEEAERIYKDEHGLLRDDEAASTR  633

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAEFVERE+E++ EQIKSII +LNANQGGEL   DG+ PLDVVVRILNNQLSSL+
Sbjct  634  DAMYEQAEFVERELEQVTEQIKSIIQTLNANQGGELDANDGMAPLDVVVRILNNQLSSLM  693

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKLA +G +ADR L  P++
Sbjct  694  WIDEKAEEFSSRIQKLANEGPAADRELMAPKY  725



>ref|XP_011469208.1| PREDICTED: nuclear pore complex protein NUP62 [Fragaria vesca 
subsp. vesca]
Length=756

 Score =   228 bits (580),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 113/152 (74%), Positives = 134/152 (88%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVA VV+TQA +ERQLELIETHQDEVDKALQS+E+EA  IY+DER +LL+DEAA TR
Sbjct  602  LEIEVANVVDTQAKVERQLELIETHQDEVDKALQSIEQEAECIYQDERGLLLNDEAASTR  661

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE++ERE+E++ EQIKSII ++NANQGGEL   DG+ PLDVVV+ILNNQLSSL+
Sbjct  662  DAMYEQAEYIERELEQVTEQIKSIIETVNANQGGELDVNDGMAPLDVVVKILNNQLSSLM  721

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKLA QG +ADR L GPR+
Sbjct  722  WIDEKAEEFSSRIQKLANQGPAADRELMGPRY  753



>ref|XP_010258846.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Nelumbo 
nucifera]
Length=764

 Score =   224 bits (571),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA+LERQLELIETHQ EVDKALQS+EEEA R+YKDER +LL+DEAA  R
Sbjct  610  LEIEVAKVVETQANLERQLELIETHQQEVDKALQSIEEEADRVYKDERGLLLEDEAASAR  669

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE +EREME+M EQIKSII +LN +QGG+L   DG+ PLDVVVRILNNQLSSL+
Sbjct  670  DAMYEQAELIEREMEQMAEQIKSIIQTLNTSQGGDLDAIDGMTPLDVVVRILNNQLSSLM  729

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKA + SSRIQ+LA +GS+A++ L G RF
Sbjct  730  WIDEKAGEFSSRIQQLASRGSAANQDLAGSRF  761



>ref|XP_009412577.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Musa 
acuminata subsp. malaccensis]
Length=748

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ +L RQLELIETHQ E+DKAL+SMEEEA RIYKDER +LL+DEA   R
Sbjct  594  LEAEVAKVVETQTNLVRQLELIETHQQEIDKALESMEEEAERIYKDERALLLEDEATSVR  653

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGG--ELTDGVNPLDVVVRILNNQLSSLV  347
            D+MYEQAEF+EREM+KM EQ+KS+I ++N++QGG  ++ DG+ PLDVVVRILNNQLS+L+
Sbjct  654  DSMYEQAEFIEREMQKMAEQVKSVIQTVNSSQGGDMDMVDGMTPLDVVVRILNNQLSTLM  713

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKA + S +IQK+A  G++A+RG T PRF
Sbjct  714  WIDEKANEFSDQIQKVANSGAAAERGSTAPRF  745



>ref|XP_008785384.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Phoenix 
dactylifera]
Length=714

 Score =   221 bits (564),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 109/152 (72%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA RIYKDER +LL+DEAA  R
Sbjct  560  LEAEVAKVVETQTSLERQLELIETHQQEVDKALQSMEEEAERIYKDERGLLLEDEAASAR  619

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGE--LTDGVNPLDVVVRILNNQLSSLV  347
            D+MYE+AEF+EREM++M EQIKSII ++N +QGGE  + DG+ P+DV VR+LNNQLSSL+
Sbjct  620  DSMYERAEFIEREMQQMAEQIKSIIQTVNTSQGGEFDVVDGMTPIDVAVRVLNNQLSSLM  679

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DE+A + S+RIQKLA +G+  +R LTGPRF
Sbjct  680  WIDERANEFSTRIQKLANRGAVVERDLTGPRF  711



>ref|XP_004140612.1| PREDICTED: LOW QUALITY PROTEIN: nucleoporin nsp1-like [Cucumis 
sativus]
Length=755

 Score =   221 bits (563),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 114/153 (75%), Positives = 131/153 (86%), Gaps = 3/153 (2%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA LE++LELIETHQ EVDKAL S+EE+A RIYKDER +LLDDEAA TR
Sbjct  600  LEIEVAKVVETQAELEKKLELIETHQQEVDKALVSVEEDAERIYKDERGLLLDDEAASTR  659

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE++ERE+E+M EQIKSII +LNANQGGEL   DG+ PLD VVRILNNQLSSL+
Sbjct  660  DAMYEQAEYIERELEQMTEQIKSIIQTLNANQGGELDVIDGMTPLDAVVRILNNQLSSLM  719

Query  346  WVDEKAEDLSSRIQKL-ARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKL A +G +ADR L G + 
Sbjct  720  WIDEKAEEFSSRIQKLAATEGPAADRELLGQKL  752



>ref|XP_010923083.1| PREDICTED: nuclear pore complex protein NUP62 isoform X2 [Elaeis 
guineensis]
Length=701

 Score =   220 bits (560),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 108/152 (71%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA RIYKDE  +LL+D AA+ R
Sbjct  547  LEAEVAKVVETQTSLERQLELIETHQQEVDKALQSMEEEAERIYKDEHGLLLEDNAAFAR  606

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGG--ELTDGVNPLDVVVRILNNQLSSLV  347
            D+MYE+AEF+EREM++M EQIKSII ++NA+QGG  ++ DG+ P+DV VR+LNNQLSSL+
Sbjct  607  DSMYERAEFIEREMQQMAEQIKSIIQTVNASQGGDFDVVDGMTPIDVAVRVLNNQLSSLM  666

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DE+A + SSRIQKLA +G+  +R LTGPRF
Sbjct  667  WIDERANEFSSRIQKLASRGAVVERDLTGPRF  698



>ref|XP_010923082.1| PREDICTED: nuclear pore complex protein NUP62 isoform X1 [Elaeis 
guineensis]
Length=731

 Score =   220 bits (560),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 108/152 (71%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA RIYKDE  +LL+D AA+ R
Sbjct  577  LEAEVAKVVETQTSLERQLELIETHQQEVDKALQSMEEEAERIYKDEHGLLLEDNAAFAR  636

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGG--ELTDGVNPLDVVVRILNNQLSSLV  347
            D+MYE+AEF+EREM++M EQIKSII ++NA+QGG  ++ DG+ P+DV VR+LNNQLSSL+
Sbjct  637  DSMYERAEFIEREMQQMAEQIKSIIQTVNASQGGDFDVVDGMTPIDVAVRVLNNQLSSLM  696

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DE+A + SSRIQKLA +G+  +R LTGPRF
Sbjct  697  WIDERANEFSSRIQKLASRGAVVERDLTGPRF  728



>gb|KHG05627.1| Nuclear pore glycoprotein p62 [Gossypium arboreum]
Length=744

 Score =   219 bits (559),  Expect = 8e-63, Method: Composition-based stats.
 Identities = 113/153 (74%), Positives = 131/153 (86%), Gaps = 3/153 (2%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQASLERQLELIETHQ EVDKALQSMEEEA RIYKDE  +LLDDEAA TR
Sbjct  589  LEIEVAKVVETQASLERQLELIETHQQEVDKALQSMEEEAERIYKDEHGLLLDDEAASTR  648

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELT--DGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE VERE+E M EQIKSII ++N++QGGEL   DG+ PLD+VV+ILNNQL+SL+
Sbjct  649  DAMYEQAENVERELEHMTEQIKSIIETVNSSQGGELEALDGMTPLDLVVKILNNQLTSLM  708

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGL-TGPRF  251
            W+DEKAE+ S RI+KLA QG++AD  L   P++
Sbjct  709  WIDEKAEEFSGRIRKLAAQGNAADGELMAAPKY  741



>ref|XP_008459731.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Cucumis 
melo]
Length=761

 Score =   219 bits (559),  Expect = 9e-63, Method: Composition-based stats.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 3/153 (2%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA LE++LELIETHQ EVDKAL S+E++A RIYKDER +LLDDEAA TR
Sbjct  606  LEIEVAKVVETQAELEKKLELIETHQQEVDKALLSVEDDAERIYKDERGLLLDDEAASTR  665

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE++ERE+E+M EQIKSII +LNANQGGEL   DG+ PLD VVRILNNQLSSL+
Sbjct  666  DAMYEQAEYIERELEQMTEQIKSIIQTLNANQGGELDVIDGMTPLDAVVRILNNQLSSLM  725

Query  346  WVDEKAEDLSSRIQKL-ARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKL A +G +ADR L G +F
Sbjct  726  WIDEKAEEFSSRIQKLAATEGPAADRELLGQKF  758



>gb|KJB42510.1| hypothetical protein B456_007G156100 [Gossypium raimondii]
Length=749

 Score =   219 bits (558),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 3/153 (2%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQASLERQLELIETHQ EVDKALQSMEEEA RIYKDER +LLDDEAA TR
Sbjct  594  LEIEVAKVVETQASLERQLELIETHQQEVDKALQSMEEEAERIYKDERGLLLDDEAASTR  653

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELT--DGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE VERE+E M EQIKSII ++N++QGGEL   DG+ PLDVVV+ILNNQL+SL+
Sbjct  654  DAMYEQAENVERELEHMTEQIKSIIETVNSSQGGELEALDGMTPLDVVVKILNNQLTSLM  713

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGL-TGPRF  251
            W+DEKAE+ S RI+KLA QG++AD  L   P++
Sbjct  714  WIDEKAEEFSGRIRKLAAQGNAADGELIAAPKY  746



>ref|XP_004513928.1| PREDICTED: uncharacterized protein DDB_G0274915-like [Cicer arietinum]
Length=748

 Score =   219 bits (557),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 114/150 (76%), Positives = 131/150 (87%), Gaps = 3/150 (2%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ++LERQLELIETHQ EVDKAL S+EEEA RIYKDER +LLDDEAA TR
Sbjct  593  LEIEVAKVVETQSNLERQLELIETHQQEVDKALLSVEEEAERIYKDERGVLLDDEAASTR  652

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E +ERE+E+M EQIKSII SLN+NQGGE+   DG++PLD VVRILNNQL+SL+
Sbjct  653  DAMYEQSELIERELEQMTEQIKSIILSLNSNQGGEVDAPDGMSPLDAVVRILNNQLTSLM  712

Query  346  WVDEKAEDLSSRIQKLARQGS-SADRGLTG  260
            W+DEKAE+ SSRIQKLA QGS S+DR   G
Sbjct  713  WIDEKAEEFSSRIQKLANQGSASSDREQIG  742



>gb|KJB42509.1| hypothetical protein B456_007G156100 [Gossypium raimondii]
Length=788

 Score =   219 bits (557),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 3/153 (2%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQASLERQLELIETHQ EVDKALQSMEEEA RIYKDER +LLDDEAA TR
Sbjct  633  LEIEVAKVVETQASLERQLELIETHQQEVDKALQSMEEEAERIYKDERGLLLDDEAASTR  692

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELT--DGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE VERE+E M EQIKSII ++N++QGGEL   DG+ PLDVVV+ILNNQL+SL+
Sbjct  693  DAMYEQAENVERELEHMTEQIKSIIETVNSSQGGELEALDGMTPLDVVVKILNNQLTSLM  752

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGL-TGPRF  251
            W+DEKAE+ S RI+KLA QG++AD  L   P++
Sbjct  753  WIDEKAEEFSGRIRKLAAQGNAADGELIAAPKY  785



>ref|XP_004164977.1| PREDICTED: nucleoporin nsp1-like [Cucumis sativus]
Length=757

 Score =   217 bits (552),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 114/153 (75%), Positives = 131/153 (86%), Gaps = 3/153 (2%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA LE++LELIETHQ EVDKAL S+EE+A RIYKDER +LLDDEAA TR
Sbjct  602  LEIEVAKVVETQAELEKKLELIETHQQEVDKALVSVEEDAERIYKDERGLLLDDEAASTR  661

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE++ERE+E+M EQIKSII +LNANQGGEL   DG+ PLD VVRILNNQLSSL+
Sbjct  662  DAMYEQAEYIERELEQMTEQIKSIIQTLNANQGGELDVIDGMTPLDAVVRILNNQLSSLM  721

Query  346  WVDEKAEDLSSRIQKL-ARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKL A +G +ADR L G + 
Sbjct  722  WIDEKAEEFSSRIQKLAATEGPAADRELLGQKL  754



>gb|KGN46555.1| hypothetical protein Csa_6G108530 [Cucumis sativus]
Length=901

 Score =   216 bits (551),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 114/153 (75%), Positives = 131/153 (86%), Gaps = 3/153 (2%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQA LE++LELIETHQ EVDKAL S+EE+A RIYKDER +LLDDEAA TR
Sbjct  746  LEIEVAKVVETQAELEKKLELIETHQQEVDKALVSVEEDAERIYKDERGLLLDDEAASTR  805

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQAE++ERE+E+M EQIKSII +LNANQGGEL   DG+ PLD VVRILNNQLSSL+
Sbjct  806  DAMYEQAEYIERELEQMTEQIKSIIQTLNANQGGELDVIDGMTPLDAVVRILNNQLSSLM  865

Query  346  WVDEKAEDLSSRIQKL-ARQGSSADRGLTGPRF  251
            W+DEKAE+ SSRIQKL A +G +ADR L G + 
Sbjct  866  WIDEKAEEFSSRIQKLAATEGPAADRELLGQKL  898



>gb|KJB42513.1| hypothetical protein B456_007G156100 [Gossypium raimondii]
Length=795

 Score =   213 bits (541),  Expect = 4e-60, Method: Composition-based stats.
 Identities = 115/160 (72%), Positives = 132/160 (83%), Gaps = 10/160 (6%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEV-------DKALQSMEEEAGRIYKDEREMLLD  542
            LE EVAKVVETQASLERQLELIETHQ EV       DKALQSMEEEA RIYKDER +LLD
Sbjct  633  LEIEVAKVVETQASLERQLELIETHQQEVFQWFLLVDKALQSMEEEAERIYKDERGLLLD  692

Query  541  DEAAYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELT--DGVNPLDVVVRILN  368
            DEAA TRDAMYEQAE VERE+E M EQIKSII ++N++QGGEL   DG+ PLDVVV+ILN
Sbjct  693  DEAASTRDAMYEQAENVERELEHMTEQIKSIIETVNSSQGGELEALDGMTPLDVVVKILN  752

Query  367  NQLSSLVWVDEKAEDLSSRIQKLARQGSSADRGL-TGPRF  251
            NQL+SL+W+DEKAE+ S RI+KLA QG++AD  L   P++
Sbjct  753  NQLTSLMWIDEKAEEFSGRIRKLAAQGNAADGELIAAPKY  792



>ref|XP_006293763.1| hypothetical protein CARUB_v10022723mg [Capsella rubella]
 gb|EOA26661.1| hypothetical protein CARUB_v10022723mg [Capsella rubella]
Length=723

 Score =   207 bits (527),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 104/136 (76%), Positives = 116/136 (85%), Gaps = 2/136 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQ+SLERQLELIETHQ EVDKALQSMEEEA RIY DER+ LLDDEAA TR
Sbjct  583  LEIEVAKVVETQSSLERQLELIETHQQEVDKALQSMEEEAERIYNDERKSLLDDEAASTR  642

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            DAMYEQ+E VERE+E M EQI+SII S+NANQGGEL   DG++PLDVVVRILNNQLSSL+
Sbjct  643  DAMYEQSELVERELEHMTEQIRSIIQSVNANQGGELEAIDGMSPLDVVVRILNNQLSSLM  702

Query  346  WVDEKAEDLSSRIQKL  299
            W+DEK   ++  I  L
Sbjct  703  WIDEKVSFVNELINCL  718



>ref|XP_001768661.1| predicted protein [Physcomitrella patens]
 gb|EDQ66599.1| predicted protein [Physcomitrella patens]
Length=743

 Score =   204 bits (520),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 100/152 (66%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LESEVA VVE+Q SLERQLELIETHQ EV+K+L+SMEEEA ++Y+DER  LL+DEAA TR
Sbjct  589  LESEVATVVESQHSLERQLELIETHQQEVEKSLESMEEEAEKLYRDERPSLLEDEAAATR  648

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D M+EQAEFVERE+E+M EQIK  I ++NA QGG+L   +G +PLD+VVRILNNQL+SL+
Sbjct  649  DMMFEQAEFVERELERMGEQIKETIQNINAAQGGDLDIAEGASPLDLVVRILNNQLTSLL  708

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKA +LS R+Q  A QG+  D+G  G R 
Sbjct  709  WIDEKAGELSGRMQSFADQGALLDKGHRGSRL  740



>ref|XP_003564647.1| PREDICTED: uncharacterized protein DDB_G0274915 [Brachypodium 
distachyon]
Length=729

 Score =   204 bits (519),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 99/152 (65%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE++VAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA +I++DER +L +DEAA  R
Sbjct  575  LEADVAKVVETQTSLERQLELIETHQREVDKALQSMEEEAEQIFQDERVLLREDEAASAR  634

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D MYEQAE VE E++ M EQ+KSII +LN+ QGGEL  TD + P DV VRIL+NQL SL+
Sbjct  635  DTMYEQAEIVENELQHMTEQVKSIIQTLNSTQGGELEATDSMTPFDVAVRILDNQLRSLM  694

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKA + S+RIQ+L    ++A+R    PRF
Sbjct  695  WIDEKANEFSNRIQRLPNNSAAAERDSGIPRF  726



>dbj|BAJ94031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04351.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   203 bits (517),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 98/155 (63%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE++VAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA RI++DER +L +DEAA  R
Sbjct  562  LEADVAKVVETQTSLERQLELIETHQKEVDKALQSMEEEAERIFQDERVLLREDEAASAR  621

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D MYEQ E VE E+++M EQ+KSII ++N+ QGGEL  TD + P DV VRIL+NQL SL+
Sbjct  622  DIMYEQGEVVENELQRMTEQVKSIIQTMNSTQGGELEATDTMAPFDVAVRILDNQLRSLM  681

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEKA + S+RIQ+L    ++A+R    PRF  +
Sbjct  682  WIDEKANEFSNRIQRLPNNSTAAERDSGIPRFWLS  716



>ref|XP_006645043.1| PREDICTED: nuclear pore glycoprotein p62-like [Oryza brachyantha]
Length=289

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA R+++DER +L +DEAA  R
Sbjct  135  LEAEVAKVVETQTSLERQLELIETHQKEVDKALQSMEEEAERVFQDERLLLREDEAASAR  194

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D M+EQ+E VE E++ M EQ+KSII +LNA QG E    D + P DV VRIL+NQL SL+
Sbjct  195  DTMFEQSETVENELQHMTEQVKSIIQTLNATQGAEFETADNMTPFDVAVRILDNQLRSLM  254

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEKA + S+RIQ+L    ++A+R    PRF  +
Sbjct  255  WIDEKANEFSTRIQRLPNNSAAAERDSGMPRFWLS  289



>gb|EMT32138.1| Nuclear pore glycoprotein p62 [Aegilops tauschii]
Length=420

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE++VAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA RI++DER +L +DEAA  R
Sbjct  266  LEADVAKVVETQTSLERQLELIETHQKEVDKALQSMEEEAERIFQDERVLLREDEAASAR  325

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D MYEQ E VE E++ M EQ+KSII ++N+ QGGEL  TD + P DV VRIL+NQL SL+
Sbjct  326  DIMYEQGEVVENELQHMTEQVKSIIQTMNSTQGGELEATDTMAPFDVAVRILDNQLRSLM  385

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEKA + S+RIQ+L    ++A+R    PRF
Sbjct  386  WIDEKANEFSNRIQRLPNNSTAAERDSGIPRF  417



>emb|CDM85074.1| unnamed protein product [Triticum aestivum]
Length=709

 Score =   201 bits (511),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 99/155 (64%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE++VAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA RI++DER +L +DEAA  R
Sbjct  555  LEADVAKVVETQTSLERQLELIETHQKEVDKALQSMEEEAERIFQDERVLLREDEAASAR  614

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D MYEQAE VE E++ M EQ+KSII ++N+ QGGEL  TD + P DV VRIL+NQL SL+
Sbjct  615  DIMYEQAEVVENELQHMTEQVKSIIQTMNSTQGGELEATDTMAPFDVAVRILDNQLRSLM  674

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEKA + S+RIQ+L    ++A+R    PRF  +
Sbjct  675  WIDEKANEFSNRIQRLPNNSTAAERDSGIPRFWLS  709



>gb|EEC71829.1| hypothetical protein OsI_04485 [Oryza sativa Indica Group]
Length=250

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = -2

Query  694  SEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTRDA  515
            +EVAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA R+++DER +L +DEAA  RD 
Sbjct  98   AEVAKVVETQTSLERQLELIETHQKEVDKALQSMEEEAERVFQDERLLLREDEAASARDT  157

Query  514  MYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLVWV  341
            M+EQ+E VE E++ M EQ+KSII +LNA QG E    D + P DV VRIL+NQL SL+W+
Sbjct  158  MFEQSETVENELQHMTEQVKSIIQTLNATQGAEFETADSMTPFDVAVRILDNQLRSLMWI  217

Query  340  DEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            DEKA + SSRIQ+L    ++A+R    PRF  +
Sbjct  218  DEKANEFSSRIQRLPNNSAAAERDSGMPRFWLS  250



>gb|EMS50822.1| Nuclear pore glycoprotein p62 [Triticum urartu]
Length=309

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = -2

Query  694  SEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTRDA  515
            ++VAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA RI++DER +L +DEAA  RD 
Sbjct  133  ADVAKVVETQTSLERQLELIETHQKEVDKALQSMEEEAERIFQDERVLLREDEAASARDI  192

Query  514  MYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLVWV  341
            MYEQ E VE E++ M EQ+KSII ++N+ QGGEL  TD + P DV VRIL+NQL SL+W+
Sbjct  193  MYEQGEVVENELQHMTEQVKSIIQTMNSTQGGELEATDNMAPFDVAVRILDNQLRSLMWI  252

Query  340  DEKAEDLSSRIQKLARQGSSADRGLTGPRFL  248
            DEKA + S+RIQ+L    ++A+R    PRF 
Sbjct  253  DEKANEFSNRIQRLPNNSTAAERDSGIPRFF  283



>ref|NP_001168960.1| uncharacterized protein LOC100382780 [Zea mays]
 gb|ACN31201.1| unknown [Zea mays]
Length=284

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 116/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ  LERQLELIETHQ EVDKALQSMEEEA R+++DER +L +D AA  R
Sbjct  130  LEAEVAKVVETQTGLERQLELIETHQREVDKALQSMEEEAERVFQDERVLLHEDGAASAR  189

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D MYEQAE VE E++ M EQ+KSII ++NA QGGEL   D + P DV VRIL+NQL SL+
Sbjct  190  DTMYEQAEVVEHELQHMTEQVKSIIQTMNATQGGELESADSMTPFDVAVRILDNQLRSLM  249

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEK  + S RIQ+L     SA+R    PRF  +
Sbjct  250  WIDEKVNEFSGRIQRLPNNSVSAERDSGIPRFWLS  284



>ref|XP_004970627.1| PREDICTED: uncharacterized protein DDB_G0274915-like isoform 
X1 [Setaria italica]
Length=754

 Score =   197 bits (501),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 97/155 (63%), Positives = 116/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ  LERQLELIETHQ EVDKALQ MEEEA RI++DER +L +DEAA  R
Sbjct  600  LEAEVAKVVETQTGLERQLELIETHQREVDKALQGMEEEAERIFQDERVLLREDEAASAR  659

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D MYEQAE VE E++ M EQ+KSII ++NA QG EL   D + P DV VRIL+NQL SL+
Sbjct  660  DTMYEQAEVVEHELQHMTEQVKSIIQTMNATQGAELEAADSMTPFDVAVRILDNQLRSLM  719

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEK  + S RIQ+L    +SA+R    PRF  +
Sbjct  720  WIDEKVNEFSGRIQRLPNNSASAERDSGIPRFWLS  754



>ref|XP_008655236.1| PREDICTED: uncharacterized protein LOC100382780 isoform X1 [Zea 
mays]
Length=734

 Score =   197 bits (500),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 96/155 (62%), Positives = 116/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L++EVAKVVETQ  LERQLELIETHQ EVDKALQSMEEEA R+++DER +L +D AA  R
Sbjct  580  LQAEVAKVVETQTGLERQLELIETHQREVDKALQSMEEEAERVFQDERVLLHEDGAASAR  639

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D MYEQAE VE E++ M EQ+KSII ++NA QGGEL   D + P DV VRIL+NQL SL+
Sbjct  640  DTMYEQAEVVEHELQHMTEQVKSIIQTMNATQGGELESADSMTPFDVAVRILDNQLRSLM  699

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEK  + S RIQ+L     SA+R    PRF  +
Sbjct  700  WIDEKVNEFSGRIQRLPNNSVSAERDSGIPRFWLS  734



>ref|XP_004970628.1| PREDICTED: uncharacterized protein DDB_G0274915-like isoform 
X2 [Setaria italica]
Length=731

 Score =   197 bits (500),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 97/155 (63%), Positives = 116/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ  LERQLELIETHQ EVDKALQ MEEEA RI++DER +L +DEAA  R
Sbjct  577  LEAEVAKVVETQTGLERQLELIETHQREVDKALQGMEEEAERIFQDERVLLREDEAASAR  636

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D MYEQAE VE E++ M EQ+KSII ++NA QG EL   D + P DV VRIL+NQL SL+
Sbjct  637  DTMYEQAEVVEHELQHMTEQVKSIIQTMNATQGAELEAADSMTPFDVAVRILDNQLRSLM  696

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEK  + S RIQ+L    +SA+R    PRF  +
Sbjct  697  WIDEKVNEFSGRIQRLPNNSASAERDSGIPRFWLS  731



>ref|XP_004970629.1| PREDICTED: uncharacterized protein DDB_G0274915-like isoform 
X3 [Setaria italica]
Length=718

 Score =   196 bits (499),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 97/155 (63%), Positives = 116/155 (75%), Gaps = 2/155 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ  LERQLELIETHQ EVDKALQ MEEEA RI++DER +L +DEAA  R
Sbjct  564  LEAEVAKVVETQTGLERQLELIETHQREVDKALQGMEEEAERIFQDERVLLREDEAASAR  623

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D MYEQAE VE E++ M EQ+KSII ++NA QG EL   D + P DV VRIL+NQL SL+
Sbjct  624  DTMYEQAEVVEHELQHMTEQVKSIIQTMNATQGAELEAADSMTPFDVAVRILDNQLRSLM  683

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            W+DEK  + S RIQ+L    +SA+R    PRF  +
Sbjct  684  WIDEKVNEFSGRIQRLPNNSASAERDSGIPRFWLS  718



>ref|XP_006846196.1| hypothetical protein AMTR_s00012p00215820 [Amborella trichopoda]
 gb|ERN07871.1| hypothetical protein AMTR_s00012p00215820 [Amborella trichopoda]
Length=741

 Score =   196 bits (499),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 103/149 (69%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+E+A VVE Q  LERQLELIETHQ EVDKALQS+EEEA R+Y +ER +LL+DE A TR
Sbjct  589  LETELANVVERQHCLERQLELIETHQQEVDKALQSIEEEAERMYNNERGVLLEDEVASTR  648

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D+MYEQAEF+EREME+M EQIKSII +LN NQG +L   DG+ PLDVVVRILNNQLSSL+
Sbjct  649  DSMYEQAEFIEREMEQMSEQIKSIIQTLNTNQGSDLDGMDGMTPLDVVVRILNNQLSSLM  708

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTG  260
            W+DEKA + S RI+KLA  G++ +R L G
Sbjct  709  WIDEKAGEFSLRIKKLADHGAAVERDLPG  737



>gb|EEE55694.1| hypothetical protein OsJ_04120 [Oryza sativa Japonica Group]
Length=307

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ SLERQLELIETHQ EVDKALQSMEEEA R+++DER +L +DEAA  R
Sbjct  76   LEAEVAKVVETQTSLERQLELIETHQKEVDKALQSMEEEAERVFQDERLLLREDEAASAR  135

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D M+EQ+E VE E++ M EQ+KSII +LNA QG E    D + P DV VRIL+NQL SL+
Sbjct  136  DTMFEQSETVENELQHMTEQVKSIIQTLNATQGAEFETADSMTPFDVAVRILDNQLRSLM  195

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGP  257
            W+DEKA + SSRIQ+L    ++A+R    P
Sbjct  196  WIDEKANEFSSRIQRLPNNSAAAERDSGMP  225



>ref|XP_002458789.1| hypothetical protein SORBIDRAFT_03g040330 [Sorghum bicolor]
 gb|EES03909.1| hypothetical protein SORBIDRAFT_03g040330 [Sorghum bicolor]
Length=539

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 117/152 (77%), Gaps = 2/152 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+EVAKVVETQ  LERQLELIETHQ EVDKALQSMEEEA RI++DER +L +D+AA  R
Sbjct  385  LEAEVAKVVETQTGLERQLELIETHQREVDKALQSMEEEAERIFQDERVLLREDDAASAR  444

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D MYEQAE VE E++ M EQ+KSII ++NA QGGEL   D + P DV VRIL+NQL SL+
Sbjct  445  DTMYEQAEVVEHELQHMTEQVKSIIQTMNATQGGELESADSMTPFDVAVRILDNQLRSLM  504

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            W+DEK  + S RIQ+L    +SA+R    PRF
Sbjct  505  WIDEKVNEFSGRIQRLPSNSASAERDSGIPRF  536



>ref|XP_009419737.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Musa 
acuminata subsp. malaccensis]
Length=621

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 123/151 (81%), Gaps = 2/151 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE+E+AKVVETQ +LE+QLELIETHQ EVDKAL+SME+EA  I KDE  +LL+DEA   R
Sbjct  467  LEAEMAKVVETQTNLEKQLELIETHQQEVDKALESMEQEAECICKDECALLLEDEATSVR  526

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDGVNPLDVVVRILNNQLSSLV  347
            D+MY+QAEF+EREM+ + EQ+KSII ++N++Q G+L   D  +PLD+VVRIL+NQL +L+
Sbjct  527  DSMYDQAEFIEREMQGIAEQVKSIIQTVNSSQSGDLDMVDAASPLDIVVRILDNQLRTLM  586

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTGPR  254
            W+DEKA + S +I K+A+ G++ + G+TG R
Sbjct  587  WIDEKANEFSYQIHKVAKSGAADEHGMTGTR  617



>gb|KHN43851.1| Nuclear pore glycoprotein p62 [Glycine soja]
Length=228

 Score =   176 bits (447),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = -2

Query  616  VDKALQSMEEEAGRIYKDEREMLLDDEAAYTRDAMYEQAEFVEREMEKMMEQIKSIINSL  437
            VDKALQSMEEEA  IYKDER +L DDEAA TRDAMYEQ+E +ERE+E+M EQIKS+I SL
Sbjct  102  VDKALQSMEEEAECIYKDERGLLHDDEAASTRDAMYEQSELIERELEQMTEQIKSVIQSL  161

Query  436  NANQGGE--LTDGVNPLDVVVRILNNQLSSLVWVDEKAEDLSSRIQKLARQGSSADRGLT  263
            N+NQGGE    DG+ PLD VVRILNNQL+SL+W+DEKAE+ SSRIQKLA  GS+ DR LT
Sbjct  162  NSNQGGEHDTLDGMTPLDAVVRILNNQLTSLMWIDEKAEEFSSRIQKLANPGSATDRELT  221

Query  262  G  260
            G
Sbjct  222  G  222



>gb|EPS64659.1| hypothetical protein M569_10119 [Genlisea aurea]
Length=225

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LESEVAKVVETQ SLERQLELIETHQDEVD+ALQS++ EA R+Y++ER +LL D+AA TR
Sbjct  76   LESEVAKVVETQGSLERQLELIETHQDEVDRALQSIDSEAERLYREERGLLLSDDAAATR  135

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            DAM+EQ+E VE E+EKM EQ+++II++LN N GG        LDVVV+ILNNQLSSL+W+
Sbjct  136  DAMFEQSEMVEGELEKMTEQLRTIIDTLNGNLGGAAAAANP-LDVVVQILNNQLSSLMWI  194

Query  340  DEKAEDLSSRIQKLARQGSSADRGLTGP  257
            D+KAE+ SSRI++LA+QG  A+R    P
Sbjct  195  DDKAEEFSSRIKRLAKQGGEAERKNQQP  222



>gb|AFW84513.1| hypothetical protein ZEAMMB73_475004 [Zea mays]
Length=120

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = -2

Query  595  MEEEAGRIYKDEREMLLDDEAAYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGE  416
            MEEEA R+++DER +L +D AA  RD MYEQAE VE E++ M EQ+KSII ++NA QGGE
Sbjct  1    MEEEAERVFQDERVLLHEDGAASARDTMYEQAEVVEHELQHMTEQVKSIIQTMNATQGGE  60

Query  415  L--TDGVNPLDVVVRILNNQLSSLVWVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            L   D + P DV VRIL+NQL SL+W+DEK  + S RIQ+L     SA+R    PRF  +
Sbjct  61   LESADSMTPFDVAVRILDNQLRSLMWIDEKVNEFSGRIQRLPNNSVSAERDSGIPRFWLS  120



>ref|NP_001044847.1| Os01g0856600 [Oryza sativa Japonica Group]
 dbj|BAF06761.1| Os01g0856600, partial [Oryza sativa Japonica Group]
Length=244

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 81/114 (71%), Gaps = 2/114 (2%)
 Frame = -2

Query  577  RIYKDEREMLLDDEAAYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGEL--TDG  404
            R+++DER +L +DEAA  RD M+EQ+E VE E++ M EQ+KSII +LNA QG E    D 
Sbjct  131  RVFQDERLLLREDEAASARDTMFEQSETVENELQHMTEQVKSIIQTLNATQGAEFETADS  190

Query  403  VNPLDVVVRILNNQLSSLVWVDEKAEDLSSRIQKLARQGSSADRGLTGPRFLFT  242
            + P DV VRIL+NQL SL+W+DEKA + SSRIQ+L    ++A+R    PRF  +
Sbjct  191  MTPFDVAVRILDNQLRSLMWIDEKANEFSSRIQRLPNNSAAAERDSGMPRFWLS  244



>gb|KJB42512.1| hypothetical protein B456_007G156100 [Gossypium raimondii]
Length=695

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EVAKVVETQASLERQLELIETHQ EVDKALQSMEEEA RIYKDER +LLDDEAA TR
Sbjct  633  LEIEVAKVVETQASLERQLELIETHQQEVDKALQSMEEEAERIYKDERGLLLDDEAASTR  692

Query  520  DAM  512
            DAM
Sbjct  693  DAM  695



>ref|XP_005847401.1| hypothetical protein CHLNCDRAFT_134254 [Chlorella variabilis]
 gb|EFN55299.1| hypothetical protein CHLNCDRAFT_134254 [Chlorella variabilis]
Length=515

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 77/127 (61%), Gaps = 2/127 (2%)
 Frame = -2

Query  679  VVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTRDAMYEQA  500
            VV  Q SLE++L+++ETHQ  +  AL  ME EA R+Y++ER +L DD  +  RD +YE+A
Sbjct  388  VVRGQESLEKKLQMLETHQKGIHDALVGMEGEAERLYREERPLLDDD--SRERDRLYERA  445

Query  499  EFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAEDL  320
            E V   +  + EQ+K  I  +N +    L D   PL   VRILNNQL +L   D + E+L
Sbjct  446  EKVGALLSHLGEQLKEAIADVNDSTSASLGDTAAPLGKAVRILNNQLQALAQADARIEEL  505

Query  319  SSRIQKL  299
            S R+  L
Sbjct  506  SQRVADL  512



>ref|XP_011396612.1| Nuclear pore glycoprotein p62 [Auxenochlorella protothecoides]
 gb|KFM23736.1| Nuclear pore glycoprotein p62 [Auxenochlorella protothecoides]
Length=179

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 75/134 (56%), Gaps = 2/134 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE EV KV+  Q +LER+L +++THQ  + + L  ME EA R+ ++E    L DE    R
Sbjct  44   LEQEVRKVLHAQEALERKLAMLDTHQRGIHETLTGMEHEAARLAQEEAG--LQDEGTRDR  101

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            D +Y +AE V  ++  +   +   +  +NAN    L D  +PL  VVRILNN L +L  +
Sbjct  102  DVLYARAERVGAQLADLGALLHRTVADINANTAASLGDTDSPLGKVVRILNNNLQALALI  161

Query  340  DEKAEDLSSRIQKL  299
            D + E+   R+  L
Sbjct  162  DARTEEARVRLNSL  175



>ref|XP_005651822.1| hypothetical protein COCSUDRAFT_38998 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27278.1| hypothetical protein COCSUDRAFT_38998 [Coccomyxa subellipsoidea 
C-169]
Length=647

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 80/135 (59%), Gaps = 9/135 (7%)
 Frame = -2

Query  682  KVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTRDAMYEQ  503
            K    Q +LE+++ ++ETHQ E+  AL SME EA R+Y++E+ M  DDE A  RDA+YE+
Sbjct  507  KAAAGQEALEKKVGMLETHQKEIHDALLSMENEAARLYQEEKGM-ADDE-ARQRDALYER  564

Query  502  AEFVEREMEKMMEQIKSIINSLNANQ-------GGELTDGVNPLDVVVRILNNQLSSLVW  344
            AE +   +  + + ++  +  +NA +          + D   PL   VRILNNQL +L  
Sbjct  565  AERLASTLAAIGDSLRDAVADVNAGKCCRYTGAAASMGDTSTPLGKAVRILNNQLQALTA  624

Query  343  VDEKAEDLSSRIQKL  299
            +DE+ + L +R+ KL
Sbjct  625  IDERTDALETRLDKL  639



>ref|XP_002952778.1| hypothetical protein VOLCADRAFT_105669 [Volvox carteri f. nagariensis]
 gb|EFJ46028.1| hypothetical protein VOLCADRAFT_105669 [Volvox carteri f. nagariensis]
Length=650

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 2/135 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            +E E+  V   Q +L+R+L ++ETH  EV  AL S+E EA R+   ER +LLD +AA  R
Sbjct  502  VEEELGVVAAGQDALDRKLTMLETHHKEVHDALSSIEAEAERMCLAER-VLLDGDAA-ER  559

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            D +Y +AE +   + ++ E +  ++  +N   G    D  + L  VVRILNNQL +L  V
Sbjct  560  DRLYARAEALSTALVRLGEDLGGVVADVNELSGAASGDPSSALGAVVRILNNQLLALGQV  619

Query  340  DEKAEDLSSRIQKLA  296
            + +   L   +Q LA
Sbjct  620  EGRVSSLEQEVQALA  634



>ref|XP_007507065.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X4 [Monodelphis 
domestica]
Length=710

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 75/136 (55%), Gaps = 6/136 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE      K++   +    A   R
Sbjct  563  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLAPLEEAV----KEQSGTIYLQHADEER  618

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            +  Y+ AE ++ ++++M + +K II  LN + G   T+  +PL  + +ILN  + SL W+
Sbjct  619  EKTYKLAENIDAQLKRMAQDLKDIIEHLNMSGGPPDTN--DPLQQICKILNAHMDSLQWI  676

Query  340  DEKAEDLSSRIQKLAR  293
            D+ +  L  +++++++
Sbjct  677  DQNSALLQRKVEEVSK  692



>ref|XP_007507064.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X3 [Monodelphis 
domestica]
Length=723

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 75/136 (55%), Gaps = 6/136 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE      K++   +    A   R
Sbjct  576  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLAPLEEAV----KEQSGTIYLQHADEER  631

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            +  Y+ AE ++ ++++M + +K II  LN + G   T+  +PL  + +ILN  + SL W+
Sbjct  632  EKTYKLAENIDAQLKRMAQDLKDIIEHLNMSGGPPDTN--DPLQQICKILNAHMDSLQWI  689

Query  340  DEKAEDLSSRIQKLAR  293
            D+ +  L  +++++++
Sbjct  690  DQNSALLQRKVEEVSK  705



>ref|XP_007507063.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X2 [Monodelphis 
domestica]
Length=723

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 75/136 (55%), Gaps = 6/136 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE      K++   +    A   R
Sbjct  576  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLAPLEEAV----KEQSGTIYLQHADEER  631

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            +  Y+ AE ++ ++++M + +K II  LN + G   T+  +PL  + +ILN  + SL W+
Sbjct  632  EKTYKLAENIDAQLKRMAQDLKDIIEHLNMSGGPPDTN--DPLQQICKILNAHMDSLQWI  689

Query  340  DEKAEDLSSRIQKLAR  293
            D+ +  L  +++++++
Sbjct  690  DQNSALLQRKVEEVSK  705



>ref|XP_007507062.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X1 [Monodelphis 
domestica]
Length=736

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 75/136 (55%), Gaps = 6/136 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE      K++   +    A   R
Sbjct  589  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLAPLEEAV----KEQSGTIYLQHADEER  644

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            +  Y+ AE ++ ++++M + +K II  LN + G   T+  +PL  + +ILN  + SL W+
Sbjct  645  EKTYKLAENIDAQLKRMAQDLKDIIEHLNMSGGPPDTN--DPLQQICKILNAHMDSLQWI  702

Query  340  DEKAEDLSSRIQKLAR  293
            D+ +  L  +++++++
Sbjct  703  DQNSALLQRKVEEVSK  718



>ref|XP_004923460.1| PREDICTED: uncharacterized protein DDB_G0274915-like [Bombyx 
mori]
Length=742

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 39/134 (29%), Positives = 71/134 (53%), Gaps = 9/134 (7%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L   V  V   Q SLE +L+ +   Q E++  L  ME++   + ++  + + D E    R
Sbjct  598  LNEAVETVKNEQQSLEHELDFVLAQQKELEDLLGPMEKQ---LLQENNDRIKDPE----R  650

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            + MY  AE ++ ++ +M E +K +I  LN     +  DG +P+  + RILN  +SS+ W+
Sbjct  651  EHMYSLAENLDSQLHQMSEDLKEVIEHLNETNRSQ--DGNDPIVQIGRILNAHMSSMHWI  708

Query  340  DEKAEDLSSRIQKL  299
            D     +S+++ +L
Sbjct  709  DNSIAQISNKLDQL  722



>ref|XP_004342073.1| nuclear pore glycoprotein p62, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR19964.1| nuclear pore glycoprotein p62, putative [Acanthamoeba castellanii 
str. Neff]
Length=571

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 69/137 (50%), Gaps = 1/137 (1%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L   V KV   Q +L+  LE+I   QDE+ + L+ +E E  ++Y           A   R
Sbjct  415  LHGSVKKVEVAQKTLDSNLEIISRQQDELHQLLEQLENEVDKVYTARTSNGQLGGADSER  474

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            ++ Y  AE +  ++++M   +K  IN LNA       D  NP+  +V ILN  L SL WV
Sbjct  475  ESGYALAEEINSDLDQMANTLKDHINKLNAAH-TSAADSDNPVYQIVEILNAHLHSLQWV  533

Query  340  DEKAEDLSSRIQKLARQ  290
            ++ +  L S+++ L  Q
Sbjct  534  EDNSNQLHSKLKTLRTQ  550



>gb|ENN77508.1| hypothetical protein YQE_06034, partial [Dendroctonus ponderosae]
Length=738

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 39/149 (26%), Positives = 85/149 (57%), Gaps = 16/149 (11%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAA-YT  524
            L S + KV + Q+ L+++L+ I   Q E+++ +  +E+E           L+D       
Sbjct  350  LNSSIEKVKQQQSQLDQELDFILAQQKELEELIIPLEKE-----------LVDVPIVDID  398

Query  523  RDAMYEQAEFVEREMEKMMEQIKSIINSLN-ANQGGELTDGVNPLDVVVRILNNQLSSLV  347
            R+ MY+ +E ++ +++++ + +K II S+N +N+  E++   NP+  + +ILN  ++SL 
Sbjct  399  RNQMYQFSEIIDFQLKQISDDLKEIIESINESNKDEEVS---NPITQISKILNAHMNSLQ  455

Query  346  WVDEKAEDLSSRIQKLARQGSSADRGLTG  260
            W+D     ++ R++++A+   +  R L+G
Sbjct  456  WIDRNTAQINRRLEEIAKIEDTNRRNLSG  484



>gb|KHJ35508.1| putative nuclear pore glycoprotein p62 [Erysiphe necator]
Length=566

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 79/145 (54%), Gaps = 21/145 (14%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYK---DEREML--LDDEAAYTRDAMYEQAEF  494
            +ERQL  +E  QDEV   L   E E   ++     + E++   D E    R+  Y+ AE 
Sbjct  413  IERQLLNVENQQDEVASWLDKYESEIDEMFSRQIGQGEIVQGPDQE----REKTYKLAEK  468

Query  493  VEREMEKMMEQIKSIINSLN-----ANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKA  329
            +   ++ M + + S+IN++N      ++ G+  D   PL  +VR+LNN L++L W+DE A
Sbjct  469  LTDRLDDMAKNLTSMINAINDASTVLSKTGKADD---PLSSIVRVLNNHLTTLQWIDENA  525

Query  328  EDLSSRI---QKLARQ-GSSADRGL  266
            E L S+I   QK+ +  GS+  +GL
Sbjct  526  EALKSKIEESQKVGKNIGSNGLKGL  550



>gb|AAA60741.1| nuclear core glycoprotein, partial [Rattus norvegicus]
Length=156

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY           A
Sbjct  9    LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQH--------A  60

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  61   DEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNM--AGGPADTSDPLQQICKILNAHMDS  118

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  119  LQWVDQSSALLQRRVEEASR  138



>gb|KHN96286.1| Nucleoporin, NSP1-lik [Metarhizium album ARSEF 1941]
Length=732

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 42/142 (30%), Positives = 70/142 (49%), Gaps = 13/142 (9%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEE-----AGRIYKDEREMLLDDEAAYT---RDAMYEQ  503
            +ERQL  +E+ Q+E++  L   E E     A +I   E+    D E   T    + + +Q
Sbjct  580  IERQLAAVESQQEELEAWLSRYEPEVQDMFAKQIGPGEQPAGPDQERERTYKLAEKLTQQ  639

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  SL+     E     +PL  +VR+LN  L+ L W+D  A +
Sbjct  640  LDEKSRDLSKMVKEINDISGSLSKGAKTE-----DPLSQIVRVLNGHLTQLQWIDANASE  694

Query  322  LSSRIQKLARQGSSADRGLTGP  257
            L ++I    +   S +   TGP
Sbjct  695  LQAKISAAQKSSGSLNNHYTGP  716



>ref|XP_002063012.1| GK21694 [Drosophila willistoni]
 gb|EDW73998.1| GK21694 [Drosophila willistoni]
Length=377

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 81/151 (54%), Gaps = 14/151 (9%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L   V KV   Q  L+++LE I T   E++++L  +E+E   + +D+ E          R
Sbjct  240  LNDAVRKVKNDQQVLDQELEFIATQHKELEESLGPLEKEFNSLNRDDVE----------R  289

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLN-ANQGGELTDGVNPLDVVVRILNNQLSSLVW  344
               Y   E ++ ++++M E +K II++LN AN+G + TD   P+  + +ILN  +SSL W
Sbjct  290  KQTYLMVENLDTQLKQMSEDLKEIIDNLNEANKGQDNTD---PIIQIGKILNAHMSSLQW  346

Query  343  VDEKAEDLSSRIQKLARQGSSADRGLTGPRF  251
            ++ ++ ++  ++  + +   S  R +  P F
Sbjct  347  IESQSTNICKKLDDIGKIQDSQKREIFRPPF  377



>gb|KEY67630.1| hypothetical protein S7711_07827 [Stachybotrys chartarum IBT 
7711]
Length=770

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 70/138 (51%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L+  E +   ++  +    E L   +    R     + + +Q
Sbjct  618  IERQLAAVESQQDELEAWLERYETDVQELFSKQMGPGEQLAGPDQERERTYKLAEKLTQQ  677

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             E   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  +  
Sbjct  678  LEEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANSSA  732

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  733  LQAKVA--AAQKSSSNLG  748



>gb|KFA51495.1| hypothetical protein S40293_06766 [Stachybotrys chartarum IBT 
40293]
Length=768

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 70/138 (51%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L+  E +   ++  +    E L   +    R     + + +Q
Sbjct  616  IERQLAAVESQQDELEAWLERYETDVQELFSKQMGPGEQLAGPDQERERTYKLAEKLTQQ  675

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             E   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  +  
Sbjct  676  LEEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANSSA  730

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  731  LQAKVA--AAQKSSSNLG  746



>gb|KFA73162.1| hypothetical protein S40288_08256 [Stachybotrys chartarum IBT 
40288]
Length=769

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 70/138 (51%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L+  E +   ++  +    E L   +    R     + + +Q
Sbjct  617  IERQLAAVESQQDELEAWLERYETDVQELFSKQMGPGEQLAGPDQERERTYKLAEKLTQQ  676

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             E   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  +  
Sbjct  677  LEEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANSSA  731

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  732  LQAKVA--AAQKSSSNLG  747



>ref|XP_011326498.1| hypothetical protein FGSG_06845 [Fusarium graminearum PH-1]
 gb|ESU12991.1| hypothetical protein FGSG_06845 [Fusarium graminearum PH-1]
 emb|CEF83383.1| unnamed protein product [Fusarium graminearum]
Length=709

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  557  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  616

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  617  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  671

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  672  LQAKVA--AAQKSSSNLG  687



>emb|CCT66034.1| related to nuclear pore protein NSP1 [Fusarium fujikuroi IMI 
58289]
Length=711

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  559  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  618

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  619  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  673

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  674  LQAKVA--AAQKSSSNLG  689



>gb|EWG43849.1| hypothetical protein FVEG_05141 [Fusarium verticillioides 7600]
 gb|EWG43850.1| hypothetical protein FVEG_05141 [Fusarium verticillioides 7600]
Length=715

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  563  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  622

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  623  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  677

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  678  LQAKVA--AAQKSSSNLG  693



>gb|EMT63823.1| Nucleoporin nsp1 [Fusarium oxysporum f. sp. cubense race 4]
Length=715

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  563  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  622

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  623  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  677

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  678  LQAKVA--AAQKSSSNLG  693



>gb|EXM36771.1| hypothetical protein FOTG_00768 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=716

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  564  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  623

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  624  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  678

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  679  LQAKVA--AAQKSSSNLG  694



>gb|EXL95302.1| hypothetical protein FOIG_12240 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
Length=716

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  564  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  623

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  624  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  678

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  679  LQAKVA--AAQKSSSNLG  694



>gb|EXK41870.1| hypothetical protein FOMG_05089 [Fusarium oxysporum f. sp. melonis 
26406]
Length=716

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  564  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  623

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  624  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  678

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  679  LQAKVA--AAQKSSSNLG  694



>gb|EXA49790.1| hypothetical protein FOVG_02791 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXL00779.1| hypothetical protein FOQG_00787 [Fusarium oxysporum f. sp. raphani 
54005]
Length=716

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  564  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  623

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  624  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  678

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  679  LQAKVA--AAQKSSSNLG  694



>gb|EWZ44506.1| hypothetical protein FOZG_05261 [Fusarium oxysporum Fo47]
 gb|EWZ98617.1| hypothetical protein FOWG_02624 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXL61834.1| hypothetical protein FOCG_00761 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
Length=716

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  564  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  623

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  624  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  678

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  679  LQAKVA--AAQKSSSNLG  694



>gb|EWY98431.1| hypothetical protein FOYG_02923 [Fusarium oxysporum FOSC 3-a]
Length=716

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  564  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  623

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  624  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  678

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  679  LQAKVA--AAQKSSSNLG  694



>gb|ENH64508.1| Nucleoporin nsp1 [Fusarium oxysporum f. sp. cubense race 1]
Length=716

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  564  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  623

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  624  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  678

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  679  LQAKVA--AAQKSSSNLG  694



>gb|EGU89054.1| hypothetical protein FOXB_00466 [Fusarium oxysporum Fo5176]
 gb|EXL73726.1| hypothetical protein FOPG_11047 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
Length=717

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  565  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  624

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  625  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  679

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  680  LQAKVA--AAQKSSSNLG  695



>gb|EYB22785.1| hypothetical protein FG05_06845 [Fusarium graminearum]
Length=729

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  577  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  636

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  637  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  691

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  692  LQAKVA--AAQKSSSNLG  707



>ref|XP_009263213.1| hypothetical protein FPSE_11821 [Fusarium pseudograminearum CS3096]
 gb|EKJ68010.1| hypothetical protein FPSE_11821 [Fusarium pseudograminearum CS3096]
Length=730

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 69/138 (50%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  578  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  637

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  638  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  692

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  693  LQAKVA--AAQKSSSNLG  708



>emb|CCG82414.1| Predicted protein [Taphrina deformans PYCC 5710]
Length=584

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 78/142 (55%), Gaps = 9/142 (6%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTRDAMYEQAEFVEREM  479
            +++ L  IE  QDE+ + L S E +   I  + R     D+    R+  Y QAE +  E+
Sbjct  442  VDQALNYIENQQDELSQILDSYEVQVRDITAEARVTQPADQE---RERAYTQAEKLVGEL  498

Query  478  EKMMEQIKSIINSLNANQGGELTDGV---NPLDVVVRILNNQLSSLVWVDEKAEDLSSRI  308
            + + + +  +I  LN N   E+T  +   +PL  +++ILN+QL SL W+DE A  L+ ++
Sbjct  499  DGLGKNLSEMITELNKNA--EVTSRLKDDDPLTSIIKILNSQLQSLTWIDENAAKLNEKV  556

Query  307  QKL-ARQGSSADRGLTGPRFLF  245
            ++L A Q + + +  TG +F F
Sbjct  557  EQLNALQTTGSPKTPTGNKFRF  578



>ref|XP_003051722.1| hypothetical protein NECHADRAFT_79074 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU46009.1| hypothetical protein NECHADRAFT_79074 [Nectria haematococca mpVI 
77-13-4]
Length=724

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 41/138 (30%), Positives = 68/138 (49%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E  QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  572  IERQLAAVENQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLMQQ  631

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  632  LDEKSRDLTKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASA  686

Query  322  LSSRIQKLARQGSSADRG  269
            L S++   A Q SS++ G
Sbjct  687  LQSKVT--AAQKSSSNLG  702



>gb|ESA10487.1| hypothetical protein GLOINDRAFT_196715 [Rhizophagus irregularis 
DAOM 181602]
Length=845

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 44/149 (30%), Positives = 76/149 (51%), Gaps = 18/149 (12%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE E  K    Q+ ++  L+ I   QD+++K L   E +      D  + L D E    R
Sbjct  671  LEEESTKAELLQSEIDAGLDSIARRQDDLEKMLSEYEVKFSEPVLDSTKPL-DKE----R  725

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNAN----------QGGELTDGV--NPLDVVVR  377
            +  Y+ AE + +E+ +M + + +II  +N N           G +  + +  +P+D VV+
Sbjct  726  EKNYDMAEEINQELGEMSQVLSTIITDVNRNIIKPYVIDESNGNQDKEDIEEDPMDEVVK  785

Query  376  ILNNQLSSLVWVDEKAEDLSSRIQKLARQ  290
            ILN+ L+SL W+D +A  L+  +Q  A+Q
Sbjct  786  ILNSHLTSLQWIDSQANQLTQGVQN-AKQ  813



>gb|EXX55109.1| Nsp1p [Rhizophagus irregularis DAOM 197198w]
Length=913

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 44/149 (30%), Positives = 76/149 (51%), Gaps = 18/149 (12%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            LE E  K    Q+ ++  L+ I   QD+++K L   E +      D  + L D E    R
Sbjct  739  LEEESTKAELLQSEIDAGLDSIARRQDDLEKMLSEYEVKFSEPVLDSTKPL-DKE----R  793

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNAN----------QGGELTDGV--NPLDVVVR  377
            +  Y+ AE + +E+ +M + + +II  +N N           G +  + +  +P+D VV+
Sbjct  794  EKNYDMAEEINQELGEMSQVLSTIITDVNRNIIKPYVIDESNGNQDKEDIEEDPMDEVVK  853

Query  376  ILNNQLSSLVWVDEKAEDLSSRIQKLARQ  290
            ILN+ L+SL W+D +A  L+  +Q  A+Q
Sbjct  854  ILNSHLTSLQWIDSQANQLTQGVQN-AKQ  881



>ref|XP_003406825.1| PREDICTED: nuclear pore glycoprotein p62 [Loxodonta africana]
 ref|XP_010584785.1| PREDICTED: nuclear pore glycoprotein p62 [Loxodonta africana]
Length=517

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 74/140 (53%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEA----GRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE A    G IY        D+E 
Sbjct  370  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEEAAKEQSGTIYLQHA----DEE-  424

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LNA   G   D  +PL  + RILN  + S
Sbjct  425  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNAA--GGPADSSDPLQQICRILNAHVDS  479

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++  R
Sbjct  480  LQWVDQNSALLQRRVEEAGR  499



>gb|KIL84288.1| nucleoporin nsp1 [Fusarium avenaceum]
Length=712

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 40/138 (29%), Positives = 68/138 (49%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L   E E   ++  +    E L   +    R     + + +Q
Sbjct  560  IERQLAAVESQQDELEAWLDRYESEVQDMFAKQLGPGEQLAGPDQERERTYKLAEKLTQQ  619

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  620  LDEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANASS  674

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS + G
Sbjct  675  LQAKVT--AAQKSSNNLG  690



>ref|XP_011110598.1| hypothetical protein H072_4703 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41410.1| hypothetical protein H072_4703 [Dactylellina haptotyla CBS 200.50]
Length=828

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 41/155 (26%), Positives = 78/155 (50%), Gaps = 11/155 (7%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDE----REMLLDDEA  533
            L +E  K  + Q  + + L+ +   QDE+  AL+  E++   I++ +      M   D+ 
Sbjct  661  LHTETIKATKKQEDINKALDYVIGQQDELSAALELYEKQVDDIFQTQIGGPEGMQPADQE  720

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLN--ANQGGELTDGVNPLDVVVRILNNQL  359
               R+  Y  AE ++++++ M + + +II  +N   N   + +   +PL  +V+ILNN L
Sbjct  721  ---REKSYLLAEKLDKQLDIMSKNLGNIITDINNATNTINKTSSAEDPLATIVKILNNHL  777

Query  358  SSLVWVDEKAEDLSSRIQ--KLARQGSSADRGLTG  260
             +L  +D ++  L  +I   K  R  S ++ GL G
Sbjct  778  GALQEIDVRSNTLQGKIDAAKTQRDASMSNNGLGG  812



>gb|KFA61478.1| hypothetical protein S40285_03419 [Stachybotrys chlorohalonata 
IBT 40285]
Length=765

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 70/138 (51%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTR-----DAMYEQ  503
            +ERQL  +E+ QDE++  L+  E +   ++  +    E L   +    R     + + +Q
Sbjct  613  IERQLAAVESQQDELEAWLERYETDVQELFSKQMGPGEQLAGPDQERERTYKLAEKLTQQ  672

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             E   R++ KM+++I  I  +LN     E     +PL  +VR+LN  L+ L W+D  +  
Sbjct  673  LEEKSRDLSKMVKEINDISGTLNKGAKPE-----DPLSQIVRVLNGHLTQLQWIDANSSA  727

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q SS++ G
Sbjct  728  LQAKVA--AAQKSSSNLG  743



>gb|EPQ65212.1| hypothetical protein BGT96224_370 [Blumeria graminis f. sp. tritici 
96224]
Length=566

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 72/126 (57%), Gaps = 11/126 (9%)
 Frame = -2

Query  664  ASLERQLELIETHQDEVDKALQSMEEE-----AGRIYKDEREMLLDDEAAYTRDAMYEQA  500
            A +ERQL+ +E+ QDEV   L+  E E     A ++ + E     D E    R+  Y+ A
Sbjct  411  AEIERQLDNVESQQDEVASWLEKYENEIDEMLARQVGQGETLQGPDQE----RERTYKLA  466

Query  499  EFVEREMEKMMEQIKSIINSLN--ANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAE  326
            E +   +++M + +  +I+++N  +N   +  +  +PL  +VR+LNN L++L W+DE AE
Sbjct  467  EKLTDRLDEMGKNLAGMIDAINDASNTLTKTGNADDPLSSIVRVLNNHLTTLQWIDENAE  526

Query  325  DLSSRI  308
             L S++
Sbjct  527  ALKSKV  532



>gb|KFO26195.1| Nuclear pore glycoprotein p62 [Fukomys damarensis]
Length=335

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  188  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  242

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  243  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGGP--ADTSDPLQQICKILNAHMDS  297

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ R
Sbjct  298  LQWIDQNSALLQRKVEEVTR  317



>dbj|BAK62955.1| nuclear pore glycoprotein p62 [Pan troglodytes]
Length=195

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 73/140 (52%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY           A
Sbjct  48   LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQH--------A  99

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  100  DEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNT--SGAPADTSDPLQQICKILNAHMDS  157

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  158  LQWIDQNSALLQRKVEEVTK  177



>gb|KFG81878.1| hypothetical protein MANI_118343 [Metarhizium anisopliae]
 gb|KID68607.1| Nucleoporin, NSP1-like protein, partial [Metarhizium anisopliae 
ARSEF 549]
Length=724

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 40/142 (28%), Positives = 69/142 (49%), Gaps = 13/142 (9%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEE-----AGRIYKDEREMLLDDEAAYT---RDAMYEQ  503
            +ERQL  +E+ Q+E++  L   E E     A +I   E+    D E   T    + + +Q
Sbjct  572  IERQLAAVESQQEELEAWLNRYESEVQDMFAKQIGPGEQLGGPDQERERTYKLAEKLTQQ  631

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +L+     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  632  LDEKSRDLSKMVKEINDISGTLSKGTKTE-----DPLSQIVRVLNGHLTQLQWIDANASA  686

Query  322  LSSRIQKLARQGSSADRGLTGP  257
            L +++    +   S +   TGP
Sbjct  687  LQAKVSAAQKSSGSLNNHYTGP  708



>ref|XP_006822534.1| PREDICTED: nuclear pore glycoprotein p62-like, partial [Saccoglossus 
kowalevskii]
Length=190

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 73/138 (53%), Gaps = 5/138 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  +V KV   Q  LE +L+ I + Q E++  L+ +EE      K ++  +    A   R
Sbjct  48   LHGDVEKVKVDQQRLEHELDFILSQQRELEDMLKPLEESV----KTQQSSVYAQHADIER  103

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            +  Y+ AE ++ ++++M + +K II  +N N      D  +P+  V +ILN  + SL WV
Sbjct  104  EHTYQMAENIDAQLKRMAQDLKEIIEHVN-NMNTSSQDSNDPIQQVAKILNAHMDSLQWV  162

Query  340  DEKAEDLSSRIQKLARQG  287
            D+    L+ ++ ++++Q 
Sbjct  163  DQNTALLNRKVDEISKQN  180



>ref|XP_005419943.1| PREDICTED: nuclear pore glycoprotein p62-like [Geospiza fortis]
Length=195

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY           A
Sbjct  48   LHREVEKVKVDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQH--------A  99

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  100  DEERERTYKLAENIDAQLKRMAQDLKDITEHLNTSRGP--ADTSDPLQQICKILNAHMDS  157

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  158  LQWIDQNSAVLQRKVEEVTK  177



>gb|KFU89209.1| Nuclear pore glycoprotein p62, partial [Chaetura pelagica]
Length=193

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY           A
Sbjct  55   LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQH--------A  106

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  107  DEERERTYKLAENIDAQLKRMAQDLKDITEHLNTSRGP--ADTSDPLQQICKILNAHMDS  164

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  165  LQWIDQNSAVLQRKVEEVTK  184



>ref|XP_009097752.1| PREDICTED: nucleoporin-62 C-terminal-like protein [Serinus canaria]
Length=381

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  234  LHREVEKVKVDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  288

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II+ LN + G    D  +PL  + +ILN  + S
Sbjct  289  ---RERTYKLAENIDAQLKRMAQDLKDIIDHLNTSGGP--ADTSDPLQQICKILNAHMDS  343

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  344  LQWIDQNSAVLQRKVEEVTK  363



>ref|XP_007821901.1| Nucleoporin, NSP1-lik [Metarhizium robertsii ARSEF 23]
 gb|EFY98573.1| Nucleoporin, NSP1-lik [Metarhizium robertsii ARSEF 23]
 gb|EXV04284.1| Nsp1-like domain protein [Metarhizium robertsii]
Length=724

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 40/142 (28%), Positives = 69/142 (49%), Gaps = 13/142 (9%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEE-----AGRIYKDEREMLLDDEAAYT---RDAMYEQ  503
            +ERQL  +E+ Q+E++  L   E E     A +I   E+    D E   T    + + +Q
Sbjct  572  IERQLAAVESQQEELEAWLNRYESEVQDMFAKQIGPGEQLGGPDQERERTYKLAEKLTQQ  631

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +L+     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  632  LDEKSRDLSKMVKEINDISGTLSKGTKTE-----DPLSQIVRVLNGHLTQLQWIDANASA  686

Query  322  LSSRIQKLARQGSSADRGLTGP  257
            L +++    +   S +   TGP
Sbjct  687  LQAKVSAAQKSSGSLNNHYTGP  708



>gb|KID80141.1| Nucleoporin, NSP1-like protein, partial [Metarhizium brunneum 
ARSEF 3297]
Length=724

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 40/142 (28%), Positives = 69/142 (49%), Gaps = 13/142 (9%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEE-----AGRIYKDEREMLLDDEAAYT---RDAMYEQ  503
            +ERQL  +E+ Q+E++  L   E E     A +I   E+    D E   T    + + +Q
Sbjct  572  IERQLAAVESQQEELEAWLNRYESEVQDMFAKQIGPGEQLGGPDQERERTYKLAEKLTQQ  631

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +L+     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  632  LDEKSRDLSKMVKEINDISGTLSKGTKTE-----DPLSQIVRVLNGHLTQLQWIDANASA  686

Query  322  LSSRIQKLARQGSSADRGLTGP  257
            L +++    +   S +   TGP
Sbjct  687  LQAKVSAAQKSSGSLNNHYTGP  708



>gb|KIE00004.1| Nucleoporin, NSP1-like protein, partial [Metarhizium majus ARSEF 
297]
Length=725

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 40/142 (28%), Positives = 69/142 (49%), Gaps = 13/142 (9%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEE-----AGRIYKDEREMLLDDEAAYT---RDAMYEQ  503
            +ERQL  +E+ Q+E++  L   E E     A +I   E+    D E   T    + + +Q
Sbjct  573  IERQLAAVESQQEELEAWLNRYESEVQDMFAKQIGPGEQLGGPDQERERTYKLAEKLTQQ  632

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +L+     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  633  LDEKSRDLSKMVKEINDISGTLSKGTKTE-----DPLSQIVRVLNGHLTQLQWIDANASA  687

Query  322  LSSRIQKLARQGSSADRGLTGP  257
            L +++    +   S +   TGP
Sbjct  688  LQAKVSAAQKSSGSLNNHYTGP  709



>gb|EQB55649.1| hypothetical protein CGLO_04395 [Colletotrichum gloeosporioides 
Cg-14]
Length=754

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/123 (28%), Positives = 65/123 (53%), Gaps = 9/123 (7%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTRDAMYEQAEFVE  488
            +ERQL+ +E+ QDE+++ L   E E   ++  +    E L   +    R+  Y+ AE + 
Sbjct  602  IERQLQAVESQQDELEEWLNRYETEVKEMFSKQMGQGETLAGPDQE--RERTYKLAEKLT  659

Query  487  REMEKMMEQIKSIINSLNANQGGELTDGV---NPLDVVVRILNNQLSSLVWVDEKAEDLS  317
            + +++    +  ++  +N +  G L+ G    +PL  +VR+LN  LS L W+D  A  L 
Sbjct  660  QSLDEKSRDLSKMVKEIN-DISGTLSKGTKPEDPLSQIVRVLNGHLSQLQWIDTNAASLQ  718

Query  316  SRI  308
            +++
Sbjct  719  AKV  721



>gb|KFO61081.1| Nuclear pore glycoprotein p62, partial [Corvus brachyrhynchos]
Length=190

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY           A
Sbjct  52   LHREVEKVKVDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQH--------A  103

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN  +G    D  +PL  + +ILN  + S
Sbjct  104  DEERERTYKLAENIDAQLKRMAQDLKDITEHLNTTRGP--ADTSDPLQQICKILNAHMDS  161

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  162  LQWIDQNSAVLQRKVEEVTK  181



>emb|CCU76818.1| hypothetical protein BGHDH14_bgh06235 [Blumeria graminis f. sp. 
hordei DH14]
Length=566

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 71/126 (56%), Gaps = 11/126 (9%)
 Frame = -2

Query  664  ASLERQLELIETHQDEVDKALQSMEEE-----AGRIYKDEREMLLDDEAAYTRDAMYEQA  500
            A +ERQL+ +E+ QDEV   L+  E E     A ++ + E     D E    R+  Y+ A
Sbjct  411  AEIERQLDNVESQQDEVASWLEKYESEIDEMLARQVGQGEALQGPDQE----RERTYKLA  466

Query  499  EFVEREMEKMMEQIKSIINSLN--ANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAE  326
            E +   +++M + +  +I+++N  +N   +     +PL  +VR+LNN L++L W+DE AE
Sbjct  467  EKLTDRLDEMGKNLAGMIDAINDASNTLTKTGKADDPLSSIVRVLNNHLTTLQWIDENAE  526

Query  325  DLSSRI  308
             L S++
Sbjct  527  ALKSKV  532



>ref|XP_008634424.1| PREDICTED: nucleoporin-62 C-terminal-like protein [Corvus brachyrhynchos]
Length=195

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY           A
Sbjct  48   LHREVEKVKVDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQH--------A  99

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN  +G    D  +PL  + +ILN  + S
Sbjct  100  DEERERTYKLAENIDAQLKRMAQDLKDITEHLNTTRGP--ADTSDPLQQICKILNAHMDS  157

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  158  LQWIDQNSAVLQRKVEEVTK  177



>gb|ETE69696.1| Nuclear pore glycoprotein p62, partial [Ophiophagus hannah]
Length=337

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 79/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  190  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLIPLEESVKEQSGTIYLQHA----DEE-  244

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  245  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGGP--ADNSDPLQQICKILNAHMDS  299

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++++
Sbjct  300  LQWIDQNSALLQRKVEEMSK  319



>ref|XP_009995388.1| PREDICTED: nucleoporin-62 C-terminal-like protein [Chaetura pelagica]
Length=195

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY           A
Sbjct  48   LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQH--------A  99

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  100  DEERERTYKLAENIDAQLKRMAQDLKDITEHLNTSRGP--ADTSDPLQQICKILNAHMDS  157

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  158  LQWIDQNSAVLQRKVEEVTK  177



>ref|XP_006898707.1| PREDICTED: nuclear pore glycoprotein p62 [Elephantulus edwardii]
Length=524

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 74/140 (53%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEA----GRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE A    G IY        D+E 
Sbjct  377  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEEAAKEQSGTIYLQHA----DEE-  431

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  432  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNT--AGAPADSSDPLQQICKILNAHMDS  486

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  487  LQWVDQNSALLQRRVEEASR  506



>gb|KDN61835.1| hypothetical protein CSUB01_00380 [Colletotrichum sublineola]
Length=757

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 17/127 (13%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAA---YTRDAMYEQAEFV-  491
            +ERQL+ +E+ QDE++  L   E +   ++   R+M   +  A     R+  Y+ AE + 
Sbjct  605  IERQLQAVESQQDELEDWLNRYESDVKEMF--SRQMGQGENLAGPDQERERTYKLAEKLT  662

Query  490  ------EREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKA  329
                   R++ KM+++I  I  +L+     E     +PL  +VR+LN  LS L W+D  A
Sbjct  663  QNLDEKSRDLSKMVKEINDISGTLSKGNKPE-----DPLSQIVRVLNGHLSQLQWIDTNA  717

Query  328  EDLSSRI  308
              L +++
Sbjct  718  ASLQAKV  724



>gb|EMP31982.1| Nuclear pore glycoprotein p62, partial [Chelonia mydas]
Length=266

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  119  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLIPLEESVKEQSGTIYLQHA----DEE-  173

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  174  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTSGGP--ADTSDPLQQICKILNAHMDS  228

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  229  LQWIDQNSALLQRKVEEVTK  248



>gb|KID91174.1| Nucleoporin, NSP1-like protein [Metarhizium guizhouense ARSEF 
977]
Length=725

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 40/142 (28%), Positives = 69/142 (49%), Gaps = 13/142 (9%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEE-----AGRIYKDEREMLLDDEAAYT---RDAMYEQ  503
            +ERQL  +E+ Q+E++  L   E E     A +I   E+    D E   T    + + +Q
Sbjct  573  IERQLAAVESQQEELEAWLNRYESEVQDMFAKQIGPGEQLGGPDQERERTYKLAEKLTQQ  632

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +L+     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  633  LDEKSRDLSKMVKEINDISGTLSKGTKTE-----DPLSQIVRVLNGHLTQLQWIDANASA  687

Query  322  LSSRIQKLARQGSSADRGLTGP  257
            L +++    +   S +   TGP
Sbjct  688  LQAKVSAAQKSSGSLNNHYTGP  709



>gb|EPQ16007.1| Nuclear pore glycoprotein p62 [Myotis brandtii]
Length=195

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 74/140 (53%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+ +L+ I + Q E++  L    +S++E++G +Y           A
Sbjct  48   LHREVEKVKLDQKRLDEELDFILSQQKELEDLLSPLEESVKEQSGTVYLQH--------A  99

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  100  DEEREKTYKLAENIDAQLKRMAQDLKDIIEHLNT--SGSPADTSDPLQQICKILNAHMDS  157

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  158  LQWIDQNSALLQRKVEEVTK  177



>emb|CCF35519.1| nuclear pore glycoprotein p62 [Colletotrichum higginsianum]
Length=741

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 34/123 (28%), Positives = 65/123 (53%), Gaps = 9/123 (7%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAA---YTRDAMYEQAEFVE  488
            +ERQL+ +E+ QDE++  L   E +   ++   R+M   +  A     R+  Y+ AE + 
Sbjct  589  IERQLQAVESQQDELEDWLNRYESDVKEMF--SRQMGQGETLAGPDQERERTYKLAEKLT  646

Query  487  REMEKMMEQIKSIINSLNANQGGELTDGV---NPLDVVVRILNNQLSSLVWVDEKAEDLS  317
            + +++    +  ++  +N +  G L+ G    +PL  +VR+LN  LS L W+D  A  L 
Sbjct  647  QNLDEKSRDLSKMVKEIN-DISGTLSKGTKPEDPLSQIVRVLNGHLSQLQWIDTNAASLQ  705

Query  316  SRI  308
            +++
Sbjct  706  AKV  708



>gb|ETE61133.1| hypothetical protein L345_13118, partial [Ophiophagus hannah]
Length=188

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/145 (27%), Positives = 77/145 (53%), Gaps = 14/145 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++       +S++E++G IY           A
Sbjct  49   LHREVEKVKLDQKRLDQELDFILSQQKELEDLWIPLEESVKEQSGTIYLQH--------A  100

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN + G    D  +PL  + +ILN  + S
Sbjct  101  DEEREKTYKLAENIDAQLKRMAQDLKDITEHLNTSGGP--ADNSDPLQQICKILNTHMDS  158

Query  352  LVWVDEKAEDLSSRIQKLARQGSSA  278
            L W+D+ +  L  +++++++   S+
Sbjct  159  LQWIDQNSALLQRKVEEMSKVCESS  183



>ref|XP_010012487.1| PREDICTED: nuclear pore glycoprotein p62, partial [Nestor notabilis]
Length=309

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  162  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  216

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  217  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTSGGP--ADTSDPLQQICKILNAHMDS  271

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  272  LQWIDQNSAVLQRKVEEVTK  291



>ref|XP_007807360.1| hypothetical protein MAC_01020 [Metarhizium acridum CQMa 102]
 gb|EFY92782.1| hypothetical protein MAC_01020 [Metarhizium acridum CQMa 102]
Length=725

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 40/142 (28%), Positives = 69/142 (49%), Gaps = 13/142 (9%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEE-----AGRIYKDEREMLLDDEAAYT---RDAMYEQ  503
            +ERQL  +E+ Q+E++  L   E E     A +I   E+    D E   T    + + +Q
Sbjct  573  IERQLAAVESQQEELEAWLNRYESEVQDMFAKQIGPGEQLGGPDQERERTYKLAEKLTQQ  632

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +L+     E     +PL  +VR+LN  L+ L W+D  A  
Sbjct  633  LDEKSRDLSKMVKEINDISGTLSKGTKTE-----DPLSQIVRVLNGHLTQLQWIDANASA  687

Query  322  LSSRIQKLARQGSSADRGLTGP  257
            L +++    +   S +   TGP
Sbjct  688  LQAKVSAAQKSSGSLNNHYTGP  709



>gb|KFQ49215.1| Nuclear pore glycoprotein p62, partial [Nestor notabilis]
Length=313

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  166  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  220

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  221  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTSGGP--ADTSDPLQQICKILNAHMDS  275

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  276  LQWIDQNSAVLQRKVEEVTK  295



>gb|EDL22755.1| mCG23139 [Mus musculus]
Length=433

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  286  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  340

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  341  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN--MAGGPADTSDPLQQICKILNAHMDS  395

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  396  LQWVDQSSALLQRRVEEASR  415



>gb|EDM07457.1| rCG53751 [Rattus norvegicus]
Length=425

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  278  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  332

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  333  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN--MAGGPADTSDPLQQICKILNAHMDS  387

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  388  LQWVDQSSALLQRRVEEASR  407



>ref|XP_007497465.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X2 [Monodelphis 
domestica]
Length=518

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  371  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEEAVKEQSGTIYLQHA----DEE-  425

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K +I  LN + G    D  +PL  V +ILN  + S
Sbjct  426  ---REKTYQLAETIDAQLKRMAQDLKDVIEHLNVSGGSP--DTGDPLQQVCKILNAHMDS  480

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++++
Sbjct  481  LQWIDQNSASLQRKVEEVSK  500



>ref|XP_007497464.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X1 [Monodelphis 
domestica]
Length=527

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  380  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEEAVKEQSGTIYLQHA----DEE-  434

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K +I  LN + G    D  +PL  V +ILN  + S
Sbjct  435  ---REKTYQLAETIDAQLKRMAQDLKDVIEHLNVSGGSP--DTGDPLQQVCKILNAHMDS  489

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++++
Sbjct  490  LQWIDQNSASLQRKVEEVSK  509



>ref|XP_007497466.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X3 [Monodelphis 
domestica]
 ref|XP_007497467.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X4 [Monodelphis 
domestica]
Length=513

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  366  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEEAVKEQSGTIYLQHA----DEE-  420

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K +I  LN + G    D  +PL  V +ILN  + S
Sbjct  421  ---REKTYQLAETIDAQLKRMAQDLKDVIEHLNVSGGSP--DTGDPLQQVCKILNAHMDS  475

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++++
Sbjct  476  LQWIDQNSASLQRKVEEVSK  495



>ref|XP_002092219.1| GE11786 [Drosophila yakuba]
 gb|EDW91931.1| GE11786 [Drosophila yakuba]
Length=393

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 75/137 (55%), Gaps = 14/137 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L   V KV   Q  L+++LE I T Q E++ +L  +E+E   + K + E          R
Sbjct  256  LNDAVKKVKTDQQVLDQELEFIATQQKELEDSLAPLEKEFVNLPKVDME----------R  305

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLN-ANQGGELTDGVNPLDVVVRILNNQLSSLVW  344
               Y   E ++ ++++M E +K II++LN AN+G + TD   P+  + +ILN  +SSL W
Sbjct  306  SQTYLMVENLDTQLKQMSEDLKEIIDNLNEANKGQDTTD---PIIQIGKILNAHMSSLQW  362

Query  343  VDEKAEDLSSRIQKLAR  293
            ++ ++ ++  ++  + +
Sbjct  363  IESQSTNICKKLDDIGK  379



>gb|EPY89156.1| hypothetical protein CB1_000132008 [Camelus ferus]
Length=515

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G +Y        D+E 
Sbjct  368  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTVYLQHA----DEE-  422

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  423  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  477

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ R
Sbjct  478  LQWIDQNSALLQRKVEEVTR  497



>ref|XP_005001812.1| PREDICTED: nuclear pore glycoprotein p62 [Cavia porcellus]
Length=518

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  371  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  425

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  426  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  480

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R++++ R
Sbjct  481  LQWVDQNSALLQRRVEEVTR  500



>ref|XP_003005306.1| nuclear pore glycoprotein p62 [Verticillium alfalfae VaMs.102]
 gb|EEY18803.1| nuclear pore glycoprotein p62 [Verticillium alfalfae VaMs.102]
Length=717

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 70/136 (51%), Gaps = 17/136 (13%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAA---YTRDAMYEQAEFV-  491
            +ERQL+ +E+ QDE+++ L   E E   ++   R+M   +  A     R+  Y+ AE + 
Sbjct  565  IERQLQSVESQQDELEEWLNRYEGEVKEMF--SRQMGQGETLAGPDQERERTYKLAEKLT  622

Query  490  ------EREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKA  329
                   R++ KM+++I  I  +++     E     +PL  +VR+LN  L+ L W+D+ A
Sbjct  623  QHLDEKSRDLSKMVKEINEISGTMSKGTKPE-----DPLSQIVRVLNGHLTQLQWIDQNA  677

Query  328  EDLSSRIQKLARQGSS  281
              L + +    + G++
Sbjct  678  AALQAEVSAAQKTGNN  693



>ref|XP_005046201.1| PREDICTED: nuclear pore glycoprotein p62-like, partial [Ficedula 
albicollis]
Length=487

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  340  LHREVEKVKVDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  394

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II+ LN + G    D  +PL  + +ILN  + S
Sbjct  395  ---RERTYKLAENIDAQLKRMAQDLKDIIDHLNTSGG--PADTSDPLQQICKILNAHMDS  449

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  450  LQWIDQNSAVLQRKVEEVTK  469



>gb|AAI30142.1| LOC100037082 protein [Xenopus laevis]
Length=495

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  348  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  402

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  403  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN--MAGGPADTSDPLQQICKILNAHMDS  457

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  458  LQWVDQSSALLQRRVEEASR  477



>ref|XP_003764354.1| PREDICTED: nuclear pore glycoprotein p62-like [Sarcophilus harrisii]
Length=210

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 74/140 (53%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    ++M+EE+G IY           A
Sbjct  63   LHREVEKVKLDQKRLDQELDFILSQQKELEDLLAPLEEAMKEESGTIYLQH--------A  114

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ +++ M + +K I   LN + G    D  +PL  + +ILN  + S
Sbjct  115  DEEREKTYKLAENIDAQLKSMAQDLKDITEHLNMSGGS--PDTNDPLQQICKILNAHMDS  172

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++ +++
Sbjct  173  LQWIDQNSVLLQQKVEDVSK  192



>ref|XP_003658805.1| hypothetical protein MYCTH_2295069 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO53560.1| hypothetical protein MYCTH_2295069 [Myceliophthora thermophila 
ATCC 42464]
Length=718

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 35/142 (25%), Positives = 70/142 (49%), Gaps = 7/142 (5%)
 Frame = -2

Query  664  ASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAA---YTRDAMYEQAEF  494
            A ++RQL  +E+ Q+E+   L+  E +   ++         ++AA     R+  Y+ AE 
Sbjct  561  AEIDRQLSNVESQQEELGAWLERYEADLNELFAKNGITATGEQAAGPDQERERTYKLAEK  620

Query  493  VEREMEKMMEQIKSIINSLNANQGGELTDGV---NPLDVVVRILNNQLSSLVWVDEKAED  323
            +   +++M + +  +I  +N +    L+ G    +PL  +VR+LN  L+ L W+D  A  
Sbjct  621  LTDRLDEMGKDLTKMIKEIN-DMSSTLSKGNKPDDPLTQIVRVLNGHLAQLQWIDSNAAA  679

Query  322  LSSRIQKLARQGSSADRGLTGP  257
            L +++    +   S    ++GP
Sbjct  680  LQAKVLAAQKASGSMGTSVSGP  701



>ref|NP_075586.1| nuclear pore glycoprotein p62 [Rattus norvegicus]
 ref|XP_006229212.1| PREDICTED: nuclear pore glycoprotein p62 isoform X1 [Rattus norvegicus]
 ref|XP_006229213.1| PREDICTED: nuclear pore glycoprotein p62 isoform X1 [Rattus norvegicus]
 sp|P17955.1|NUP62_RAT RecName: Full=Nuclear pore glycoprotein p62; AltName: Full=62 
kDa nucleoporin; AltName: Full=Nucleoporin Nup62 [Rattus norvegicus]
 emb|CAA36813.1| unnamed protein product [Rattus rattus]
 gb|AAA41789.1| glycoprotein p62 [Rattus norvegicus]
 gb|AAI28710.1| Nucleoporin 62 [Rattus norvegicus]
Length=525

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  378  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  432

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  433  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN--MAGGPADTSDPLQQICKILNAHMDS  487

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  488  LQWVDQSSALLQRRVEEASR  507



>gb|EMC88654.1| Nuclear pore glycoprotein p62 [Columba livia]
Length=324

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  177  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  231

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ +++ M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  232  ---RERTYKLAENIDAQLKHMAQDLKDIIEHLNTSGGP--ADTSDPLQQICKILNAHMDS  286

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  287  LQWIDQNSAMLQRKVEEVTK  306



>ref|XP_006036900.1| PREDICTED: nuclear pore glycoprotein p62-like [Alligator sinensis]
Length=398

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  251  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  305

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  306  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTSGGP--ADTSDPLQQICKILNAHMDS  360

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  361  LQWIDQNSALLQRKVEEVTK  380



>gb|ENH87501.1| nucleoporin nsp1 [Colletotrichum orbiculare MAFF 240422]
Length=769

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/123 (27%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTRDAMYEQAEFVE  488
            +ERQL+ +E+ QDE+++ L   E E   ++  +    E L   +    R+  Y+ AE + 
Sbjct  617  IERQLQAVESQQDELEEWLNRYETEVKEMFSKQMGQGETLAGPDQE--RERTYKLAEKLT  674

Query  487  REMEKMMEQIKSIINSLNANQGGELTDGV---NPLDVVVRILNNQLSSLVWVDEKAEDLS  317
            + +++    +  ++  +N +  G L+ G    +PL  +VR+LN  L  L W+D  A  L 
Sbjct  675  QNLDEKSRDLSKMVKEIN-DISGTLSKGTKPEDPLSQIVRVLNGHLGQLQWIDTNAASLQ  733

Query  316  SRI  308
            +++
Sbjct  734  AKV  736



>ref|XP_002034121.1| GM21692 [Drosophila sechellia]
 gb|EDW48134.1| GM21692 [Drosophila sechellia]
Length=393

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 14/137 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L   V KV   Q  L+++LE I T Q E++ +L  +E+E   + + + E          R
Sbjct  256  LNDAVKKVKTDQQVLDQELEFIATQQKELEDSLGPLEKEFVNLPRVDME----------R  305

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLN-ANQGGELTDGVNPLDVVVRILNNQLSSLVW  344
               Y   E ++ ++++M E +K II++LN AN+G + TD   P+  + +ILN  ++SL W
Sbjct  306  SQTYLMVENLDTQLKQMSEDLKEIIDNLNEANKGQDTTD---PIIQIGKILNAHMNSLQW  362

Query  343  VDEKAEDLSSRIQKLAR  293
            ++ ++ ++S +++ + +
Sbjct  363  IESQSTNISKKLEDIGK  379



>ref|XP_006275550.1| PREDICTED: nuclear pore glycoprotein p62-like [Alligator mississippiensis]
Length=398

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  251  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  305

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  306  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTSGGP--ADTSDPLQQICKILNAHMDS  360

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  361  LQWIDQNSALLQRKVEEVTK  380



>ref|NP_611120.1| nucleoporin 62kD, isoform A [Drosophila melanogaster]
 ref|NP_001286489.1| nucleoporin 62kD, isoform B [Drosophila melanogaster]
 gb|AAF58007.1| nucleoporin 62kD, isoform A [Drosophila melanogaster]
 gb|AAM11060.1| GH12838p [Drosophila melanogaster]
 gb|ACL85115.1| Nup62-PA, partial [synthetic construct]
 gb|ACL90070.1| Nup62-PA [synthetic construct]
 gb|AHN56285.1| nucleoporin 62kD, isoform B [Drosophila melanogaster]
Length=394

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 77/137 (56%), Gaps = 14/137 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L   V KV   Q  L+++LE I T Q E++ +L  +E+E   + + + E          R
Sbjct  257  LNDAVKKVKTDQQVLDQELEFIATQQKELEDSLGPLEKEFVNLPRVDME----------R  306

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLN-ANQGGELTDGVNPLDVVVRILNNQLSSLVW  344
               Y   E ++ ++++M E +K II++LN AN+G + TD   P+  + +ILN  ++SL W
Sbjct  307  SQTYLMVENLDTQLKQMSEDLKEIIDNLNEANKGQDTTD---PIIQIGKILNAHMNSLQW  363

Query  343  VDEKAEDLSSRIQKLAR  293
            ++ ++ ++S +++ + +
Sbjct  364  IESQSTNISKKLEDIGK  380



>gb|KGL78705.1| Nuclear pore glycoprotein p62, partial [Tinamus guttatus]
Length=452

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  305  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  359

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  360  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTSGGP--ADTSDPLQQICKILNAHMDS  414

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  415  LQWIDQNSALLQRKVEEVTK  434



>ref|XP_008634480.1| PREDICTED: LOW QUALITY PROTEIN: nuclear pore glycoprotein p62-like 
[Corvus brachyrhynchos]
Length=532

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  385  LHREVEKVKVDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  439

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II+ LN + G    D  +PL  + +ILN  + S
Sbjct  440  ---RERTYKLAENIDAQLKRMAQDLKDIIDHLNTSGG--PADTSDPLQQICKILNAHMDS  494

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  495  LQWIDQNSAVLQRKVEEVTK  514



>ref|XP_006677073.1| hypothetical protein BATDEDRAFT_86302 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82841.1| hypothetical protein BATDEDRAFT_86302 [Batrachochytrium dendrobatidis 
JAM81]
Length=548

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 81/159 (51%), Gaps = 33/159 (21%)
 Frame = -2

Query  682  KVVET-QASLERQLELIETHQDEVDKALQSMEEEAGRIYKDE------REMLLDDEAAYT  524
            +V ET Q  +++ LE IE  Q+E+D  L + + +   + +++      R    D+E    
Sbjct  363  QVTETAQKEIDQNLEYIEAQQNELDATLDNYQAQILALSQNDAQAAHFRTTPADEE----  418

Query  523  RDAMYEQAEFVEREMEKMMEQIKSIINSLNANQ---------GGELTDGV----------  401
            R+  Y  AE + ++++ M  Q+  II+ +N ++         GG LT G           
Sbjct  419  REKAYTLAENLNKQLDDMSLQLGVIIDDMNQSRNASMPSTMYGGGLTAGQSEGNKQPIAF  478

Query  400  ---NPLDVVVRILNNQLSSLVWVDEKAEDLSSRIQKLAR  293
               NP+  +VRILN+ L+SL W+D+ + +L+ R+ +L R
Sbjct  479  EEDNPIGAIVRILNDHLASLEWIDKTSTELAGRVVELKR  517



>ref|XP_003935930.1| PREDICTED: nucleoporin-62 C-terminal-like protein [Saimiri boliviensis 
boliviensis]
Length=266

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 69/136 (51%), Gaps = 6/136 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV KV   Q  LE++L+ I + Q E++  L  +EE       D+  +     A   R
Sbjct  118  LHGEVNKVKLDQKRLEQELDFILSQQQELEFLLTYLEESM----SDQSGLHYLQHADEER  173

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
               Y  AE ++ ++++M + +K ++N LN    G   D  +PL  + RILN  + SL W+
Sbjct  174  VETYRLAESIDAQLKQMSQDLKDVVNHLNT--FGISADTTDPLQQICRILNAHMDSLQWI  231

Query  340  DEKAEDLSSRIQKLAR  293
            D  +  L  +++++ R
Sbjct  232  DRNSGILRRKVEEVTR  247



>dbj|BAE40127.1| unnamed protein product [Mus musculus]
Length=526

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  379  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  433

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  434  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN--MAGGPADTSDPLQQICKILNAHMDS  488

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  489  LQWVDQSSAMLQRRVEEASR  508



>ref|XP_003269736.1| PREDICTED: nuclear pore glycoprotein p62 [Nomascus leucogenys]
Length=419

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  272  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  326

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  327  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMDS  381

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  382  LQWIDQNSALLQRKVEEVTK  401



>gb|AAB19953.1| nuclear pore complex glycoprotein p62 [Mus sp.]
Length=526

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  379  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  433

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  434  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN--MAGGPADTSDPLQQICKILNAHMDS  488

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  489  LQWVDQSSALLQRRVEEASR  508



>dbj|BAK62486.1| nuclear pore glycoprotein p62 [Pan troglodytes]
Length=420

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  273  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  327

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  328  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMDS  382

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  383  LQWIDQNSALLQRKVEEVTK  402



>dbj|BAE29296.1| unnamed protein product [Mus musculus]
Length=526

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  379  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  433

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  434  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN--MAGGPADTSDPLQQICKILNAHMDS  488

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  489  LQWVDQSSALLQRRVEEASR  508



>ref|XP_006868284.1| PREDICTED: nuclear pore glycoprotein p62 [Chrysochloris asiatica]
Length=522

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 74/140 (53%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEA----GRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE A    G IY        D+E 
Sbjct  375  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEEAAKEQSGTIYLQHA----DEE-  429

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  430  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNT--AGGPADTSDPLQQICKILNAHMDS  484

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ ++
Sbjct  485  LQWVDQNSALLQRRVEEASK  504



>dbj|BAE40956.1| unnamed protein product [Mus musculus]
Length=526

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  379  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  433

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  434  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN--MAGGPADTSDPLQQICKILNAHMDS  488

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  489  LQWVDQSSALLQRRVEEASR  508



>dbj|BAE33019.1| unnamed protein product [Mus musculus]
Length=526

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  379  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  433

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  434  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN--MAGGPADTSDPLQQICKILNAHMDS  488

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  489  LQWVDQSSALLQRRVEEASR  508



>ref|NP_444304.1| nuclear pore glycoprotein p62 [Mus musculus]
 sp|Q63850.2|NUP62_MOUSE RecName: Full=Nuclear pore glycoprotein p62; AltName: Full=62 
kDa nucleoporin; AltName: Full=Nucleoporin Nup62 [Mus musculus]
 gb|AAH05784.1| Nucleoporin 62 [Mus musculus]
 gb|AAH89317.1| Nucleoporin 62 [Mus musculus]
 dbj|BAE42464.1| unnamed protein product [Mus musculus]
 dbj|BAE42562.1| unnamed protein product [Mus musculus]
 dbj|BAE38900.1| unnamed protein product [Mus musculus]
 dbj|BAE28999.1| unnamed protein product [Mus musculus]
 dbj|BAE40373.1| unnamed protein product [Mus musculus]
Length=526

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  379  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  433

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  434  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN--MAGGPADTSDPLQQICKILNAHMDS  488

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  489  LQWVDQSSALLQRRVEEASR  508



>ref|XP_007941054.1| PREDICTED: nuclear pore glycoprotein p62 [Orycteropus afer afer]
Length=516

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 74/140 (53%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEA----GRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE A    G IY        D+E 
Sbjct  369  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEEAAKEQSGTIYLQHA----DEE-  423

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN   G    D  +PL  + +ILN  + S
Sbjct  424  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTAGG--PADSSDPLQQICKILNAHMDS  478

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ ++
Sbjct  479  LQWVDQNSALLQRRVEEASK  498



>gb|EOB08562.1| Nuclear pore glycoprotein p62, partial [Anas platyrhynchos]
Length=471

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  324  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  378

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  379  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  433

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  434  LQWIDQNSALLQRKVEEVTK  453



>ref|NP_001270199.1| uncharacterized protein LOC101866268 [Macaca fascicularis]
 dbj|BAE01812.1| unnamed protein product [Macaca fascicularis]
Length=521

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  374  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  428

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  429  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMGS  483

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  484  LQWIDQNSALLQRKVEEVTK  503



>ref|XP_005440073.1| PREDICTED: nuclear pore glycoprotein p62-like [Falco cherrug]
Length=462

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  315  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  369

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K +I  LN + G    D  +PL  + +ILN  + S
Sbjct  370  ---RERTYKLAENIDAQLKRMAQDLKDVIEHLNTSGGP--ADTNDPLQQICKILNAHMDS  424

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  425  LQWIDQNSAVLQRKVEEVTK  444


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 65/114 (57%), Gaps = 14/114 (12%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEAAYTRDAMYEQAEFV  491
            L+++L+ I + Q E++  L    +S++E++G IY        D+E    R+  Y+ AE +
Sbjct  8    LDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE----RERTYKLAENI  59

Query  490  EREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKA  329
            + ++++M + +K I   LN ++G    D  +PL  + +ILN  + SL W+D+ +
Sbjct  60   DAQLKRMAQDLKDITEHLNTSRGP--ADTSDPLQQICKILNAHMDSLQWIDQNS  111



>gb|EFQ26235.1| hypothetical protein GLRG_01379 [Colletotrichum graminicola M1.001]
Length=753

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 17/127 (13%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDER---EMLLDDEAAYTRDAMYEQAEFV-  491
            +ERQL+ +E+ QDE++  L   E +   ++  +    E L   +    R+  Y+ AE + 
Sbjct  601  IERQLQAVESQQDELEDWLNRYESDVKEMFSRQMGQGETLTGPDQE--RERTYKLAEKLT  658

Query  490  ------EREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKA  329
                   R++ KM+++I  I  +L+     E     +PL  +VR+LN  LS L W+D  A
Sbjct  659  QNLDEKSRDLSKMVKEINDISGTLSKGSKPE-----DPLSQIVRVLNGHLSQLQWIDTNA  713

Query  328  EDLSSRI  308
              L +++
Sbjct  714  ASLQAKV  720



>gb|KFB34747.1| AGAP010978-PA-like protein [Anopheles sinensis]
Length=408

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 75/137 (55%), Gaps = 14/137 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L   V KV   Q ++E++LE I     E+++ +  +E+E  RI + + E          R
Sbjct  265  LNEAVMKVKAEQNAMEQELEFITAQHTELEECIVPLEQELSRIGQIDLE----------R  314

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLN-ANQGGELTDGVNPLDVVVRILNNQLSSLVW  344
               Y  AE ++ ++++M E +K +I  LN AN+    TD  +PL  + +ILN  ++SL W
Sbjct  315  GQTYSMAETLDSQLKQMYEDLKEVIEHLNDANK---YTDPNDPLVQIGKILNAHMNSLQW  371

Query  343  VDEKAEDLSSRIQKLAR  293
            +D  +  +++R++++ +
Sbjct  372  IDSSSTVITNRLEEINK  388



>ref|XP_007995812.1| PREDICTED: nuclear pore glycoprotein p62 [Chlorocebus sabaeus]
 ref|XP_007995813.1| PREDICTED: nuclear pore glycoprotein p62 [Chlorocebus sabaeus]
Length=521

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  374  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  428

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  429  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMGS  483

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  484  LQWIDQNSALLQRKVEEVTK  503



>ref|XP_010215102.1| PREDICTED: nucleoporin-62 C-terminal-like protein [Tinamus guttatus]
Length=497

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  350  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  404

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  405  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTSGG--PADTSDPLQQICKILNAHMDS  459

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  460  LQWIDQNSALLQRKVEEVTK  479



>gb|EMC88655.1| Nuclear pore glycoprotein p62 [Columba livia]
Length=317

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  170  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  224

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  225  ---RERTYKLAENIDAQLKRMAQDLKDITEHLNTSRGP--ADTSDPLQQICKILNAHMDS  279

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  280  LQWIDQNSAVLQRKVEEVTK  299



>ref|XP_009570320.1| PREDICTED: nuclear pore glycoprotein p62-like [Cuculus canorus]
Length=422

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L++ L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  275  LHKEVEKVKLDQKRLDQDLDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  329

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  330  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGG--PADTSDPLQQICKILNAHMDS  384

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  385  LQWIDQNSAVLQRKVEEVTK  404



>ref|XP_005009725.1| PREDICTED: nuclear pore glycoprotein p62-like [Anas platyrhynchos]
Length=484

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  337  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  391

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  392  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  446

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  447  LQWIDQNSALLQRKVEEVTK  466



>ref|XP_010713440.1| PREDICTED: nucleoporin-62 C-terminal-like protein [Meleagris 
gallopavo]
Length=511

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  364  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  418

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  419  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GRPADTSDPLQQICKILNAHMDS  473

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  474  LQWIDQNSALLQRKVEEVTK  493



>ref|XP_007599043.1| nuclear pore glycoprotein p62 [Colletotrichum fioriniae PJ7]
 gb|EXF77306.1| nuclear pore glycoprotein p62 [Colletotrichum fioriniae PJ7]
Length=758

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/123 (27%), Positives = 64/123 (52%), Gaps = 9/123 (7%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAA---YTRDAMYEQAEFVE  488
            +ERQL+ +E+ QDE++  L   E +   ++   R+M   +  A     R+  Y+ AE + 
Sbjct  606  IERQLQAVESQQDELEDWLNRYEADVKEMF--SRQMGQGETLAGPDQERERTYKLAEKLT  663

Query  487  REMEKMMEQIKSIINSLNANQGGELTDGV---NPLDVVVRILNNQLSSLVWVDEKAEDLS  317
            + +++    +  ++  +N +  G L+ G    +PL  +VR+LN  L  L W+D  A  L 
Sbjct  664  QNLDEKSRDLSKMVKEIN-DISGTLSKGTKPEDPLSQIVRVLNGHLGQLQWIDSNAASLQ  722

Query  316  SRI  308
            +++
Sbjct  723  AKV  725



>gb|KFH47953.1| Nucleoporin-like protein [Acremonium chrysogenum ATCC 11550]
Length=708

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 41/138 (30%), Positives = 70/138 (51%), Gaps = 15/138 (11%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEE-----AGRIYKDEREMLLDDEAAYT---RDAMYEQ  503
            +ERQL  +E  QDE++  L   E E     A +I   E+    D E   T    + + +Q
Sbjct  556  IERQLSSVEGQQDELEAWLDRYESEVQEMFAKQIGPGEQLGGPDQERERTYKLAEKLTQQ  615

Query  502  AEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAED  323
             +   R++ KM+++I  I  +L+     E     +PL  +VR+LN  L+ L W+D  A +
Sbjct  616  LDEKSRDLSKMVKEINDISGTLSKGSKPE-----DPLSQIVRVLNGHLTQLQWIDANASE  670

Query  322  LSSRIQKLARQGSSADRG  269
            L +++   A Q S+++ G
Sbjct  671  LQAKVA--AAQKSNSNLG  686



>ref|NP_001247546.1| nuclear pore glycoprotein p62 [Macaca mulatta]
 gb|EHH30284.1| hypothetical protein EGK_10913 [Macaca mulatta]
 gb|EHH59799.1| hypothetical protein EGM_09994 [Macaca fascicularis]
Length=521

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  374  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  428

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  429  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMGS  483

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  484  LQWIDQNSALLQRKVEEVTK  503



>ref|XP_004381680.1| PREDICTED: nuclear pore glycoprotein p62 [Trichechus manatus 
latirostris]
Length=516

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 74/140 (53%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEA----GRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE A    G IY        D+E 
Sbjct  369  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEEAAKEQSGTIYLQHA----DEE-  423

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  424  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN--TAGGPADSSDPLQQICKILNAHMDS  478

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ ++
Sbjct  479  LQWVDQNSALLQRRVEEASK  498



>ref|XP_010638993.1| PREDICTED: nuclear pore glycoprotein p62 [Fukomys damarensis]
Length=522

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  375  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  429

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  430  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  484

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ R
Sbjct  485  LQWIDQNSALLQRKVEEVTR  504



>gb|AFP33412.1| nucleoporin 62, partial [Sepiella maindroni]
Length=169

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 72/137 (53%), Gaps = 6/137 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  +V +V   Q  L+ +L+ I + Q E++  L  +E    ++      +     A   R
Sbjct  22   LNHDVDRVKIDQQRLDNELDFIRSQQKELEDLLTPLETSMEQLPP----LSYQHHADIER  77

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            +  Y+ AE ++ ++++M+  +K II+ LN     E  +  +P+  + +ILN  + SL W+
Sbjct  78   EHTYQLAESIDGQLKRMVLDLKEIIDHLNTTNSTE--ENTDPIHQITKILNAHMDSLRWI  135

Query  340  DEKAEDLSSRIQKLARQ  290
            D+ A  L+ R++ +++Q
Sbjct  136  DQNAGLLNRRVEDISKQ  152



>ref|XP_008053992.1| PREDICTED: nuclear pore glycoprotein p62 [Tarsius syrichta]
Length=522

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  375  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  429

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN   GG   D  +PL  + +ILN  + S
Sbjct  430  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLN-TAGGP-ADTSDPLQQICKILNAHMDS  484

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++AR
Sbjct  485  LQWIDQNSALLQRKVEEVAR  504



>gb|AAH64245.2| hypothetical protein LOC394934 [Xenopus (Silurana) tropicalis]
Length=552

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 77/141 (55%), Gaps = 14/141 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  E+ KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  405  LHREMEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  459

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K +I  LN + G    D  NPL  + +ILN  + S
Sbjct  460  ---REKTYKLAENIDAQLKRMAQDLKEVIEHLNTSAG--PGDAGNPLQQICKILNAHMDS  514

Query  352  LVWVDEKAEDLSSRIQKLARQ  290
            L W+D+ +  L  +++++ ++
Sbjct  515  LQWIDQNSALLQRKVEQVTKE  535



>ref|XP_002673465.1| nuclear pore complex p62 [Naegleria gruberi]
 gb|EFC40721.1| nuclear pore complex p62 [Naegleria gruberi]
Length=736

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 34/138 (25%), Positives = 71/138 (51%), Gaps = 14/138 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSME---EEAGRIYKDEREMLLDDEAA  530
            L  +V ++   Q+ L+ QL++I++ Q+ ++  ++ +E   E+   IY   +    D E  
Sbjct  597  LNDQVNRITAEQSELKGQLDMIDSQQNNLENIIKGLEDYIEKNQSIYDSSKRSQSDRE--  654

Query  529  YTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNP---LDVVVRILNNQL  359
              R+  Y+ AE +  +++ M + +  ++  LN          V+P      +V+++NN L
Sbjct  655  --REETYKTAESINCQLDAMQQTLDEMVMQLNKT----FEQSVDPHSDFTRIVQVMNNHL  708

Query  358  SSLVWVDEKAEDLSSRIQ  305
            + L W++++A  L S IQ
Sbjct  709  ACLQWIEQQASGLDSDIQ  726



>ref|XP_003915981.1| PREDICTED: nuclear pore glycoprotein p62 [Papio anubis]
 ref|XP_003915982.1| PREDICTED: nuclear pore glycoprotein p62 [Papio anubis]
 ref|XP_003915983.1| PREDICTED: nuclear pore glycoprotein p62 [Papio anubis]
 ref|XP_009193276.1| PREDICTED: nuclear pore glycoprotein p62 [Papio anubis]
Length=521

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  374  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  428

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  429  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMGS  483

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  484  LQWIDQNSALLQRKVEEVTK  503



>ref|XP_005237964.1| PREDICTED: nuclear pore glycoprotein p62-like [Falco peregrinus]
Length=375

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 79/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  228  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  282

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K +I  LN + G   T+  +PL  + +ILN  + S
Sbjct  283  ---RERTYKLAENIDAQLKRMAQDLKDVIEHLNTSGGPADTN--DPLQQICKILNAHMDS  337

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  338  LQWIDQNSAVLQRKVEEVTK  357



>ref|XP_010367825.1| PREDICTED: nuclear pore glycoprotein p62 [Rhinopithecus roxellana]
 ref|XP_010367826.1| PREDICTED: nuclear pore glycoprotein p62 [Rhinopithecus roxellana]
 ref|XP_010367827.1| PREDICTED: nuclear pore glycoprotein p62 [Rhinopithecus roxellana]
 ref|XP_010367828.1| PREDICTED: nuclear pore glycoprotein p62 [Rhinopithecus roxellana]
Length=521

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  374  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  428

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  429  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMGS  483

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  484  LQWIDQNSALLQRKVEEVTK  503



>gb|KFV78789.1| Nuclear pore glycoprotein p62, partial [Struthio camelus australis]
Length=470

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  323  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  377

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  378  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  432

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  433  LQWIDQNSALLQRKVEEVTK  452



>ref|XP_009668275.1| PREDICTED: nucleoporin-62 C-terminal-like protein [Struthio camelus 
australis]
Length=492

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  345  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  399

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  400  ---RERTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  454

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  455  LQWIDQNSALLQRKVEEVTK  474



>ref|XP_010991466.1| PREDICTED: LOW QUALITY PROTEIN: nuclear pore glycoprotein p62 
[Camelus dromedarius]
Length=475

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G +Y        D+E 
Sbjct  328  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTVYLQHA----DEE-  382

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  383  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  437

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ R
Sbjct  438  LQWIDQNSALLQRKVEEVTR  457



>ref|XP_005515441.1| PREDICTED: nuclear pore glycoprotein p62-like, partial [Columba 
livia]
Length=347

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  200  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  254

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  255  ---RERTYKLAENIDAQLKRMAQDLKDITEHLNTSRGP--ADTSDPLQQICKILNAHMDS  309

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  310  LQWIDQNSAVLQRKVEEVTK  329



>ref|XP_002609193.1| hypothetical protein BRAFLDRAFT_125958 [Branchiostoma floridae]
 gb|EEN65203.1| hypothetical protein BRAFLDRAFT_125958 [Branchiostoma floridae]
Length=421

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 66/126 (52%), Gaps = 6/126 (5%)
 Frame = -2

Query  667  QASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTRDAMYEQAEFVE  488
            Q  L+ +L+ I   Q E++  L  +E   G + K +   +    A   R+  Y+ AE  +
Sbjct  285  QGRLDHELDFILAQQRELEDMLLPLE---GAV-KSQAPSIYQQHADLEREHTYQLAENTD  340

Query  487  REMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKAEDLSSRI  308
             ++++MM+ IK II  LN  Q G      +PL  + RILN  + SL W+D+ A  L  ++
Sbjct  341  AQLKRMMQDIKDIIEHLN--QSGAPNTSNDPLHQIARILNAHMDSLQWLDQNAAVLQRKV  398

Query  307  QKLARQ  290
             ++A+Q
Sbjct  399  DEVAKQ  404



>gb|KFO71976.1| Nuclear pore glycoprotein p62, partial [Cuculus canorus]
Length=447

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L++ L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  300  LHKEVEKVKLDQKRLDQDLDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  354

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  355  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGG--PADTSDPLQQICKILNAHMDS  409

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  410  LQWIDQNSAVLQRKVEEVTK  429



>ref|NP_001001989.1| uncharacterized protein LOC394934 [Xenopus (Silurana) tropicalis]
 gb|AAH75599.1| hypothetical protein LOC394934 [Xenopus (Silurana) tropicalis]
Length=552

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 77/141 (55%), Gaps = 14/141 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  E+ KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  405  LHREMEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  459

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K +I  LN + G    D  NPL  + +ILN  + S
Sbjct  460  ---REKTYKLAENIDAQLKRMAQDLKEVIEHLNTSAG--PGDAGNPLQQICKILNAHMDS  514

Query  352  LVWVDEKAEDLSSRIQKLARQ  290
            L W+D+ +  L  +++++ ++
Sbjct  515  LQWIDQNSALLQRKVEQVTKE  535



>ref|XP_005420008.1| PREDICTED: nuclear pore glycoprotein p62-like [Geospiza fortis]
Length=384

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  237  LHREVEKVKVDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQH----ADEE-  291

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  292  ---RERTYKLAENIDAQLKRMAQDLKDITEHLNTSRG--PADTSDPLQQICKILNAHMDS  346

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  347  LQWIDQNSAVLQRKVEEVTK  366



>ref|XP_006173846.1| PREDICTED: nuclear pore glycoprotein p62 [Camelus ferus]
 ref|XP_010945307.1| PREDICTED: nuclear pore glycoprotein p62 [Camelus bactrianus]
Length=510

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G +Y        D+E 
Sbjct  363  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTVYLQHA----DEE-  417

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  418  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  472

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ R
Sbjct  473  LQWIDQNSALLQRKVEEVTR  492



>ref|XP_003226470.2| PREDICTED: nucleoporin-62 C-terminal-like protein [Anolis carolinensis]
Length=599

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 79/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  452  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLVPLEESVKEQSGTIYLQHA----DEE-  506

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  507  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  561

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++++
Sbjct  562  LQWIDQNSALLQRKVEEVSK  581



>ref|XP_008529432.1| PREDICTED: nuclear pore glycoprotein p62 [Equus przewalskii]
Length=455

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G +Y        D+E 
Sbjct  308  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTVYLQHA----DEE-  362

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  363  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGG--PADTSDPLQQICKILNAHMDS  417

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  418  LQWIDQNSALLQRKVEEVTK  437



>ref|XP_007506780.1| PREDICTED: nuclear pore glycoprotein p62-like, partial [Monodelphis 
domestica]
Length=217

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 74/140 (53%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQ----SMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I   Q E+++ L     ++ E+ G IY        D+E 
Sbjct  70   LHREVEKVKLDQRRLDQELDFILAQQKELEELLAPLEDAVREQGGSIYLQH----ADEE-  124

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M   +K +I  LNA   G   D  +PL  V RILN    S
Sbjct  125  ---RERTYQLAETIDAQLKRMARDLKDVIEHLNA--AGGPPDAADPLQQVCRILNAHTDS  179

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  +++++A+
Sbjct  180  LQWVDQNSALLQRKVEEVAK  199



>ref|XP_006208499.1| PREDICTED: nuclear pore glycoprotein p62 [Vicugna pacos]
Length=510

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G +Y        D+E 
Sbjct  363  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTVYLQHA----DEE-  417

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  418  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  472

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ R
Sbjct  473  LQWIDQNSALLQRKVEEVTR  492



>ref|XP_007530689.1| PREDICTED: nucleoporin-62 C-terminal-like protein [Erinaceus 
europaeus]
Length=234

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 67/124 (54%), Gaps = 6/124 (5%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV KV + Q  LE +L+ + + Q E+++ L  +EE   +      +   D+E   T 
Sbjct  83   LHGEVEKVKQDQKRLENELDFVLSQQKELEEILIPLEESVNQQSGAASQQSTDEEHERT-  141

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
               Y+ AE ++ ++++M + +K +I  LN+  G   T   +PL  + +ILN  ++SL W+
Sbjct  142  ---YQSAETIDAQLKQMTQDLKDVIEYLNSFAGPANT--TDPLQQICKILNTHMNSLQWI  196

Query  340  DEKA  329
            D+ +
Sbjct  197  DKNS  200



>ref|XP_005641697.1| PREDICTED: nuclear pore glycoprotein p62 isoform X2 [Canis lupus 
familiaris]
 ref|XP_005641698.1| PREDICTED: nuclear pore glycoprotein p62 isoform X3 [Canis lupus 
familiaris]
 ref|XP_005641699.1| PREDICTED: nuclear pore glycoprotein p62 isoform X4 [Canis lupus 
familiaris]
Length=307

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 69/136 (51%), Gaps = 6/136 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV KV   Q  LE++L+ I + Q E++  L  +EE      KD+   +    A    
Sbjct  159  LHGEVEKVKLDQQRLEQELDFILSQQKELEDLLTPLEE----FVKDQSGSVYLQHADKVH  214

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
               Y  AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + SL W+
Sbjct  215  GKTYRLAENIDAQLKRMAQDLKDIIEHLNTF--GSPADTTDPLQQICKILNAHMDSLQWI  272

Query  340  DEKAEDLSSRIQKLAR  293
            ++ +  L  +++++ +
Sbjct  273  NQNSGMLQRKVEEVTQ  288



>ref|NP_001084339.1| nuclear pore complex glycoprotein p62 [Xenopus laevis]
 gb|AAB19954.1| nuclear pore complex glycoprotein p62 [Xenopus laevis]
 gb|AAI06601.1| IL4I1 protein [Xenopus laevis]
Length=547

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 77/141 (55%), Gaps = 14/141 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  E+ KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  400  LHREMEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  454

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K +I  LN + G    D  NPL  + +ILN  + S
Sbjct  455  ---REKTYKLAENIDAQLKRMAQDLKEVIEHLNTSAG--PGDASNPLQQICKILNAHMDS  509

Query  352  LVWVDEKAEDLSSRIQKLARQ  290
            L W+D+ +  L  +++++ ++
Sbjct  510  LQWIDQNSALLQRKVEQVTKE  530



>gb|KFO86807.1| Nuclear pore glycoprotein p62, partial [Buceros rhinoceros silvestris]
Length=331

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L++ L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  184  LHREVEKVKLDQKRLDQDLDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  238

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  239  ---RERTYKLAENIDAQLKRMAQDLKDITEHLNTSRGP--ADTSDPLQQICKILNAHMDS  293

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  294  LQWIDQNSAVLQRKVEEVTK  313



>ref|XP_010740237.1| PREDICTED: nuclear pore glycoprotein p62 [Larimichthys crocea]
Length=580

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  E+ KV   Q  L ++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  433  LHKEMEKVKLDQRRLNQELDFILSQQKELEDLLCPLEESVKEQSGTIYMQNT----DEE-  487

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE V+ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  488  ---RERTYKLAENVDAQLKRMSQDLKEIIEHLNTSSG--PADTSDPLQQICKILNTHMDS  542

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  R++++++
Sbjct  543  LQWIDQNSVLLQRRVEEVSK  562



>ref|XP_001975363.1| GG20600 [Drosophila erecta]
 gb|EDV55763.1| GG20600 [Drosophila erecta]
Length=390

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 75/137 (55%), Gaps = 14/137 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L   V KV   Q  L+++LE I T Q E++ +L  +E+E   + + + E          R
Sbjct  253  LNDAVEKVKTDQQVLDQELEFIATQQKELEDSLAPLEKEFVNLPRVDME----------R  302

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLN-ANQGGELTDGVNPLDVVVRILNNQLSSLVW  344
               Y   E ++ ++++M E +K II++LN AN+G + TD   P+  + +ILN  +SSL W
Sbjct  303  SQTYLMVENLDTQLKQMSEDLKEIIDNLNEANKGQDTTD---PIIQIGKILNAHMSSLQW  359

Query  343  VDEKAEDLSSRIQKLAR  293
            ++ ++ ++  ++  + +
Sbjct  360  IESQSTNICKKLDDIGK  376



>ref|XP_010129702.1| PREDICTED: nuclear pore glycoprotein p62, partial [Buceros rhinoceros 
silvestris]
Length=346

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 77/140 (55%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L++ L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  199  LHREVEKVKLDQKRLDQDLDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  253

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  254  ---RERTYKLAENIDAQLKRMAQDLKDITEHLNTSRGP--ADTSDPLQQICKILNAHMDS  308

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  309  LQWIDQNSAVLQRKVEEVTK  328



>ref|XP_008020640.1| hypothetical protein SETTUDRAFT_162123 [Setosphaeria turcica 
Et28A]
 gb|EOA91411.1| hypothetical protein SETTUDRAFT_162123 [Setosphaeria turcica 
Et28A]
Length=720

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 42/146 (29%), Positives = 69/146 (47%), Gaps = 13/146 (9%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYK-------DEREMLLD  542
            L S+  +     A +ERQL ++E +Q E+D  L   E+E   + K       +E     D
Sbjct  542  LYSKTFQAERDAAEVERQLTMMEENQQELDSYLDRYEKEIDNLMKMHGVSGKNESLRGPD  601

Query  541  DEAAYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGV--NPLDVVVRILN  368
             E    R+  Y+ AE ++  + ++ + +  +I  +N+        G   +PL  VVR+LN
Sbjct  602  QE----RERTYKLAEKLQDRLNELNKDLTDMIEEINSTSQTLSKTGKPDDPLTKVVRVLN  657

Query  367  NQLSSLVWVDEKAEDLSSRIQKLARQ  290
             QLS L  +D  A  L  +I K  R+
Sbjct  658  TQLSQLQLIDSGASQLQEKIAKAQRE  683



>gb|EPQ14626.1| Nuclear pore glycoprotein p62 [Myotis brandtii]
Length=340

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 75/143 (52%), Gaps = 20/143 (14%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIY---KDEREMLLD  542
            L  EV KV   Q  L+ +L+ I + Q E++  L  +EE    ++G +Y    DE+     
Sbjct  193  LHREVEKVKLDQKRLDEELDFILSQQKELEDLLSPLEESVKEQSGTVYLQHADEK-----  247

Query  541  DEAAYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQ  362
                  R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  
Sbjct  248  ------REKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGGP--ADTSDPLQQICKILNAH  299

Query  361  LSSLVWVDEKAEDLSSRIQKLAR  293
            + SL W+D+ +  L  +++++ +
Sbjct  300  MDSLQWIDQNSALLQRKVEEVTK  322



>ref|XP_005692911.1| PREDICTED: nuclear pore glycoprotein p62 [Capra hircus]
Length=291

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 73/136 (54%), Gaps = 6/136 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE      K++   +    A   R
Sbjct  144  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESV----KEQSGTVHLQHADEER  199

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            +  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + SL W+
Sbjct  200  EKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGGP--ADTSDPLQQICKILNAHMDSLQWI  257

Query  340  DEKAEDLSSRIQKLAR  293
            D+ +  L  +++++ +
Sbjct  258  DQSSALLQRKVEEVTK  273



>ref|XP_004672270.1| PREDICTED: nuclear pore glycoprotein p62 [Jaculus jaculus]
Length=524

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  377  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  431

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN   G    D  +PL  + +ILN  + S
Sbjct  432  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTTGG--PADTSDPLQQICKILNAHMDS  486

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  ++++ +R
Sbjct  487  LQWIDQNSALLQRKVEEASR  506



>emb|CAA41411.1| nucleoporin p62 [Homo sapiens]
Length=522

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 74/136 (54%), Gaps = 6/136 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    + K++R  +    A   R
Sbjct  375  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEE----LVKEQRATIYLQHADEER  430

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
               Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + SL W+
Sbjct  431  QKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMDSLQWI  488

Query  340  DEKAEDLSSRIQKLAR  293
            D+ +  L  +++++ +
Sbjct  489  DQNSALLQRKVEEVTK  504



>ref|XP_009649198.1| nuclear pore glycoprotein p62 [Verticillium dahliae VdLs.17]
 gb|EGY23018.1| nuclear pore glycoprotein p62 [Verticillium dahliae VdLs.17]
Length=721

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 70/136 (51%), Gaps = 17/136 (13%)
 Frame = -2

Query  658  LERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAA---YTRDAMYEQAEFV-  491
            +ERQL  +E+ QDE+++ L   E E   ++   R+M   +  A     R+  Y+ AE + 
Sbjct  569  IERQLLSVESQQDELEEWLNRYEGEVKEMF--SRQMGQGETLAGPDQERERTYKLAEKLT  626

Query  490  ------EREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWVDEKA  329
                   R++ KM+++I  I  +++     E     +PL  +VR+LN  L+ L W+D+ A
Sbjct  627  QHLDEKSRDLSKMVKEINEISGTMSKGTKPE-----DPLSQIVRVLNGHLTQLQWIDQNA  681

Query  328  EDLSSRIQKLARQGSS  281
              L +++    + G++
Sbjct  682  AALQAKVSAAQKTGNN  697



>ref|XP_004061257.1| PREDICTED: nuclear pore glycoprotein p62 isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004061258.1| PREDICTED: nuclear pore glycoprotein p62 isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004061259.1| PREDICTED: nuclear pore glycoprotein p62 isoform 3 [Gorilla gorilla 
gorilla]
 ref|XP_004061260.1| PREDICTED: nuclear pore glycoprotein p62 isoform 4 [Gorilla gorilla 
gorilla]
 ref|XP_004061261.1| PREDICTED: nuclear pore glycoprotein p62 isoform 5 [Gorilla gorilla 
gorilla]
 ref|XP_004061262.1| PREDICTED: nuclear pore glycoprotein p62 isoform 6 [Gorilla gorilla 
gorilla]
 ref|XP_004061263.1| PREDICTED: nuclear pore glycoprotein p62 isoform 7 [Gorilla gorilla 
gorilla]
Length=522

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  375  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  429

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  430  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMDS  484

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  485  LQWIDQNSALLQRKVEEVTK  504



>ref|XP_007546536.1| PREDICTED: nuclear pore glycoprotein p62 [Poecilia formosa]
Length=553

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 79/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  E+ KV   Q  L ++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  406  LHKELEKVKLDQRRLNQELDFILSQQKELEDLLCPLEESVKEQSGTIYMQNA----DEE-  460

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE V+ ++++M + +K II+ LN + G    D  +PL  + +ILN  + S
Sbjct  461  ---RERTYKLAENVDAQLKRMSQDLKEIIDHLNTSSG--PADTSDPLQQICKILNAHMDS  515

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  R++++++
Sbjct  516  LQWIDQNSVLLQRRVEEVSK  535



>ref|XP_852888.3| PREDICTED: nuclear pore glycoprotein p62 isoform X6 [Canis lupus 
familiaris]
Length=301

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 69/136 (51%), Gaps = 6/136 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV KV   Q  LE++L+ I + Q E++  L  +EE      KD+   +    A    
Sbjct  153  LHGEVEKVKLDQQRLEQELDFILSQQKELEDLLTPLEE----FVKDQSGSVYLQHADKVH  208

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
               Y  AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + SL W+
Sbjct  209  GKTYRLAENIDAQLKRMAQDLKDIIEHLNT--FGSPADTTDPLQQICKILNAHMDSLQWI  266

Query  340  DEKAEDLSSRIQKLAR  293
            ++ +  L  +++++ +
Sbjct  267  NQNSGMLQRKVEEVTQ  282



>ref|XP_004440362.1| PREDICTED: nuclear pore glycoprotein p62 [Ceratotherium simum 
simum]
Length=514

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G +Y        D+E 
Sbjct  367  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTVYLQHA----DEE-  421

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN + G    D  +PL  + +ILN  + S
Sbjct  422  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGG--PADTSDPLQQICKILNAHMDS  476

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ R
Sbjct  477  LQWIDQNSALLQRKVEEVTR  496



>ref|XP_005641696.1| PREDICTED: nuclear pore glycoprotein p62 isoform X1 [Canis lupus 
familiaris]
Length=334

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 69/136 (51%), Gaps = 6/136 (4%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV KV   Q  LE++L+ I + Q E++  L  +EE      KD+   +    A    
Sbjct  186  LHGEVEKVKLDQQRLEQELDFILSQQKELEDLLTPLEE----FVKDQSGSVYLQHADKVH  241

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
               Y  AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + SL W+
Sbjct  242  GKTYRLAENIDAQLKRMAQDLKDIIEHLNTF--GSPADTTDPLQQICKILNAHMDSLQWI  299

Query  340  DEKAEDLSSRIQKLAR  293
            ++ +  L  +++++ +
Sbjct  300  NQNSGMLQRKVEEVTQ  315



>ref|XP_003316568.1| PREDICTED: nuclear pore glycoprotein p62 [Pan troglodytes]
 ref|XP_003316572.1| PREDICTED: nuclear pore glycoprotein p62 [Pan troglodytes]
 ref|XP_003316577.1| PREDICTED: nuclear pore glycoprotein p62 [Pan troglodytes]
 ref|XP_009434342.1| PREDICTED: nuclear pore glycoprotein p62 [Pan troglodytes]
Length=527

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  380  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  434

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  435  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMDS  489

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  490  LQWIDQNSALLQRKVEEVTK  509



>ref|XP_003814399.1| PREDICTED: nuclear pore glycoprotein p62 [Pan paniscus]
 ref|XP_003814400.1| PREDICTED: nuclear pore glycoprotein p62 [Pan paniscus]
 ref|XP_008965241.1| PREDICTED: nuclear pore glycoprotein p62 [Pan paniscus]
 ref|XP_008965242.1| PREDICTED: nuclear pore glycoprotein p62 [Pan paniscus]
Length=528

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  381  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  435

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  436  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMDS  490

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  491  LQWIDQNSALLQRKVEEVTK  510



>ref|XP_001846021.1| nuclear pore glycoprotein p62 [Culex quinquefasciatus]
 gb|EDS42376.1| nuclear pore glycoprotein p62 [Culex quinquefasciatus]
Length=316

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 72/136 (53%), Gaps = 12/136 (9%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L   V KV   Q ++E++LE I     E+++ +  +EEE  +I + + E          R
Sbjct  173  LNDAVDKVKAEQVAMEQELEFITAQHTELEECIIPLEEELSKIVQVDIE----------R  222

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
               Y  AE ++ ++++M E +K +I  LN  +  + +D  +PL  + +ILN  ++SL W+
Sbjct  223  GQTYSMAETLDSQLKQMSEDLKEVIEHLN--ESNKYSDPSDPLVQIGKILNAHMNSLQWI  280

Query  340  DEKAEDLSSRIQKLAR  293
            +     +++R++ + +
Sbjct  281  ESSTSGIANRLEDIGK  296



>ref|XP_006890006.1| PREDICTED: nuclear pore glycoprotein p62-like [Elephantulus edwardii]
Length=221

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEAGRIYKDEREMLLDDEAAYTR  521
            L  EV K+ + Q  LE++L+ I + Q+E++  L  +EE      KD+ E      A   R
Sbjct  48   LHGEVEKMKKEQKRLEQELDFILSQQNELEDLLIPLEESV----KDQSEPAYLQYADEER  103

Query  520  DAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSSLVWV  341
            D  Y+ AE ++ ++++M + +K II  LN  Q     D  +PL  V +ILN  + SL  +
Sbjct  104  DRTYKLAENIDTQLKQMAQDLKDIIEHLNTFQSP--ADNTDPLQQVCKILNAHMDSLHRI  161

Query  340  DEKA  329
            D  +
Sbjct  162  DHNS  165



>gb|KFV73131.1| Nuclear pore glycoprotein p62, partial [Picoides pubescens]
Length=456

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  309  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  363

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  364  ---REKTYKLAENIDAQLKRMAQDLKDITEHLNTSRG--PADTSDPLQQICKILNAHMDS  418

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  419  LQWIDQNSAVLQRKVEEVTK  438



>ref|XP_006986271.1| PREDICTED: nuclear pore glycoprotein p62 isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006986272.1| PREDICTED: nuclear pore glycoprotein p62 isoform X2 [Peromyscus 
maniculatus bairdii]
Length=520

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 75/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  373  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTIYLQHA----DEE-  427

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  ++ AE ++ ++++M + +K II  LN    G   D  +PL  + +ILN  + S
Sbjct  428  ---REKTFKLAENIDAQLKRMAQDLKDIIEHLN--MAGGPADTSDPLQQICKILNAHMDS  482

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L WVD+ +  L  R+++ +R
Sbjct  483  LQWVDQSSALLQRRVEEASR  502



>ref|XP_004409969.1| PREDICTED: nuclear pore glycoprotein p62 [Odobenus rosmarus divergens]
Length=532

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G +Y        D+E 
Sbjct  385  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKEQSGTVYLQHA----DEE-  439

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  440  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GGPADTSDPLQQICKILNAHMDS  494

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  495  LQWIDQNSALLQRKVEEVTK  514



>ref|XP_010114860.1| PREDICTED: nuclear pore glycoprotein p62, partial [Chlamydotis 
macqueenii]
Length=485

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  338  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  392

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  393  ---RERTYKLAENIDAQLKRMAQDLKDITEHLNTSRG--PADTSDPLQQICKILNAHMDS  447

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  448  LQWIDQNSAVLQRKVEEVTK  467



>ref|XP_004769067.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X4 [Mustela 
putorius furo]
 ref|XP_004827657.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X4 [Mustela 
putorius furo]
Length=275

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 74/140 (53%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  LE++L+ I + Q E++  L  +EE     +G  Y      L D++ 
Sbjct  127  LHGEVEKVKLDQQRLEQELDFILSQQKELENLLTPLEEFVKDHSGAPYLQ----LADEDH  182

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
              T    Y+ AE ++ ++++M + +K I+  LN  + G   D  +PL  + +ILN  + S
Sbjct  183  GKT----YKLAENIDAQLKRMAQDLKDIVEHLN--RVGSPADTTDPLQQICKILNAHMDS  236

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+++ +  L  +++++ R
Sbjct  237  LQWINQNSGMLQKKVEEVTR  256



>gb|KFP40131.1| Nuclear pore glycoprotein p62, partial [Chlamydotis macqueenii]
Length=475

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  328  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  382

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  383  ---RERTYKLAENIDAQLKRMAQDLKDITEHLNTSRG--PADTSDPLQQICKILNAHMDS  437

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  438  LQWIDQNSAVLQRKVEEVTK  457



>ref|XP_009905646.1| PREDICTED: nucleoporin-62 C-terminal-like protein [Picoides pubescens]
Length=482

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 78/140 (56%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKAL----QSMEEEAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L    +S++E++G IY        D+E 
Sbjct  335  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHA----DEE-  389

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K I   LN ++G    D  +PL  + +ILN  + S
Sbjct  390  ---REKTYKLAENIDAQLKRMAQDLKDITEHLNTSRG--PADTSDPLQQICKILNAHMDS  444

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  445  LQWIDQNSAVLQRKVEEVTK  464



>ref|XP_005654342.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X2 [Sus 
scrofa]
 ref|XP_005654343.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X3 [Sus 
scrofa]
 ref|XP_005654344.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X4 [Sus 
scrofa]
 ref|XP_005654345.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X5 [Sus 
scrofa]
 ref|XP_005654346.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X6 [Sus 
scrofa]
 ref|XP_005654347.1| PREDICTED: nuclear pore glycoprotein p62-like isoform X7 [Sus 
scrofa]
Length=306

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 72/143 (50%), Gaps = 21/143 (15%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEEEA----GRIY---KDEREMLLD  542
            L  EV KV   Q  LE++L+ I + Q E++  L  +EE      G +Y    DERE    
Sbjct  159  LHGEVEKVKLDQKRLEKELDFILSQQKELEDLLIPLEESVKDQNGSVYLQHTDERE----  214

Query  541  DEAAYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQ  362
                    + Y+ AE ++ ++++M + +K II  LN    G   D   PL  + +ILN  
Sbjct  215  --------STYKLAENIDAQLKRMAQDLKDIIEHLNTF--GSPADTTEPLQQICKILNAH  264

Query  361  LSSLVWVDEKAEDLSSRIQKLAR  293
            + SL W+++ +  L  +++++ +
Sbjct  265  MDSLQWINQTSGMLQRKVEEVTQ  287



>ref|NP_036478.2| nuclear pore glycoprotein p62 [Homo sapiens]
 ref|NP_057637.2| nuclear pore glycoprotein p62 [Homo sapiens]
 ref|NP_714940.1| nuclear pore glycoprotein p62 [Homo sapiens]
 ref|NP_714941.1| nuclear pore glycoprotein p62 [Homo sapiens]
 ref|NP_001180286.1| nuclear pore glycoprotein p62 [Homo sapiens]
 sp|P37198.3|NUP62_HUMAN RecName: Full=Nuclear pore glycoprotein p62; AltName: Full=62 
kDa nucleoporin; AltName: Full=Nucleoporin Nup62 [Homo sapiens]
 gb|AAH14842.1| Nucleoporin 62kDa [Homo sapiens]
 gb|AAH50717.1| Nucleoporin 62kDa [Homo sapiens]
 emb|CAG46522.1| NUP62 [Homo sapiens]
 gb|AAI01105.1| Nucleoporin 62kDa [Homo sapiens]
 gb|EAW52576.1| hCG19665, isoform CRA_a [Homo sapiens]
 gb|EAW52577.1| hCG19665, isoform CRA_a [Homo sapiens]
 gb|EAW52578.1| hCG19665, isoform CRA_a [Homo sapiens]
 gb|EAW52579.1| hCG19665, isoform CRA_a [Homo sapiens]
 dbj|BAG54257.1| unnamed protein product [Homo sapiens]
 gb|AIC56089.1| NUP62, partial [synthetic construct]
Length=522

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  375  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  429

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  430  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMDS  484

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  485  LQWIDQNSALLQRKVEEVTK  504



>emb|CAB82399.1| hypothetical protein [Homo sapiens]
 gb|AAH03663.1| Nucleoporin 62kDa [Homo sapiens]
 gb|AAH95410.1| Nucleoporin 62kDa [Homo sapiens]
 gb|AAI01107.1| Nucleoporin 62kDa [Homo sapiens]
 gb|AAI01106.1| Nucleoporin 62kDa [Homo sapiens]
 gb|AAI01108.1| Nucleoporin 62kDa [Homo sapiens]
 emb|CAL38660.1| hypothetical protein [synthetic construct]
 gb|ABM83517.1| nucleoporin 62kDa [synthetic construct]
 gb|ABM87856.1| nucleoporin 62kDa [synthetic construct]
 dbj|BAG72665.1| nucleoporin 62kDa [synthetic construct]
 gb|AIC56088.1| NUP62, partial [synthetic construct]
 gb|AIC62715.1| NUP62, partial [synthetic construct]
Length=522

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 14/140 (10%)
 Frame = -2

Query  700  LESEVAKVVETQASLERQLELIETHQDEVDKALQSMEE----EAGRIYKDEREMLLDDEA  533
            L  EV KV   Q  L+++L+ I + Q E++  L  +EE    ++G IY        D+E 
Sbjct  375  LHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHA----DEE-  429

Query  532  AYTRDAMYEQAEFVEREMEKMMEQIKSIINSLNANQGGELTDGVNPLDVVVRILNNQLSS  353
               R+  Y+ AE ++ ++++M + +K II  LN +  G   D  +PL  + +ILN  + S
Sbjct  430  ---REKTYKLAENIDAQLKRMAQDLKDIIEHLNTS--GAPADTSDPLQQICKILNAHMDS  484

Query  352  LVWVDEKAEDLSSRIQKLAR  293
            L W+D+ +  L  +++++ +
Sbjct  485  LQWIDQNSALLQRKVEEVTK  504



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320